BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5989

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248267.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    200   6e-60   Solanum lycopersicum
ref|XP_006362955.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    199   7e-60   
emb|CDP05912.1|  unnamed protein product                                194   1e-57   Coffea canephora [robusta coffee]
ref|XP_010060550.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    192   8e-57   Eucalyptus grandis [rose gum]
ref|XP_009789468.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    191   9e-57   Nicotiana sylvestris
ref|XP_011082674.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    191   1e-56   Sesamum indicum [beniseed]
ref|XP_002284913.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    190   3e-56   Vitis vinifera
gb|EYU44938.1|  hypothetical protein MIMGU_mgv1a0108731mg               186   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_009606581.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    189   6e-56   Nicotiana tomentosiformis
ref|XP_009623871.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    187   9e-56   Nicotiana tomentosiformis
ref|XP_006370268.1|  cytidylyltransferase family protein                189   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002517281.1|  cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidy...    188   1e-55   Ricinus communis
gb|KFK35754.1|  hypothetical protein AALP_AA4G032100                    188   2e-55   Arabis alpina [alpine rockcress]
ref|XP_007021424.1|  Nucleotide-diphospho-sugar transferases supe...    189   2e-55   
ref|XP_006377770.1|  hypothetical protein POPTR_0011s12080g             188   2e-55   
ref|XP_011004626.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    188   2e-55   Populus euphratica
ref|XP_002316900.1|  cytidylyltransferase family protein                188   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_009784749.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    188   2e-55   Nicotiana sylvestris
ref|XP_012084951.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    188   2e-55   Jatropha curcas
ref|NP_175708.2|  3-deoxy-manno-octulosonate cytidylyltransferase       187   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305471.1|  hypothetical protein CARUB_v10009902mg             187   3e-55   Capsella rubella
ref|XP_011029470.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    187   3e-55   Populus euphratica
ref|XP_006451888.1|  hypothetical protein CICLE_v10009061mg             186   4e-55   
ref|XP_006451887.1|  hypothetical protein CICLE_v10009061mg             185   4e-55   
emb|CDY47563.1|  BnaC03g69060D                                          187   5e-55   Brassica napus [oilseed rape]
ref|XP_010479831.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    187   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010242912.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    187   6e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010500927.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    187   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009107014.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    186   8e-55   Brassica rapa
ref|XP_006451890.1|  hypothetical protein CICLE_v10009061mg             186   8e-55   Citrus clementina [clementine]
emb|CDY02531.1|  BnaA08g01380D                                          186   8e-55   
ref|XP_006451889.1|  hypothetical protein CICLE_v10009061mg             186   1e-54   
ref|XP_006392844.1|  hypothetical protein EUTSA_v10011698mg             186   1e-54   Eutrema salsugineum [saltwater cress]
ref|XP_002894417.1|  cytidylyltransferase family                        186   2e-54   Arabidopsis lyrata subsp. lyrata
gb|KGN56240.1|  hypothetical protein Csa_3G104930                       185   2e-54   Cucumis sativus [cucumbers]
ref|XP_010462154.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    185   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003526068.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    185   3e-54   Glycine max [soybeans]
ref|XP_009124899.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    184   3e-54   Brassica rapa
gb|KHN37186.1|  3-deoxy-manno-octulosonate cytidylyltransferase         185   3e-54   Glycine soja [wild soybean]
ref|XP_009124898.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    184   4e-54   Brassica rapa
emb|CDY69672.1|  BnaA05g35640D                                          184   4e-54   Brassica napus [oilseed rape]
ref|XP_004133708.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    184   5e-54   Cucumis sativus [cucumbers]
ref|XP_003540098.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    185   5e-54   Glycine max [soybeans]
ref|XP_010545826.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    184   8e-54   Tarenaya hassleriana [spider flower]
ref|XP_008452260.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    183   2e-53   Cucumis melo [Oriental melon]
ref|XP_011098319.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    184   3e-53   
gb|KJB61818.1|  hypothetical protein B456_009G389800                    182   4e-53   Gossypium raimondii
ref|XP_004514100.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    182   4e-53   Cicer arietinum [garbanzo]
ref|XP_010694996.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    182   5e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH41941.1|  3-deoxy-manno-octulosonate cytidylyltransferase         188   6e-53   Medicago truncatula
ref|XP_010272461.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    181   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_002534236.1|  cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidy...    180   2e-52   Ricinus communis
ref|XP_008366929.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    180   3e-52   Malus domestica [apple tree]
ref|XP_007133176.1|  hypothetical protein PHAVU_011G157900g             180   4e-52   Phaseolus vulgaris [French bean]
emb|CDY55874.1|  BnaC06g41770D                                          184   4e-52   Brassica napus [oilseed rape]
ref|XP_002263680.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    179   5e-52   Vitis vinifera
ref|XP_006849964.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    179   7e-52   Amborella trichopoda
ref|XP_008226639.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    179   8e-52   Prunus mume [ume]
ref|XP_007213820.1|  hypothetical protein PRUPE_ppa009246mg             179   9e-52   Prunus persica
ref|XP_009356824.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    178   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_009351030.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    177   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_010064449.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    175   5e-51   
ref|XP_004295148.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    177   5e-51   Fragaria vesca subsp. vesca
ref|XP_010919659.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    176   1e-50   Elaeis guineensis
ref|XP_010919652.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    176   1e-50   Elaeis guineensis
ref|XP_008386160.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    176   1e-50   Malus domestica [apple tree]
ref|XP_008809046.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    176   2e-50   Phoenix dactylifera
ref|XP_008225094.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    175   3e-50   Prunus mume [ume]
ref|XP_008810228.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    174   3e-50   Phoenix dactylifera
gb|ABK23054.1|  unknown                                                 174   3e-50   Picea sitchensis
ref|XP_006654782.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    174   9e-50   Oryza brachyantha
ref|XP_002441511.1|  hypothetical protein SORBIDRAFT_09g028380          173   1e-49   Sorghum bicolor [broomcorn]
ref|XP_010924427.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   5e-49   Elaeis guineensis
ref|XP_009406254.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    172   5e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC79690.1|  hypothetical protein OsI_20971                          172   5e-49   Oryza sativa Indica Group [Indian rice]
ref|NP_001056314.1|  Os05g0561500                                       171   6e-49   
ref|XP_010108191.1|  3-deoxy-manno-octulosonate cytidylyltransferase    172   6e-49   
ref|XP_007211713.1|  hypothetical protein PRUPE_ppa009339mg             171   7e-49   Prunus persica
gb|EPS72950.1|  hypothetical protein M569_01801                         169   2e-48   Genlisea aurea
ref|XP_004961235.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    169   3e-48   Setaria italica
gb|AFW81112.1|  hypothetical protein ZEAMMB73_836886                    168   6e-48   
ref|NP_001105657.1|  CMP-KDO synthetase1 precursor                      169   8e-48   Zea mays [maize]
gb|ACG42455.1|  3-deoxy-manno-octulosonate cytidylyltransferase         168   1e-47   Zea mays [maize]
emb|CAN72248.1|  hypothetical protein VITISV_008336                     166   4e-47   Vitis vinifera
ref|XP_003567908.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    160   6e-45   Brachypodium distachyon [annual false brome]
dbj|BAK04151.1|  predicted protein                                      160   8e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN62581.1|  hypothetical protein VITISV_036570                     160   2e-44   Vitis vinifera
ref|XP_010231033.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    160   5e-44   Brachypodium distachyon [annual false brome]
gb|EMT25203.1|  hypothetical protein F775_52244                         156   1e-43   
emb|CAB89847.1|  CMP-KDO synthetase                                     155   2e-43   Zea mays [maize]
ref|XP_001784950.1|  predicted protein                                  155   7e-43   
ref|XP_002981117.1|  hypothetical protein SELMODRAFT_113793             154   1e-42   
ref|XP_002982588.1|  hypothetical protein SELMODRAFT_116934             153   3e-42   
gb|AAY34906.1|  CMP-KDO synthetase                                      134   9e-37   Prunus armeniaca
ref|XP_005843072.1|  hypothetical protein CHLNCDRAFT_33280              134   1e-34   Chlorella variabilis
ref|XP_005648194.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    134   2e-34   Coccomyxa subellipsoidea C-169
ref|XP_011396550.1|  3-deoxy-manno-octulosonate cytidylyltransferase    128   2e-32   Auxenochlorella protothecoides
gb|KDO74064.1|  hypothetical protein CISIN_1g0225552mg                  119   9e-31   Citrus sinensis [apfelsine]
gb|KDO74063.1|  hypothetical protein CISIN_1g0225552mg                  121   1e-30   Citrus sinensis [apfelsine]
ref|XP_010910968.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    122   1e-30   Elaeis guineensis
gb|KDO74061.1|  hypothetical protein CISIN_1g0225552mg                  121   2e-30   Citrus sinensis [apfelsine]
gb|KCW67327.1|  hypothetical protein EUGRSUZ_F01114                     120   2e-30   Eucalyptus grandis [rose gum]
ref|WP_045997502.1|  3-deoxy-manno-octulosonate cytidylyltransferase    122   3e-30   Loktanella sp. S4079
ref|WP_039711500.1|  3-deoxy-manno-octulosonate cytidylyltransferase    121   4e-30   
ref|WP_038075781.1|  3-deoxy-manno-octulosonate cytidylyltransferase    121   5e-30   Thioclava pacifica
ref|WP_038068247.1|  3-deoxy-manno-octulosonate cytidylyltransferase    120   1e-29   Thioclava dalianensis
ref|WP_023937494.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    119   1e-29   Porphyromonas crevioricanis
ref|WP_015814489.1|  3-deoxy-manno-octulosonate cytidylyltransferase    119   3e-29   Dyadobacter fermentans
ref|WP_026625033.1|  3-deoxy-manno-octulosonate cytidylyltransferase    118   4e-29   Dysgonomonas capnocytophagoides
ref|WP_038145601.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   1e-28   Thioclava atlantica
ref|WP_028092696.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   1e-28   Pseudodonghicola xiamenensis
ref|WP_043868136.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   1e-28   Celeribacter indicus
ref|WP_040178930.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   1e-28   Phaeobacter sp. S60
gb|ACN28946.1|  unknown                                                 115   1e-28   Zea mays [maize]
ref|WP_022456342.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   2e-28   
ref|WP_013455330.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   2e-28   Marivirga tractuosa
ref|WP_040175228.1|  3-deoxy-manno-octulosonate cytidylyltransferase    117   3e-28   Phaeobacter piscinae
ref|WP_037505655.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   3e-28   
ref|WP_014881488.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   3e-28   Phaeobacter inhibens
ref|WP_010528306.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   3e-28   Thermophagus xiamenensis
ref|WP_014876334.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   3e-28   Phaeobacter inhibens
ref|WP_035255598.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   3e-28   Actibacterium mucosum
sp|A6L9D4.1|KDSB_PARD8  RecName: Full=3-deoxy-manno-octulosonate ...    116   3e-28   Parabacteroides distasonis ATCC 8503
ref|WP_005855678.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    116   4e-28   Parabacteroides
gb|EEU51150.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase       116   4e-28   Parabacteroides sp. D13
ref|WP_005865386.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    116   4e-28   Parabacteroides
ref|WP_019954246.1|  3-deoxy-manno-octulosonate cytidylyltransferase    116   5e-28   Yoonia vestfoldensis
gb|EEY84280.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase       115   5e-28   Bacteroides sp. 2_1_33B
ref|WP_015027427.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   5e-28   Emticicia oligotrophica
ref|WP_034531370.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   6e-28   Bacteroides sp. 2_1_33B
gb|KEJ86014.1|  3-deoxy-manno-octulosonate cytidylyltransferase         115   6e-28   Porphyromonas sp. 31_2
gb|EFI07282.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase       115   6e-28   Bacteroides sp. 3_1_19
ref|WP_034527937.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    115   6e-28   Bacteroidales
ref|WP_024098828.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetase      115   6e-28   Phaeobacter gallaeciensis
ref|WP_016777332.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   6e-28   Anaerophaga thermohalophila
ref|WP_008282626.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   7e-28   Roseovarius sp. TM1035
ref|WP_039843135.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   8e-28   
ref|WP_026350652.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   1e-27   Dyadobacter beijingensis
ref|WP_013385423.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   1e-27   Ketogulonicigenium vulgare
gb|KKB50181.1|  3-deoxy-manno-octulosonate cytidylyltransferase         114   1e-27   Parabacteroides sp. HGS0025
ref|WP_010421691.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   1e-27   Anaerophaga thermohalophila
ref|XP_007508518.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   1e-27   Bathycoccus prasinos
ref|WP_038128468.1|  3-deoxy-manno-octulosonate cytidylyltransferase    115   1e-27   Thioclava indica
ref|WP_045753550.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   2e-27   Sphingobacterium sp. PM2-P1-29
ref|WP_031525651.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   2e-27   Dyadobacter crusticola
ref|WP_043747234.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   2e-27   Pseudooceanicola atlanticus
ref|XP_005840663.1|  hypothetical protein GUITHDRAFT_91881              113   2e-27   Guillardia theta CCMP2712
ref|WP_037275977.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   2e-27   Roseovarius mucosus
ref|WP_015808397.1|  3-deoxy-manno-octulosonate cytidylyltransferase    113   4e-27   Pedobacter heparinus
ref|WP_015497229.1|  3-deoxy-manno-octulosonate cytidylyltransferase    114   4e-27   Octadecabacter arcticus
ref|WP_013446517.1|  3-deoxy-manno-octulosonate cytidylyltransferase    113   4e-27   Paludibacter propionicigenes
ref|WP_009570326.1|  3-deoxy-manno-octulosonate cytidylyltransferase    113   4e-27   Celeribacter baekdonensis
ref|XP_001758202.1|  predicted protein                                  111   4e-27   
ref|WP_008561601.1|  3-deoxy-manno-octulosonate cytidylyltransferase    113   6e-27   Rhodobacteraceae
ref|WP_045089745.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   6e-27   Porphyromonadaceae
ref|WP_015501886.1|  3-deoxy-manno-octulosonate cytidylyltransferase    113   6e-27   Octadecabacter antarcticus
ref|WP_009159832.1|  3-deoxy-manno-octulosonate cytidylyltransferase    113   6e-27   Thalassobium sp. R2A62
ref|WP_039533129.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   8e-27   Ruegeria sp. ANG-S4
ref|WP_035405825.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   8e-27   Chlamydia suis
ref|WP_036556332.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   8e-27   Oceanicola sp. MCTG156(1a)
dbj|GAO28025.1|  3-deoxy-manno-octulosonate cytidylyltransferase        112   9e-27   Geofilum rubicundum JCM 15548
ref|WP_028728574.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   9e-27   Parabacteroides gordonii
ref|WP_009504025.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   Citreicella sp. 357
ref|WP_013666771.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   Sphingobacterium sp. 21
ref|WP_039472359.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   Pedobacter kyungheensis
ref|WP_029274713.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   
ref|WP_028979558.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   Sporocytophaga myxococcoides
ref|WP_039540163.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   Ruegeria sp. ANG-R
ref|WP_035249396.1|  3-deoxy-manno-octulosonate cytidylyltransferase    112   1e-26   Actibacterium atlanticum
ref|WP_040299194.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   
ref|WP_007811891.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   Roseobacter sp. AzwK-3b
ref|WP_039423526.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   Porphyromonas gulae
ref|WP_005651239.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   Parabacteroides merdae
ref|WP_039432450.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   Porphyromonas gulae
ref|WP_039417760.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    111   2e-26   Porphyromonas
ref|WP_008155288.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   Parabacteroides johnsonii
ref|WP_008150585.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   2e-26   Parabacteroides johnsonii
gb|EOR95637.1|  3-deoxy-manno-octulosonate cytidylyltransferase         111   2e-26   Arcticibacter svalbardensis MN12-7
ref|WP_026462832.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   3e-26   Adhaeribacter aquaticus
ref|WP_039434264.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   3e-26   Porphyromonas gulae
ref|WP_043140282.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   3e-26   Mameliella alba
ref|WP_024810562.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   3e-26   Oceanicola sp. HL-35
ref|WP_018965264.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   3e-26   Porphyromonas gulae
ref|WP_005641144.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    111   3e-26   Parabacteroides merdae
ref|WP_045467694.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   4e-26   Sporocytophaga myxococcoides
ref|WP_013934884.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   4e-26   
ref|WP_040650434.1|  3-deoxy-manno-octulosonate cytidylyltransferase    111   4e-26   Roseovarius sp. 217
gb|EAQ24665.1|  3-deoxy-manno-octulosonate cytidylyltransferase         110   5e-26   Roseovarius sp. 217
ref|WP_029285309.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   5e-26   
ref|WP_003007365.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   5e-26   Sphingobacterium spiritivorum
ref|WP_026630897.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   5e-26   Dyadobacter alkalitolerans
ref|WP_010138030.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   5e-26   Oceanicola sp. S124
ref|WP_010800182.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    110   5e-26   Parabacteroides
ref|WP_007657616.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   6e-26   Parabacteroides goldsteinii
ref|WP_028714048.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    110   6e-26   Paracoccus
ref|WP_005979887.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   6e-26   Ruegeria lacuscaerulensis
ref|WP_008205584.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   6e-26   Roseobacter sp. SK209-2-6
ref|WP_022700420.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   7e-26   Oceanicaulis alexandrii
ref|WP_013631698.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   7e-26   Pseudopedobacter saltans
ref|WP_037247226.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   8e-26   Roseovarius sp. MCTG156(2b)
ref|WP_028955684.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   8e-26   Sulfitobacter sp. 20_GPM-1509m
ref|WP_037922448.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   8e-26   Sulfitobacter pseudonitzschiae
ref|WP_007118349.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   9e-26   Sulfitobacter indolifex
ref|WP_021188746.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   9e-26   Sphingobacterium sp. IITKGP-BTPF85
ref|WP_037314625.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   9e-26   Ruegeria halocynthiae
ref|WP_023451750.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   9e-26   Asticcacaulis sp. AC460
ref|WP_039162639.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   1e-25   Leisingera sp. ANG-M1
ref|WP_008232471.1|  3-deoxy-manno-octulosonate cytidylyltransferase    110   1e-25   Roseobacter sp. CCS2
ref|WP_002994153.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   1e-25   Sphingobacterium spiritivorum
ref|WP_037359120.1|  hypothetical protein                               109   1e-25   Schleiferia thermophila
ref|XP_010320532.1|  PREDICTED: 3-deoxy-manno-octulosonate cytidy...    105   1e-25   
ref|WP_045680503.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   1e-25   
ref|WP_009813430.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   1e-25   Roseovarius nubinhibens
ref|WP_026903068.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   2e-25   Pedobacter glucosidilyticus
ref|WP_010665507.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   2e-25   Marinilabilia salmonicolor
ref|WP_018622429.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   2e-25   Spirosoma luteum
ref|WP_009801887.1|  3-deoxy-manno-octulosonate cytidylyltransferase    109   2e-25   Oceanicaulis sp. HTCC2633
ref|WP_027420620.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   2e-25   Crocinitomix catalasitica
emb|CBL29028.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase      108   2e-25   Fretibacterium fastidiosum
ref|WP_014225875.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   2e-25   Tannerella forsythia
ref|WP_027257045.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   2e-25   Leisingera aquimarina
gb|KIC72214.1|  3-deoxy-manno-octulosonate cytidylyltransferase         108   2e-25   Candidatus Protochlamydia amoebophila
ref|WP_036845736.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   2e-25   Porphyromonas cangingivalis
ref|WP_036851249.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   2e-25   Porphyromonas cangingivalis
ref|WP_045639512.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   
ref|WP_010442943.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   Ruegeria conchae
ref|WP_037439749.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   Shewanella mangrovi
ref|WP_006271654.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   Asticcacaulis biprosthecium
ref|WP_016412439.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   
ref|WP_023447991.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   Asticcacaulis sp. AC402
ref|WP_038011846.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   
ref|WP_037906212.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   3e-25   Sulfitobacter mediterraneus
ref|WP_008240969.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   4e-25   Pedobacter sp. BAL39
ref|WP_011919382.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   4e-25   Shewanella putrefaciens
ref|WP_028522996.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   4e-25   Runella limosa
ref|WP_011789211.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    108   4e-25   Shewanella
ref|WP_021931200.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   4e-25   Gabonia massiliensis
ref|WP_022707949.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   4e-25   Paracoccus zeaxanthinifaciens
ref|WP_039184863.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   4e-25   Leisingera sp. ANG-M7
ref|WP_044227886.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   4e-25   Coprobacter secundus
ref|WP_005036959.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    108   4e-25   Holophaga foetida
ref|WP_025763583.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   5e-25   Dyadobacter tibetensis
ref|WP_009810335.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   5e-25   Roseobacter sp. MED193
ref|WP_039000332.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   5e-25   Halocynthiibacter arcticus
ref|WP_012458505.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   5e-25   Porphyromonas gingivalis
ref|WP_027242172.1|  3-deoxy-manno-octulosonate cytidylyltransferase    108   5e-25   Pseudophaeobacter arcticus
ref|WP_020600800.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   5e-25   Spirosoma panaciterrae
ref|WP_021677637.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    107   5e-25   Porphyromonas gingivalis
ref|WP_037987160.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   5e-25   
ref|WP_019187057.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   6e-25   Prevotella conceptionensis
ref|WP_045393323.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   6e-25   Falsirhodobacter sp. alg1
ref|WP_009230111.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   6e-25   Prevotella sp. oral taxon 317
ref|WP_023663844.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   6e-25   
ref|WP_038697552.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   6e-25   Sphingobacterium sp. ML3W
ref|WP_034765307.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   6e-25   Bacillus vietnamensis
ref|WP_021662354.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    107   7e-25   Porphyromonas gingivalis
ref|WP_015740362.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   7e-25   Zymomonas mobilis
ref|WP_011496571.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   7e-25   Shewanella denitrificans
ref|WP_027444530.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   7e-25   Prevotella baroniae
ref|WP_013279112.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   7e-25   Acetohalobium arabaticum
sp|Q6MD00.1|KDSB_PARUW  RecName: Full=3-deoxy-manno-octulosonate ...    107   8e-25   Candidatus Protochlamydia amoebophila UWE25
ref|WP_011497096.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   8e-25   Shewanella denitrificans
ref|WP_037494398.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   8e-25   Sphingobacterium deserti
ref|WP_044187363.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   8e-25   Porphyromonas sp. COT-290 OH860
ref|WP_021069790.1|  hypothetical protein                               107   8e-25   Sphingobacterium paucimobilis
ref|WP_044232397.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   9e-25   Porphyromonas sp. COT-290 OH3588
ref|WP_039685195.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   9e-25   Tateyamaria sp. ANG-S1
ref|WP_036707581.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   9e-25   Paracoccus sanguinis
ref|WP_036701037.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   9e-25   Paracoccus sanguinis
ref|WP_036635198.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   Paenirhodobacter enshiensis
ref|WP_028297917.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   Olivibacter sitiensis
ref|WP_014849391.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   Zymomonas mobilis
ref|WP_042251989.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   Paracoccus sp. PAMC 22219
ref|WP_014501176.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   Zymomonas mobilis
ref|WP_036730823.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   Paracoccus sanguinis
ref|WP_015333012.1|  3-deoxy-manno-octulosonate cytidylyltransfer...    106   1e-24   Fibrella aestuarina
ref|WP_044129818.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   1e-24   
ref|WP_037418743.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   1e-24   Shewanella xiamenensis
ref|WP_008510337.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   1e-24   Mucilaginibacter paludis
ref|WP_043132284.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   
ref|WP_028721179.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   
ref|WP_011622622.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    106   1e-24   
ref|WP_011072444.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   1e-24   
ref|WP_039450665.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   1e-24   
ref|WP_009235946.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   1e-24   
ref|WP_008755838.1|  3-deoxy-manno-octulosonate cytidylyltransferase    107   1e-24   
ref|WP_028287104.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_017927726.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_018478329.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_018710278.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_010397255.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_010263247.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_011696887.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_025604741.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   2e-24   
ref|WP_009316615.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   2e-24   
ref|WP_021664336.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_040496333.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   2e-24   
ref|WP_004583467.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_008035593.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_037981657.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   2e-24   
gb|ABX59257.1|  CMP-2 keto-3-deoxyoctulosonic acid synthetase           106   2e-24   
ref|WP_022340234.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   2e-24   
ref|WP_021096489.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetase      106   3e-24   
ref|WP_026577932.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_044175306.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_022383969.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_027262687.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_011241263.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_027289775.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_018968408.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_008673914.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_044108622.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_017999390.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_007843032.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    105   3e-24   
ref|WP_021891939.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_007835361.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_021854314.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   3e-24   
ref|WP_042280529.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_026473865.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_021589283.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    105   4e-24   
ref|WP_039357883.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_020057809.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_025047373.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_044044912.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|XP_007511142.1|  3-deoxy-manno-octulosonate cytidylyltransferase    106   4e-24   
ref|WP_025839273.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_011748583.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_025113000.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_012197229.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   4e-24   
ref|WP_007849204.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   5e-24   
ref|WP_018302625.1|  hypothetical protein                               105   5e-24   
ref|WP_005938814.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    105   5e-24   
ref|WP_029904931.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   5e-24   
ref|WP_006081834.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   5e-24   
ref|WP_012089331.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   5e-24   
ref|WP_022390934.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   6e-24   
ref|WP_037203695.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   6e-24   
ref|WP_044050673.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   6e-24   
ref|WP_007226879.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   6e-24   
ref|WP_013629246.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   6e-24   
ref|WP_008086300.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   6e-24   
ref|WP_006283222.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   6e-24   
ref|WP_012180231.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   6e-24   
ref|WP_033564525.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   7e-24   
ref|WP_039384606.1|  3-deoxy-manno-octulosonate cytidylyltransferase    105   7e-24   
ref|WP_043414031.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   7e-24   
ref|WP_031532510.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    104   7e-24   
ref|WP_040310420.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   7e-24   
ref|WP_022308746.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   8e-24   
ref|WP_025055210.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   8e-24   
ref|WP_017731791.1|  hypothetical protein                               104   8e-24   
gb|EXJ11210.1|  3-deoxy-manno-octulosonate cytidylyltransferase         104   9e-24   
ref|WP_028639923.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   9e-24   
ref|WP_025862941.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   9e-24   
gb|EEX18133.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase       104   1e-23   
ref|WP_005842057.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    104   1e-23   
ref|WP_020604969.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_025821426.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   1e-23   
ref|WP_032953321.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_022021301.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_034155367.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_023460253.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_007908227.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    104   1e-23   
ref|WP_021692860.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_013182177.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   1e-23   
ref|WP_039126638.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_043774440.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_025278267.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   1e-23   
ref|WP_011537385.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_042238826.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
emb|CCB91546.1|  3-deoxy-manno-octulosonate cytidylyltransferase        103   1e-23   
ref|WP_029945122.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   1e-23   
ref|WP_025069659.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   1e-23   
ref|WP_025051745.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_024092081.1|  3-deoxy-manno-octulosonate cytidylyltransferase    104   1e-23   
ref|WP_016986042.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   1e-23   
ref|WP_023851300.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   1e-23   
ref|WP_006841481.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_027715696.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_019149696.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_041479456.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_024843582.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_011637225.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_036718935.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_010230493.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_007648132.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_044882342.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_008861168.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_039851435.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_024013932.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_018356590.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_016771003.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_018463396.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_045982678.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_020253603.1|  MULTISPECIES: hypothetical protein                 103   2e-23   
ref|WP_024562882.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_038364499.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_022960120.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_020253970.1|  MULTISPECIES: hypothetical protein                 103   2e-23   
ref|WP_025815360.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
gb|KIC73798.1|  3-deoxy-manno-octulosonate cytidylyltransferase         103   2e-23   
ref|WP_046000442.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_007255734.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   2e-23   
ref|WP_028668878.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_017937806.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_018080414.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_021102675.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_039770692.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_011335448.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_036896439.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_017258676.1|  hypothetical protein                               103   3e-23   
ref|WP_036739142.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_022053556.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
gb|AAF39307.1|  3-deoxy-manno-octulosonate cytidylyltransferase         103   3e-23   
ref|WP_022573334.1|  CMP-2-keto-3-deoxyoctulosonic acid synthetase      103   3e-23   
ref|WP_025311309.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
gb|EGJ72201.1|  3-deoxy-manno-octulosonate cytidylyltransferase         104   3e-23   
ref|WP_028068198.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   3e-23   
ref|WP_003227077.1|  3-deoxy-manno-octulosonate cytidylyltransferase    103   3e-23   
ref|WP_016277565.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    103   3e-23   
ref|WP_023593733.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    103   3e-23   
ref|WP_022602832.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   3e-23   
ref|WP_020799921.1|  MULTISPECIES: 3-deoxy-D-manno-octulosonate c...    102   3e-23   
ref|WP_030131952.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   3e-23   
ref|WP_026853715.1|  hypothetical protein                               103   3e-23   
ref|WP_006801403.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   3e-23   
ref|WP_039760192.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_039594050.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    102   4e-23   
ref|WP_030137693.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_028760067.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_032125452.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_007950771.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_038606814.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_008247681.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_008023193.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_011785221.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_013686482.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_034505851.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
gb|EJS88736.1|  3-deoxy-manno-octulosonate cytidylyltransferase       99.0    4e-23   
ref|WP_041069122.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_042560448.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_028898683.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
ref|WP_023914226.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   4e-23   
gb|ETX13489.1|  hypothetical protein OCH239_10260                       101   5e-23   
ref|WP_042102883.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   5e-23   
ref|WP_038030447.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   5e-23   
ref|WP_036877231.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   5e-23   
ref|WP_003456201.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   5e-23   
ref|WP_024993979.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   5e-23   
ref|WP_028582433.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   5e-23   
ref|WP_007656515.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   6e-23   
ref|WP_020370166.1|  MULTISPECIES: 3-deoxy-D-manno-octulosonate c...    102   6e-23   
ref|WP_021666316.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    102   6e-23   
ref|WP_024776920.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   6e-23   
ref|WP_009806869.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   6e-23   
ref|WP_042610690.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   6e-23   
ref|WP_003179365.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   6e-23   
ref|WP_039171872.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   6e-23   
ref|WP_019297579.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    102   7e-23   
ref|WP_017677617.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   7e-23   
ref|WP_028623634.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   7e-23   
ref|WP_015547880.1|  3-deoxy-D-manno-octulosonate cytidylyltransf...    102   7e-23   
ref|WP_022061466.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   7e-23   
ref|WP_012142768.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   7e-23   
gb|ETZ21560.1|  hypothetical protein N824_27885                         102   7e-23   
ref|WP_013065873.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   7e-23   
gb|EPP35242.1|  mobA-like NTP transferase domain protein              99.8    7e-23   
ref|WP_022128716.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   7e-23   
ref|WP_004156197.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   8e-23   
ref|WP_020250641.1|  hypothetical protein                               101   8e-23   
ref|WP_008622866.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   8e-23   
ref|WP_021979582.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   8e-23   
ref|WP_011045810.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   8e-23   
ref|WP_003204286.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    102   8e-23   
ref|WP_027911496.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   8e-23   
ref|WP_024307569.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   8e-23   
ref|WP_007293260.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   9e-23   
ref|WP_018248154.1|  hypothetical protein                               101   9e-23   
ref|WP_022082186.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   9e-23   
ref|WP_024616896.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   9e-23   
ref|WP_036752391.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   1e-22   
ref|WP_027235984.1|  3-deoxy-manno-octulosonate cytidylyltransferase    102   1e-22   
ref|WP_024985854.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
gb|EEX72658.1|  3-deoxy-D-manno-octulosonate cytidylyltransferase       101   1e-22   
ref|WP_039751562.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_021488573.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_019245019.1|  hypothetical protein                               101   1e-22   
ref|WP_022353089.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
gb|EGY36545.1|  LOW QUALITY PROTEIN: 3-deoxy-D-manno-octulosonate...    101   1e-22   
ref|WP_008566021.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
gb|KGU86972.1|  3-deoxy-manno-octulosonate cytidylyltransferase         101   1e-22   
ref|WP_040599123.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_025057663.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_029950952.1|  MULTISPECIES: 3-deoxy-manno-octulosonate cyt...    101   1e-22   
ref|WP_027313680.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_013163176.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_032628265.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_010321926.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_025043003.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   
ref|WP_037438240.1|  3-deoxy-manno-octulosonate cytidylyltransferase    101   1e-22   



>ref|XP_004248267.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Solanum lycopersicum]
Length=296

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RSGKFRSRVIGIIPARFASTRF GKPLV ILGKPMIQRTWERAKLA  LDQVVVATD
Sbjct  40   YLSRSGKFRSRVIGIIPARFASTRFQGKPLVQILGKPMIQRTWERAKLAETLDQVVVATD  99

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKL+KKYDIVV
Sbjct  100  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLDKKYDIVV  143



>ref|XP_006362955.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Solanum tuberosum]
Length=294

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RSGKFRSRVIGIIPARFASTRF GKPLV ILGKPMIQRTWERAKLA  LDQVVVATD
Sbjct  38   YLGRSGKFRSRVIGIIPARFASTRFQGKPLVQILGKPMIQRTWERAKLAETLDQVVVATD  97

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKL+KKYDIVV
Sbjct  98   DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLDKKYDIVV  141



>emb|CDP05912.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R GKFR+RV+GIIPARFAS+RFPGKPLV ILGKPMIQRTWERAK+A +LD VVVATD
Sbjct  42   YLRRPGKFRTRVVGIIPARFASSRFPGKPLVQILGKPMIQRTWERAKMASSLDHVVVATD  101

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCRGFGA+VI+TSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  102  DEKIADCCRGFGADVIITSESCRNGTERCNEALQKLEKKYDIVV  145



>ref|XP_010060550.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Eucalyptus grandis]
 gb|KCW67331.1| hypothetical protein EUGRSUZ_F01118 [Eucalyptus grandis]
Length=305

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R+ KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA +LD VVVATD
Sbjct  49   YLGRAAKFRSRVVGIIPARFASSRFQGKPLVPILGKPMIQRTWERAKLAASLDHVVVATD  108

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+VIMTSESCRNGTERCNEALQKL+KKYDIVV
Sbjct  109  DEKIAECCRGFGADVIMTSESCRNGTERCNEALQKLDKKYDIVV  152



>ref|XP_009789468.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nicotiana sylvestris]
Length=285

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RSGKFRSRVIGIIPARFASTRF GKPL  ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  29   YLGRSGKFRSRVIGIIPARFASTRFQGKPLAHILGKPMIQRTWERAKLAATLDHVVVATD  88

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA CC+GFGAEVIMTSESCRNGTERCNEALQKL KKYDIVV
Sbjct  89   DEKIAACCQGFGAEVIMTSESCRNGTERCNEALQKLAKKYDIVV  132



>ref|XP_011082674.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Sesamum indicum]
Length=299

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y+ RSGKFRSRVIGIIPARFAS+RF GKPLV ILGKPMIQRTWERAK+A  LD VVVATD
Sbjct  43   YYRRSGKFRSRVIGIIPARFASSRFEGKPLVHILGKPMIQRTWERAKMATTLDHVVVATD  102

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            D+KIAECCRGFGA+V+MTSESCRNGTERCNEALQKL K+YD+VV
Sbjct  103  DDKIAECCRGFGADVVMTSESCRNGTERCNEALQKLGKQYDVVV  146



>ref|XP_002284913.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Vitis vinifera]
 emb|CBI20312.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            RSGKFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATDD+K
Sbjct  44   RSGKFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLATTLDHVVVATDDDK  103

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IA+CCRGFGA+VIMTSESCRNGTERCNEALQKLEK+YDIVV
Sbjct  104  IADCCRGFGADVIMTSESCRNGTERCNEALQKLEKQYDIVV  144



>gb|EYU44938.1| hypothetical protein MIMGU_mgv1a0108731mg, partial [Erythranthe 
guttata]
 gb|EYU44939.1| hypothetical protein MIMGU_mgv1a0108731mg, partial [Erythranthe 
guttata]
Length=168

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + RSGKFRSRVIGIIPARFAS+RF GKPLV ILGKPMIQRTWERAK+A +LD VVVATDD
Sbjct  44   YRRSGKFRSRVIGIIPARFASSRFEGKPLVHILGKPMIQRTWERAKMATSLDHVVVATDD  103

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +KIAECCRGFGA+V+MTSESCRNGTERCNEALQKL K+YD+VV
Sbjct  104  DKIAECCRGFGADVVMTSESCRNGTERCNEALQKLGKEYDVVV  146



>ref|XP_009606581.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Nicotiana tomentosiformis]
Length=296

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RSG+FRSRVIGIIPARFASTRF GKPL  ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  40   YLGRSGRFRSRVIGIIPARFASTRFQGKPLAHILGKPMIQRTWERAKLAATLDHVVVATD  99

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA CC+GFGAEVIMTSESCRNGTERCNEALQKL KKYDIVV
Sbjct  100  DEKIAACCQGFGAEVIMTSESCRNGTERCNEALQKLGKKYDIVV  143



>ref|XP_009623871.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=224

 Score =   187 bits (474),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRVIGIIPARFASTRF GKPLV ILGKPMIQRTWERAKLA  LDQVVVATD
Sbjct  37   YLARSSKFRSRVIGIIPARFASTRFQGKPLVQILGKPMIQRTWERAKLAETLDQVVVATD  96

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCR FGAEVIMT+ESCRNGTERC EAL+KL KKYDI V
Sbjct  97   DEKIAECCRSFGAEVIMTAESCRNGTERCTEALEKLGKKYDIAV  140



>ref|XP_006370268.1| cytidylyltransferase family protein [Populus trichocarpa]
 gb|ERP66837.1| cytidylyltransferase family protein [Populus trichocarpa]
Length=290

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPAR+AS+RF GKPLV+ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  34   YLGRYRKFRSRVVGIIPARYASSRFEGKPLVNILGKPMIQRTWERAKLASTLDHIVVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+VIMTSESCRNGTERCNEALQKL+KKYD+VV
Sbjct  94   DEKIAECCRGFGADVIMTSESCRNGTERCNEALQKLDKKYDVVV  137



>ref|XP_002517281.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
 gb|EEF45074.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
Length=294

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRVIGIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD ++VATD
Sbjct  38   YLSRSRKFRSRVIGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLATTLDHIIVATD  97

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+VIMTSESCRNGTERCNEA+ KLEKKYD+VV
Sbjct  98   DEKIAECCRGFGADVIMTSESCRNGTERCNEAIGKLEKKYDVVV  141



>gb|KFK35754.1| hypothetical protein AALP_AA4G032100 [Arabis alpina]
Length=295

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  39   YLTRSSKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLATTLDHVVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  99   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  142



>ref|XP_007021424.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007021425.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007021426.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY12949.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY12950.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY12951.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=301

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R+ KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  45   YLGRAKKFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERSKLATTLDHIVVATD  104

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+VIMTSESC+NGTERCNEAL+KLEKKYDIVV
Sbjct  105  DEKIAECCRGFGADVIMTSESCQNGTERCNEALEKLEKKYDIVV  148



>ref|XP_006377770.1| hypothetical protein POPTR_0011s12080g [Populus trichocarpa]
 gb|ERP55567.1| hypothetical protein POPTR_0011s12080g [Populus trichocarpa]
Length=285

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y +R  KFRS+V+GIIPAR+AS+RF GKPLV+ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  37   YLVRYRKFRSQVVGIIPARYASSRFEGKPLVNILGKPMIQRTWERAKLATTLDHIVVATD  96

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+V+MTSESCRNGTERCNEALQKL+KKYD+VV
Sbjct  97   DEKIAECCRGFGADVVMTSESCRNGTERCNEALQKLDKKYDVVV  140



>ref|XP_011004626.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Populus euphratica]
 ref|XP_011004627.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Populus euphratica]
 ref|XP_011004628.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Populus euphratica]
Length=291

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPAR+AS+RF GKPLV+ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  35   YLGRYRKFRSRVVGIIPARYASSRFEGKPLVNILGKPMIQRTWERAKLASTLDHIVVATD  94

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+VIMTSESCRNGTERCNEALQKL+KKYD+VV
Sbjct  95   DEKIAECCRGFGADVIMTSESCRNGTERCNEALQKLDKKYDVVV  138



>ref|XP_002316900.1| cytidylyltransferase family protein [Populus trichocarpa]
 gb|EEE97512.1| cytidylyltransferase family protein [Populus trichocarpa]
Length=293

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y +R  KFRS+V+GIIPAR+AS+RF GKPLV+ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  37   YLVRYRKFRSQVVGIIPARYASSRFEGKPLVNILGKPMIQRTWERAKLATTLDHIVVATD  96

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+V+MTSESCRNGTERCNEALQKL+KKYD+VV
Sbjct  97   DEKIAECCRGFGADVVMTSESCRNGTERCNEALQKLDKKYDVVV  140



>ref|XP_009784749.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Nicotiana sylvestris]
Length=297

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRVIGIIPARFASTRF GKPLV ILGKPMIQRTWERAKLA  LDQVVVATD
Sbjct  41   YLARSSKFRSRVIGIIPARFASTRFQGKPLVQILGKPMIQRTWERAKLAETLDQVVVATD  100

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCR FGAEVIMT+ESCRNGTERC +AL+KL KKYDIVV
Sbjct  101  DEKIAECCRSFGAEVIMTAESCRNGTERCTQALEKLGKKYDIVV  144



>ref|XP_012084951.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Jatropha curcas]
 gb|KDP27047.1| hypothetical protein JCGZ_20982 [Jatropha curcas]
Length=296

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS  FRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  40   YLARSRNFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLATTLDHIVVATD  99

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+VIMTSESCRNGTERCNEAL KLEKKYD+VV
Sbjct  100  DEKIAECCRGFGADVIMTSESCRNGTERCNEALGKLEKKYDVVV  143



>ref|NP_175708.2| 3-deoxy-manno-octulosonate cytidylyltransferase [Arabidopsis 
thaliana]
 sp|Q9C920.1|KDSB_ARATH RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase, 
mitochondrial; AltName: Full=CMP-2-keto-3-deoxyoctulosonic 
acid synthase; Short=AtCKS; Short=CMP-KDO synthase; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52266.1|AC019018_3 putative deoxyoctulonosic acid synthetase; 116195-114393 [Arabidopsis 
thaliana]
 emb|CAD43603.1| putative CMP-KDO synthetase [Arabidopsis thaliana]
 dbj|BAH20217.1| AT1G53000 [Arabidopsis thaliana]
 gb|AEE32875.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Arabidopsis 
thaliana]
Length=290

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  34   YLGRSKKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLATTLDHIVVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  94   DERIAECCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  137



>ref|XP_006305471.1| hypothetical protein CARUB_v10009902mg [Capsella rubella]
 gb|EOA38369.1| hypothetical protein CARUB_v10009902mg [Capsella rubella]
Length=292

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  36   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLATTLDHVVVATD  95

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  96   DERIAECCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  139



>ref|XP_011029470.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Populus euphratica]
Length=293

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRS+V+GIIPAR+AS+RF GKPLV+ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  37   YLFRYRKFRSQVVGIIPARYASSRFEGKPLVNILGKPMIQRTWERAKLATTLDHIVVATD  96

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECCRGFGA+V+MTSESCRNGTERCNEALQKL+KKYD+VV
Sbjct  97   DEKIAECCRGFGADVVMTSESCRNGTERCNEALQKLDKKYDVVV  140



>ref|XP_006451888.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 gb|ESR65128.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
Length=238

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS  FRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  39   YLGRSKNFRSRVVGIIPARFASSRFEGKPLVNILGKPMIQRTWERSKLATTLDHLVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  99   DEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVV  142



>ref|XP_006451887.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 gb|ESR65127.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
Length=236

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS  FRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  39   YLGRSKNFRSRVVGIIPARFASSRFEGKPLVNILGKPMIQRTWERSKLATTLDHLVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  99   DEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVV  142



>emb|CDY47563.1| BnaC03g69060D [Brassica napus]
Length=289

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  33   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  92

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  93   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  136



>ref|XP_010479831.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Camelina sativa]
Length=292

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER KLA  LD VVVATD
Sbjct  36   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERTKLATTLDHVVVATD  95

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  96   DERIAECCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  139



>ref|XP_010242912.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=299

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
             L  GKFRSRV+GIIPAR+AS+RF GKPL  ILGKPMIQRTWERAKLA  LD +VVATDD
Sbjct  44   LLGLGKFRSRVVGIIPARYASSRFEGKPLAQILGKPMIQRTWERAKLATTLDHIVVATDD  103

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  104  ERIAECCRGFGADVIMTSESCRNGTERCNEALQKLEKKYDIVV  146



>ref|XP_010500927.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Camelina sativa]
Length=294

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRVIGIIPAR+AS+RF GKPLV ILGKPMIQRTWER KLA  LD VVVATD
Sbjct  38   YLGRSRKFRSRVIGIIPARYASSRFEGKPLVQILGKPMIQRTWERTKLATTLDHVVVATD  97

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL+KL+KKYD+VV
Sbjct  98   DERIAECCRGFGADVIMTSESCRNGTERCNEALEKLDKKYDVVV  141



>ref|XP_009107014.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Brassica rapa]
Length=289

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  33   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  92

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  93   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  136



>ref|XP_006451890.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 ref|XP_006464742.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Citrus sinensis]
 gb|ESR65130.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
Length=295

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS  FRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  39   YLGRSKNFRSRVVGIIPARFASSRFEGKPLVNILGKPMIQRTWERSKLATTLDHLVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  99   DEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVV  142



>emb|CDY02531.1| BnaA08g01380D [Brassica napus]
Length=291

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  35   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  94

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  95   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  138



>ref|XP_006451889.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
 gb|ESR65129.1| hypothetical protein CICLE_v10009061mg [Citrus clementina]
Length=281

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS  FRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  39   YLGRSKNFRSRVVGIIPARFASSRFEGKPLVNILGKPMIQRTWERSKLATTLDHLVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  99   DEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKYDIVV  142



>ref|XP_006392844.1| hypothetical protein EUTSA_v10011698mg [Eutrema salsugineum]
 gb|ESQ30130.1| hypothetical protein EUTSA_v10011698mg [Eutrema salsugineum]
Length=291

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  35   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  94

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  95   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  138



>ref|XP_002894417.1| cytidylyltransferase family [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70676.1| cytidylyltransferase family [Arabidopsis lyrata subsp. lyrata]
Length=293

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  37   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLATTLDHIVVATD  96

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL+KL+KKYD+VV
Sbjct  97   DERIAECCRGFGADVIMTSESCRNGTERCNEALEKLDKKYDVVV  140



>gb|KGN56240.1| hypothetical protein Csa_3G104930 [Cucumis sativus]
Length=276

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWERAK+A  LD VVVATD
Sbjct  41   YLGRSKKFRSRVVGIIPARFASSRFEGKPLVEILGKPMIQRTWERAKMATTLDCVVVATD  100

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            D +IA+CC+GFGA+V+MTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  101  DARIAQCCKGFGADVVMTSESCRNGTERCNEALQKLEKKYDIVV  144



>ref|XP_010462154.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Camelina sativa]
Length=292

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R+ KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER KLA  LD VVVATD
Sbjct  36   YLGRTRKFRSRVVGIIPARYASSRFEGKPLVKILGKPMIQRTWERTKLATTLDHVVVATD  95

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL+KLEKKYD+VV
Sbjct  96   DERIAECCRGFGADVIMTSESCRNGTERCNEALEKLEKKYDVVV  139



>ref|XP_003526068.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Glycine max]
Length=305

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  49   YMTRFSKFRSRVVGIIPARFASSRFEGKPLVQILGKPMIQRTWERAKLAATLDHVVVATD  108

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCR FGA+VIMTSESCRNGTERCNEALQKL KKYDIVV
Sbjct  109  DEKIADCCRQFGADVIMTSESCRNGTERCNEALQKLGKKYDIVV  152



>ref|XP_009124899.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X2 [Brassica rapa]
Length=271

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  34   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEK+YD+VV
Sbjct  94   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKEYDVVV  137



>gb|KHN37186.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Glycine soja]
Length=301

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  45   YMTRFSKFRSRVVGIIPARFASSRFEGKPLVQILGKPMIQRTWERAKLAATLDHVVVATD  104

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCR FGA+VIMTSESCRNGTERCNEALQKL KKYDIVV
Sbjct  105  DEKIADCCRQFGADVIMTSESCRNGTERCNEALQKLGKKYDIVV  148



>ref|XP_009124898.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X1 [Brassica rapa]
Length=290

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  34   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEK+YD+VV
Sbjct  94   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKEYDVVV  137



>emb|CDY69672.1| BnaA05g35640D [Brassica napus]
Length=290

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  34   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEK+YD+VV
Sbjct  94   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKEYDVVV  137



>ref|XP_004133708.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Cucumis sativus]
Length=297

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWERAK+A  LD VVVATD
Sbjct  41   YLGRSKKFRSRVVGIIPARFASSRFEGKPLVEILGKPMIQRTWERAKMATTLDCVVVATD  100

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            D +IA+CC+GFGA+V+MTSESCRNGTERCNEALQKLEKKYDIVV
Sbjct  101  DARIAQCCKGFGADVVMTSESCRNGTERCNEALQKLEKKYDIVV  144



>ref|XP_003540098.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Glycine max]
 gb|KHN04396.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Glycine soja]
Length=306

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  50   YMTRFSKFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLAATLDHIVVATD  109

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCR FGA+VIMTSESCRNGTERCNEALQKL KKYDIVV
Sbjct  110  DEKIADCCRQFGADVIMTSESCRNGTERCNEALQKLGKKYDIVV  153



>ref|XP_010545826.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Tarenaya hassleriana]
Length=295

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+K+A  LD VVVATD
Sbjct  39   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKMATMLDHVVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+V+MTSESCRNGTERCNEAL+KLE KYD+VV
Sbjct  99   DERIAECCRGFGADVVMTSESCRNGTERCNEALEKLENKYDVVV  142



>ref|XP_008452260.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Cucumis melo]
Length=297

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS +FRSRV+GIIPARFAS+RF GKPLV+ILGKPMIQRTWERAK+A  LD VVVATD
Sbjct  41   YLGRSKRFRSRVVGIIPARFASSRFEGKPLVEILGKPMIQRTWERAKMATTLDCVVVATD  100

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            D KIA+CC+GFGA+V+MTSESCRNGTERCNEAL KLEKKYDIVV
Sbjct  101  DAKIAQCCKGFGADVVMTSESCRNGTERCNEALHKLEKKYDIVV  144



>ref|XP_011098319.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Sesamum indicum]
Length=332

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            RS KFRSRVIGIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATDD+K
Sbjct  79   RSAKFRSRVIGIIPARFASSRFQGKPLVHILGKPMIQRTWERAKLATLLDHVVVATDDDK  138

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IA CC+GFGA+V+MTSESCRNGTERCNEALQKL KKYD+VV
Sbjct  139  IAACCKGFGADVVMTSESCRNGTERCNEALQKLGKKYDVVV  179



>gb|KJB61818.1| hypothetical protein B456_009G389800 [Gossypium raimondii]
Length=296

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R+ KFR+RV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD +VVATD
Sbjct  40   YLGRARKFRTRVVGIIPARYASSRFEGKPLVHILGKPMIQRTWERSKLATTLDHLVVATD  99

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA CCRGFGA+VIMTSESC+NGTERCNEAL+KLEKKYDIVV
Sbjct  100  DEKIAACCRGFGADVIMTSESCQNGTERCNEALEKLEKKYDIVV  143



>ref|XP_004514100.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Cicer arietinum]
Length=304

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA +LD VVVATD
Sbjct  48   YLTRFNKFRSRVVGIIPARFASSRFSGKPLVQILGKPMIQRTWERAKLAASLDHVVVATD  107

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCR FGA+VIMTS SCRNGTERCNEALQKL +KYDIVV
Sbjct  108  DEKIADCCRQFGADVIMTSVSCRNGTERCNEALQKLGRKYDIVV  151



>ref|XP_010694996.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=298

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 1/105 (1%)
 Frame = +3

Query  219  YFLR-SGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVAT  395
            +FLR S KFR+RVIGIIPARFAS+RF GKPLV+ILGKPMIQRT+ERAKLA  LDQVVVAT
Sbjct  41   FFLRRSRKFRARVIGIIPARFASSRFEGKPLVEILGKPMIQRTYERAKLASMLDQVVVAT  100

Query  396  DDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DD KIAECCRGFGA+VIMTSESCRNG ERC+EALQKL KKYD+VV
Sbjct  101  DDNKIAECCRGFGADVIMTSESCRNGAERCSEALQKLTKKYDVVV  145



>gb|KEH41941.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Medicago truncatula]
Length=596

 Score =   188 bits (478),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 88/104 (85%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            YF R  KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWE AKLA +LD +VVATD
Sbjct  340  YFNRFNKFRSRVVGIIPARFASSRFEGKPLVHILGKPMIQRTWESAKLAASLDHLVVATD  399

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCR FGA+VIMTSESCRNGTERCNEALQKLE+KYDIVV
Sbjct  400  DEKIADCCRKFGADVIMTSESCRNGTERCNEALQKLERKYDIVV  443



>ref|XP_010272461.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272462.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272463.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272464.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272465.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272466.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272467.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
 ref|XP_010272468.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=298

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            R GKFRS VIGIIPAR+AS+RF GKPLV ILGKPMIQRTWERAKLA  LD +VVATDDEK
Sbjct  45   RFGKFRSTVIGIIPARYASSRFEGKPLVQILGKPMIQRTWERAKLATTLDHIVVATDDEK  104

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECC+ FGA+VIMTS SCRNGTERCNEALQK+EKKYD+VV
Sbjct  105  IAECCQAFGADVIMTSTSCRNGTERCNEALQKIEKKYDVVV  145



>ref|XP_002534236.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
 gb|EEF28143.1| cmp-2-keto-3-deoctulosonate (cmp-kdo) cytidyltransferase, putative 
[Ricinus communis]
Length=290

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFR RVIGIIPARF S+RF GKPLV ILGKPMIQRTWERAKLA  LD ++VATD
Sbjct  34   YLGRFRKFRRRVIGIIPARFDSSRFQGKPLVHILGKPMIQRTWERAKLATTLDHIIVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +EKIAECCRGFGA+VIMTSESCRNGTERCNEAL KLEKKYD+VV
Sbjct  94   NEKIAECCRGFGADVIMTSESCRNGTERCNEALGKLEKKYDVVV  137



>ref|XP_008366929.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Malus domestica]
Length=290

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y   + KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  34   YLGPTRKFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLASTLDHVVVATD  93

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKI ECCR FGA+VIMTSESCRNGTERC+EA++KLEKKYDIVV
Sbjct  94   DEKIRECCRSFGADVIMTSESCRNGTERCSEAIEKLEKKYDIVV  137



>ref|XP_007133176.1| hypothetical protein PHAVU_011G157900g [Phaseolus vulgaris]
 gb|ESW05170.1| hypothetical protein PHAVU_011G157900g [Phaseolus vulgaris]
Length=301

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  45   YMTRFSKFRSRVVGIIPARYASSRFQGKPLVQILGKPMIQRTWERAKLAVTLDHLVVATD  104

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA+CCR FGA+VIMTSESC+NGTERCNEALQKL K YDIVV
Sbjct  105  DEKIADCCRQFGADVIMTSESCKNGTERCNEALQKLGKNYDIVV  148



>emb|CDY55874.1| BnaC06g41770D [Brassica napus]
Length=481

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  RS KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWER+KLA  LD VVVATD
Sbjct  37   YLGRSRKFRSRVVGIIPARYASSRFEGKPLVQILGKPMIQRTWERSKLASTLDHVVVATD  96

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IA+CCRGFGA+VIMTSESCRNGTERCNEAL+KLEK+YD+VV
Sbjct  97   DERIADCCRGFGADVIMTSESCRNGTERCNEALEKLEKEYDVVV  140



>ref|XP_002263680.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Vitis vinifera]
 emb|CBI23963.3| unnamed protein product [Vitis vinifera]
Length=293

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            RS K RS+V+GIIPARFAS+RF GKPLV +LGKPMIQRTWERAKLA  LDQ+VVATDDEK
Sbjct  40   RSVKLRSQVVGIIPARFASSRFEGKPLVPLLGKPMIQRTWERAKLATTLDQLVVATDDEK  99

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECCRGFGA+VIMTSESCRNGTERCNEAL+KL K +DIVV
Sbjct  100  IAECCRGFGADVIMTSESCRNGTERCNEALKKLRKNFDIVV  140



>ref|XP_006849964.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Amborella trichopoda]
 gb|ERN11545.1| hypothetical protein AMTR_s00022p00147990 [Amborella trichopoda]
Length=288

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            +S  FRSR +GIIPAR+ S+RF GKPL  ILGKPMIQRTWERAKLA  LD VVVATDDEK
Sbjct  35   KSSHFRSRAVGIIPARYKSSRFEGKPLAQILGKPMIQRTWERAKLAVTLDHVVVATDDEK  94

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECCRGFGA+VIMTSESC+NGTERCNEALQKL+KKYDIVV
Sbjct  95   IAECCRGFGADVIMTSESCQNGTERCNEALQKLKKKYDIVV  135



>ref|XP_008226639.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Prunus mume]
Length=299

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y     KFRSRV+GIIPARFAS+RF GKPL  ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  43   YLGPPKKFRSRVVGIIPARFASSRFQGKPLAQILGKPMIQRTWERAKLATTLDHVVVATD  102

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKI ECCR FGA+V+MTSESCRNGTERC+EA+QKLEKKYDIVV
Sbjct  103  DEKIRECCRSFGADVVMTSESCRNGTERCSEAIQKLEKKYDIVV  146



>ref|XP_007213820.1| hypothetical protein PRUPE_ppa009246mg [Prunus persica]
 gb|EMJ15019.1| hypothetical protein PRUPE_ppa009246mg [Prunus persica]
Length=300

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y     KFRSRV+GIIPARF S+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  44   YLGPPKKFRSRVVGIIPARFDSSRFQGKPLVQILGKPMIQRTWERAKLATTLDHVVVATD  103

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKI ECCR FGA+VIMTSESCRNGTERC+EA+QKLEKKYDIVV
Sbjct  104  DEKIRECCRSFGADVIMTSESCRNGTERCSEAIQKLEKKYDIVV  147



>ref|XP_009356824.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Pyrus x bretschneideri]
Length=296

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y   + KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  40   YLGPTRKFRSRVVGIIPARYASSRFQGKPLVQILGKPMIQRTWERAKLASTLDHVVVATD  99

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKI ECCR FGA+VIMTSESC+NGTERC+EA++KLEKKYDIVV
Sbjct  100  DEKIRECCRSFGADVIMTSESCQNGTERCSEAIEKLEKKYDIVV  143



>ref|XP_009351030.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Pyrus x bretschneideri]
Length=295

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  ++ KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD+VVVATD
Sbjct  39   YLGQTKKFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLASTLDRVVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+I ECC  FGA+V+MTSESCRNGTERC+EA++KLEKKYDIVV
Sbjct  99   DERIRECCHSFGADVVMTSESCRNGTERCSEAIEKLEKKYDIVV  142



>ref|XP_010064449.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Eucalyptus grandis]
Length=235

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y  R  K RSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA +LD +VVATD
Sbjct  97   YLGRFAKCRSRVVGIIPARFASSRFQGKPLVPILGKPMIQRTWERAKLAASLDHLVVATD  156

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DEKIA CCRGFGA+VIMTSESC NG ERCNEAL KL+KKYDIVV
Sbjct  157  DEKIAACCRGFGADVIMTSESCWNGNERCNEALLKLDKKYDIVV  200



>ref|XP_004295148.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=301

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = +3

Query  237  KFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            KFRSRV+GIIPAR+AS+RF GKPLV ILGKPMIQRTWERAK+A  LD +VVATDDEKIAE
Sbjct  51   KFRSRVVGIIPARYASSRFQGKPLVQILGKPMIQRTWERAKMASTLDHIVVATDDEKIAE  110

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            CCR FGA+VIMTSESC NGTERC EA+QKLEKKYD+VV
Sbjct  111  CCRSFGADVIMTSESCPNGTERCYEAIQKLEKKYDVVV  148



>ref|XP_010919659.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=295

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            YF    K RSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  39   YFKWFRKGRSRVVGIIPARFASSRFEGKPLVHILGKPMIQRTWERAKLASTLDHIVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL KL K YDIVV
Sbjct  99   DERIAECCRGFGADVIMTSESCRNGTERCNEALLKLGKHYDIVV  142



>ref|XP_010919652.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=296

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            YF    K RSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD +VVATD
Sbjct  39   YFKWFRKGRSRVVGIIPARFASSRFEGKPLVHILGKPMIQRTWERAKLASTLDHIVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESCRNGTERCNEAL KL K YDIVV
Sbjct  99   DERIAECCRGFGADVIMTSESCRNGTERCNEALLKLGKHYDIVV  142



>ref|XP_008386160.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Malus domestica]
 ref|XP_008349984.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
[Malus domestica]
Length=295

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            Y   + KFRSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD+VVVATD
Sbjct  39   YLGPTKKFRSRVVGIIPARFASSRFQGKPLVQILGKPMIQRTWERAKLASTLDRVVVATD  98

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+I ECC  FGA+V+MTSESCRNGTERC+EA++KLEK YDIVV
Sbjct  99   DERIQECCHSFGADVVMTSESCRNGTERCSEAIEKLEKNYDIVV  142



>ref|XP_008809046.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Phoenix dactylifera]
 ref|XP_008809123.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Phoenix dactylifera]
Length=330

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            R GKFRSR +GIIPARF S+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATDDEK
Sbjct  77   RFGKFRSRAVGIIPARFNSSRFQGKPLVPILGKPMIQRTWERAKLASTLDHVVVATDDEK  136

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECCRGFGA+VIMTSESC+NGTERC EA QKL++ YDIVV
Sbjct  137  IAECCRGFGADVIMTSESCQNGTERCYEAFQKLKRNYDIVV  177



>ref|XP_008225094.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Prunus mume]
Length=296

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            RS + R  V+GIIPARFAS+RFPGKPLV ILGKPMIQRTWERAKLA  LDQ+VVATD+EK
Sbjct  43   RSARLRCHVLGIIPARFASSRFPGKPLVPILGKPMIQRTWERAKLATTLDQLVVATDNEK  102

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECC GFGA+VIMTS++CRNGTERCN+ALQK +KK+DIVV
Sbjct  103  IAECCLGFGADVIMTSDTCRNGTERCNKALQKFKKKFDIVV  143



>ref|XP_008810228.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Phoenix dactylifera]
Length=270

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            YF    K RSRV+GIIPARF+S+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  41   YFKWFRKGRSRVVGIIPARFSSSRFEGKPLVQILGKPMIQRTWERAKLASTLDHVVVATD  100

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DE+IAECCRGFGA+VIMTSESC+NGTERCNEAL KL K YDIVV
Sbjct  101  DERIAECCRGFGADVIMTSESCKNGTERCNEALLKLAKNYDIVV  144



>gb|ABK23054.1| unknown [Picea sitchensis]
Length=290

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +3

Query  216  RYFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVAT  395
            R   RS + R+RV+GIIPARF STRF GKPLV+ILGKPMIQRTWERA LA  LD+VV+AT
Sbjct  33   RLVARSNRARNRVVGIIPARFRSTRFEGKPLVEILGKPMIQRTWERAMLAATLDKVVIAT  92

Query  396  DDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            DDEKIAECC GFGA+V+MT ESCRNGTERCNEAL+KL+KKYDIVV
Sbjct  93   DDEKIAECCLGFGADVVMTPESCRNGTERCNEALRKLKKKYDIVV  137



>ref|XP_006654782.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Oryza brachyantha]
Length=299

 Score =   174 bits (440),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R G FRSR +GIIPARFAS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  44   YRRPGGFRSRAVGIIPARFASSRFEGKPLAPILGKPMIQRTWERVMLASSLDHVVVATDD  103

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTSESCRNG+ERC EALQKL+K YDIVV
Sbjct  104  ERIAECCRGFGADVIMTSESCRNGSERCCEALQKLDKNYDIVV  146



>ref|XP_002441511.1| hypothetical protein SORBIDRAFT_09g028380 [Sorghum bicolor]
 gb|EES19941.1| hypothetical protein SORBIDRAFT_09g028380 [Sorghum bicolor]
Length=296

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R   FRSR +GIIPARFASTRF GKPLV ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  41   YRRPSGFRSRAVGIIPARFASTRFEGKPLVHILGKPMIQRTWERVMLASSLDHVVVATDD  100

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTSESC+NG+ERC EAL+KLEK+YDIVV
Sbjct  101  ERIAECCRGFGADVIMTSESCKNGSERCCEALKKLEKRYDIVV  143



>ref|XP_010924427.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Elaeis guineensis]
Length=297

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  219  YFLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATD  398
            YF    K RSRV+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATD
Sbjct  41   YFKWFRKDRSRVVGIIPARFASSRFEGKPLVRILGKPMIQRTWERAKLASTLDHVVVATD  100

Query  399  DEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             EKIAECCR FGA+VIMTSESC+NGTERCNEALQKL K YD+VV
Sbjct  101  SEKIAECCREFGADVIMTSESCKNGTERCNEALQKLGKNYDVVV  144



>ref|XP_009406254.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=295

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  216  RYFLR--SGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVV  389
             ++LR  S  FRSRV+GIIPARF S+RF GKPL  ILGKPMIQRTWERAKLA  L+ VVV
Sbjct  36   HFYLRRWSSGFRSRVVGIIPARFDSSRFQGKPLAQILGKPMIQRTWERAKLASTLENVVV  95

Query  390  ATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            ATDDEKIAECCRGFGA+V+MTS  CRNGTERCNEAL+KL K YDIVV
Sbjct  96   ATDDEKIAECCRGFGADVVMTSVGCRNGTERCNEALEKLGKNYDIVV  142



>gb|EEC79690.1| hypothetical protein OsI_20971 [Oryza sativa Indica Group]
Length=297

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R G FR R +GIIPARFAS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  42   YRRPGGFRGRAVGIIPARFASSRFEGKPLAPILGKPMIQRTWERVMLASSLDHVVVATDD  101

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTSESCRNG+ERC EALQKL K YDIVV
Sbjct  102  ERIAECCRGFGADVIMTSESCRNGSERCCEALQKLNKHYDIVV  144



>ref|NP_001056314.1| Os05g0561500 [Oryza sativa Japonica Group]
 gb|AAU10647.1| putative 3-deoxy-manno-octulosonate cytidylyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAF18228.1| Os05g0561500 [Oryza sativa Japonica Group]
 dbj|BAG88112.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64681.1| hypothetical protein OsJ_19536 [Oryza sativa Japonica Group]
Length=297

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R G FR R +GIIPARFAS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  42   YRRPGGFRGRAVGIIPARFASSRFEGKPLAPILGKPMIQRTWERVMLASSLDHVVVATDD  101

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTSESCRNG+ERC EALQKL K YDIVV
Sbjct  102  ERIAECCRGFGADVIMTSESCRNGSERCCEALQKLNKHYDIVV  144



>ref|XP_010108191.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Morus notabilis]
 gb|EXC18116.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Morus notabilis]
Length=305

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            +S +FR +V+GIIPARFAS+RFPGKPLV ILGKPMIQRTWERAKLA  L+++VVATDD+K
Sbjct  44   QSWRFRRQVLGIIPARFASSRFPGKPLVPILGKPMIQRTWERAKLAATLNKLVVATDDQK  103

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECC  FGA+V+MTSESC+NGTERCNEALQ+L++K+DIVV
Sbjct  104  IAECCSAFGADVLMTSESCKNGTERCNEALQRLQRKFDIVV  144



>ref|XP_007211713.1| hypothetical protein PRUPE_ppa009339mg [Prunus persica]
 gb|EMJ12912.1| hypothetical protein PRUPE_ppa009339mg [Prunus persica]
Length=296

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
             V+GIIPARFAS+RFPGKPLV ILGKPMIQRTWERAKLA  LDQ+VVATD+EKIAECC G
Sbjct  50   HVLGIIPARFASSRFPGKPLVPILGKPMIQRTWERAKLATTLDQLVVATDNEKIAECCLG  109

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FGA+VIMTS++CRNGTERCNEALQK +KK+DIVV
Sbjct  110  FGADVIMTSDTCRNGTERCNEALQKFKKKFDIVV  143



>gb|EPS72950.1| hypothetical protein M569_01801, partial [Genlisea aurea]
Length=281

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            V+GIIPARFAS+RF GKPLV ILGKPMIQRTWERAK+A +LD+VVVATDD +IA+CCRGF
Sbjct  40   VVGIIPARFASSRFEGKPLVQILGKPMIQRTWERAKMAVSLDRVVVATDDHRIADCCRGF  99

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            GA+V+MTSESCRNGTERCNEALQKL+K YD+VV
Sbjct  100  GADVVMTSESCRNGTERCNEALQKLDKHYDVVV  132



>ref|XP_004961235.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Setaria italica]
Length=297

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R   FRSR +GIIPARFAS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  42   YRRPSGFRSRAVGIIPARFASSRFEGKPLAHILGKPMIQRTWERVMLASSLDHVVVATDD  101

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IA+CCRGFGA+VIMTSESCRNG+ERC EALQKL K+YDIVV
Sbjct  102  ERIADCCRGFGADVIMTSESCRNGSERCCEALQKLGKRYDIVV  144



>gb|AFW81112.1| hypothetical protein ZEAMMB73_836886 [Zea mays]
Length=280

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R   FRSR +GIIPARFASTRF GKPLV ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  43   YRRPTGFRSRAVGIIPARFASTRFEGKPLVPILGKPMIQRTWERVMLASSLDHVVVATDD  102

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTS SC+NG+ERC EAL+KL+K YDIVV
Sbjct  103  ERIAECCRGFGADVIMTSASCKNGSERCCEALKKLDKHYDIVV  145



>ref|NP_001105657.1| CMP-KDO synthetase1 precursor [Zea mays]
 emb|CAB89846.1| CMP-KDO synthetase [Zea mays]
 gb|AFW81111.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Zea mays]
Length=298

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R   FRSR +GIIPARFASTRF GKPLV ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  43   YRRPTGFRSRAVGIIPARFASTRFEGKPLVPILGKPMIQRTWERVMLASSLDHVVVATDD  102

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTS SC+NG+ERC EAL+KL+K YDIVV
Sbjct  103  ERIAECCRGFGADVIMTSASCKNGSERCCEALKKLDKHYDIVV  145



>gb|ACG42455.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Zea mays]
Length=298

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R   FRSR +GIIPARFASTRF GKPLV ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  43   YRRPTGFRSRAVGIIPARFASTRFEGKPLVPILGKPMIQRTWERVMLASSLDHVVVATDD  102

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E+IAECCRGFGA+VIMTS SC+NG+ERC EAL+KL+K YDIVV
Sbjct  103  ERIAECCRGFGADVIMTSASCKNGSERCCEALKKLDKHYDIVV  145



>emb|CAN72248.1| hypothetical protein VITISV_008336 [Vitis vinifera]
Length=264

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAE  440
            IIPARFAS+RF GKPLV +LGKPMIQRTWERAKLA  LDQ+VVATDDEKIAECCRGFGA+
Sbjct  22   IIPARFASSRFEGKPLVPLLGKPMIQRTWERAKLATTLDQLVVATDDEKIAECCRGFGAD  81

Query  441  VIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            VIMTSESCRNGTERCNEAL+KL K +DIVV
Sbjct  82   VIMTSESCRNGTERCNEALKKLRKNFDIVV  111



>ref|XP_003567908.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
isoform X2 [Brachypodium distachyon]
Length=290

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  228  RSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEK  407
            R   FR+  +GIIPAR+AS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDDEK
Sbjct  37   RPRGFRTLAVGIIPARYASSRFEGKPLALILGKPMIQRTWERVMLASSLDHVVVATDDEK  96

Query  408  IAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IAECCRGFGA+VIMTS SC+NG+ERC EALQKLEK YDIVV
Sbjct  97   IAECCRGFGADVIMTSVSCQNGSERCCEALQKLEKCYDIVV  137



>dbj|BAK04151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=293

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
            + R   FRS  +GIIPAR+AS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDD
Sbjct  38   YRRPRGFRSLAVGIIPARYASSRFEGKPLALILGKPMIQRTWERVMLASSLDHVVVATDD  97

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            EKIAECCRGFGA+V+MTS SC+NG+ERC EALQKL K YDIVV
Sbjct  98   EKIAECCRGFGADVVMTSVSCQNGSERCCEALQKLGKHYDIVV  140



>emb|CAN62581.1| hypothetical protein VITISV_036570 [Vitis vinifera]
Length=297

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  276  FASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTS  455
            FAS+RF GKPLV ILGKPMIQRTWERAKLA  LD VVVATDD+KIA+CCRGFGA+VIMTS
Sbjct  60   FASSRFQGKPLVQILGKPMIQRTWERAKLATTLDHVVVATDDDKIADCCRGFGADVIMTS  119

Query  456  ESCRNGTERCNEALQKLEKKYDIVV  530
            ESCRNGTERCNEALQKLEK+YDIVV
Sbjct  120  ESCRNGTERCNEALQKLEKQYDIVV  144



>ref|XP_010231033.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial 
isoform X1 [Brachypodium distachyon]
Length=364

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  240  FRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAEC  419
            FR+  +GIIPAR+AS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDDEKIAEC
Sbjct  41   FRTLAVGIIPARYASSRFEGKPLALILGKPMIQRTWERVMLASSLDHVVVATDDEKIAEC  100

Query  420  CRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            CRGFGA+VIMTS SC+NG+ERC EALQKLEK YDIVV
Sbjct  101  CRGFGADVIMTSVSCQNGSERCCEALQKLEKCYDIVV  137



>gb|EMT25203.1| hypothetical protein F775_52244 [Aegilops tauschii]
Length=240

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  255  IGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFG  434
            +GIIPAR+AS+RF GKPL  ILGKPMIQRTWER  LA +LD VVVATDDEKIAECCRGFG
Sbjct  13   VGIIPARYASSRFEGKPLALILGKPMIQRTWERVMLASSLDHVVVATDDEKIAECCRGFG  72

Query  435  AEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            A+VIMTS SC+NG+ERC EALQKL K YDIVV
Sbjct  73   ADVIMTSVSCQNGSERCCEALQKLRKHYDIVV  104



>emb|CAB89847.1| CMP-KDO synthetase [Zea mays]
Length=236

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  264  IPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEV  443
            IPARFASTRF GKPLV ILGKPMIQRTWER  LA +LD VVVATDDE+IAECCRGFGA+V
Sbjct  1    IPARFASTRFEGKPLVPILGKPMIQRTWERVMLASSLDHVVVATDDERIAECCRGFGADV  60

Query  444  IMTSESCRNGTERCNEALQKLEKKYDIVV  530
            IMTS SC+NG+ERC EAL+KL+K YDIVV
Sbjct  61   IMTSASCKNGSERCCEALKKLDKHYDIVV  89



>ref|XP_001784950.1| predicted protein [Physcomitrella patens]
 gb|EDQ50258.1| predicted protein [Physcomitrella patens]
Length=290

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +3

Query  216  RYFLRSG-KFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVA  392
             Y+ R+  K R RV+G+IPARF S+RF GKPLV I+GKPMIQRTWE+A    +L  +VVA
Sbjct  32   HYWFRARLKARPRVVGVIPARFKSSRFEGKPLVHIMGKPMIQRTWEQAMKCTSLQAIVVA  91

Query  393  TDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            TDD++IA+CCRGFGA+V+MTSE+C+NGTERCNEAL+KL  KYDIVV
Sbjct  92   TDDDRIADCCRGFGADVVMTSENCQNGTERCNEALEKLAAKYDIVV  137



>ref|XP_002981117.1| hypothetical protein SELMODRAFT_113793 [Selaginella moellendorffii]
 gb|EFJ17818.1| hypothetical protein SELMODRAFT_113793 [Selaginella moellendorffii]
Length=255

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  243  RSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECC  422
            RSRV+GIIPAR+AS+RF GKPL  ILGKPMIQRTWE+A+LA+ LD +VVATDDE+I +CC
Sbjct  6    RSRVVGIIPARYASSRFQGKPLALILGKPMIQRTWEQARLAKTLDALVVATDDERIRQCC  65

Query  423  RGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              FGAEV+MTSE C NGTERCNEA++KL++K+DIVV
Sbjct  66   EEFGAEVVMTSEKCPNGTERCNEAVKKLKRKFDIVV  101



>ref|XP_002982588.1| hypothetical protein SELMODRAFT_116934 [Selaginella moellendorffii]
 gb|EFJ16341.1| hypothetical protein SELMODRAFT_116934 [Selaginella moellendorffii]
Length=254

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  243  RSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECC  422
            RSRV+GIIPAR+AS+RF GKPL  ILGKPMIQRTWE+A+LA+ LD +VVATDDE+I +CC
Sbjct  6    RSRVVGIIPARYASSRFQGKPLALILGKPMIQRTWEQARLAKTLDALVVATDDERIRQCC  65

Query  423  RGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              FGAEV+MTSE C NGTERCNEA+++L++K+DIVV
Sbjct  66   EEFGAEVVMTSEKCPNGTERCNEAVKRLKRKFDIVV  101



>gb|AAY34906.1| CMP-KDO synthetase, partial [Prunus armeniaca]
Length=90

 Score =   134 bits (336),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  315  ILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEA  494
            ILGKPMIQRTWERAKLA  LD VVVATDDEKI ECCR FGA+VIMTSESCRNGTERC+EA
Sbjct  1    ILGKPMIQRTWERAKLATTLDHVVVATDDEKIRECCRSFGADVIMTSESCRNGTERCSEA  60

Query  495  LQKLEKKYDIVV  530
            +QKLEKKYDIVV
Sbjct  61   IQKLEKKYDIVV  72



>ref|XP_005843072.1| hypothetical protein CHLNCDRAFT_33280 [Chlorella variabilis]
 gb|EFN50970.1| hypothetical protein CHLNCDRAFT_33280 [Chlorella variabilis]
Length=303

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            V+G++PAR+ S+RFPGKPLV ILGKPMI RT+E+A  A+ LD VVVATDDE+IAE CR  
Sbjct  52   VVGVLPARYQSSRFPGKPLVPILGKPMILRTYEQACKAQTLDAVVVATDDERIAEACRAA  111

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            GA+ +MT   C NGTERC EA+ KL K+YDIV+
Sbjct  112  GAQAVMTHPDCPNGTERCEEAVSKLSKQYDIVL  144



>ref|XP_005648194.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE23650.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=284

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  243  RSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECC  422
            R RV+G+IPAR+ S RFPGKPLV ILGKPM+ RTWE+A  A  L +VVVATDDE+IA  C
Sbjct  30   RLRVVGVIPARYQSVRFPGKPLVSILGKPMVVRTWEQASKATTLQKVVVATDDERIASAC  89

Query  423  RGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            R  GAEV+MTS  C NGT RC+EA+ KL  +YDIV+
Sbjct  90   RDAGAEVVMTSSECPNGTVRCHEAVTKLLGEYDIVI  125



>ref|XP_011396550.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Auxenochlorella 
protothecoides]
 gb|KFM23676.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Auxenochlorella 
protothecoides]
Length=287

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            ++GI+PAR+ S+RFPGKPL+ +LGKPMI  T+++A  A  LD VVVATDDE+IA  CR  
Sbjct  25   LVGILPARYDSSRFPGKPLIPLLGKPMILHTYDQACKATTLDAVVVATDDERIASVCRAH  84

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            GA+V+MT   C NGTERC EA+Q L K+YDIV+
Sbjct  85   GAQVVMTRPDCPNGTERCEEAVQALGKQYDIVI  117



>gb|KDO74064.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
 gb|KDO74065.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
 gb|KDO74066.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
Length=133

 Score =   119 bits (299),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  339  RTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKY  518
            RTWER+KLA  LD +VVATDDEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKY
Sbjct  1    RTWERSKLATTLDHLVVATDDEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKY  60

Query  519  DIVV  530
            DIVV
Sbjct  61   DIVV  64



>gb|KDO74063.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
Length=199

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  339  RTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKY  518
            RTWER+KLA  LD +VVATDDEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKY
Sbjct  1    RTWERSKLATTLDHLVVATDDEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKY  60

Query  519  DIVV  530
            DIVV
Sbjct  61   DIVV  64



>ref|XP_010910968.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like 
[Elaeis guineensis]
Length=220

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +3

Query  330  MIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLE  509
            MIQRTWERAKLA +L+ VVVATDDEKIAECCRGFGA+VIMTSESC+NGTERC EALQKL+
Sbjct  1    MIQRTWERAKLASSLEHVVVATDDEKIAECCRGFGADVIMTSESCQNGTERCCEALQKLK  60

Query  510  KKYDIVV  530
            + YDIVV
Sbjct  61   RNYDIVV  67



>gb|KDO74061.1| hypothetical protein CISIN_1g0225552mg, partial [Citrus sinensis]
Length=217

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  339  RTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKY  518
            RTWER+KLA  LD +VVATDDEKIAECC+ FGA+VIMTSESCRNGTERCNEALQKLEKKY
Sbjct  1    RTWERSKLATTLDHLVVATDDEKIAECCQQFGADVIMTSESCRNGTERCNEALQKLEKKY  60

Query  519  DIVV  530
            DIVV
Sbjct  61   DIVV  64



>gb|KCW67327.1| hypothetical protein EUGRSUZ_F01114 [Eucalyptus grandis]
Length=191

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  330  MIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLE  509
            MIQRTWERAKLA +LD +VVATDDEKIA CCRGFGA+VIMTSESC NG ERCNEAL KL+
Sbjct  1    MIQRTWERAKLAASLDHLVVATDDEKIAACCRGFGADVIMTSESCWNGNERCNEALLKLD  60

Query  510  KKYDIVV  530
            KKYDIVV
Sbjct  61   KKYDIVV  67



>ref|WP_045997502.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Loktanella sp. 
S4079]
 gb|KJZ19362.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Loktanella sp. 
S4079]
Length=266

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            VI +IPAR+ASTR+PGKPLV++ G     K +I+R+W+ A     +D+VVVATDD++IA+
Sbjct  3    VIIVIPARYASTRYPGKPLVELRGADGQAKSLIRRSWDAAMQVEGVDRVVVATDDDRIAD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              RGFGAEV+MTS  C+NGTERC EALQ ++  YDIVV
Sbjct  63   AARGFGAEVVMTSVDCQNGTERCAEALQNIDGDYDIVV  100



>ref|WP_039711500.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Scytonema millei]
 gb|KIF24118.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Scytonema millei 
VB511283]
Length=260

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            V+ +IPAR+ STRFPGKPL  I G PMI+R W  A  A  +D+ VVATDDE+IAE  RGF
Sbjct  3    VLAVIPARYGSTRFPGKPLAPIAGTPMIERVWRIASAAEGVDRTVVATDDERIAEAVRGF  62

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G E +MT E+CRNGTER   AL  L    DIVV
Sbjct  63   GGEAVMTPETCRNGTERALAALDALNSDADIVV  95



>ref|WP_038075781.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava pacifica]
 gb|KEO54467.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava pacifica 
DSM 10166]
Length=266

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV++ G     K +IQR+WE A+  + +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVELTGCTGEKKTLIQRSWEAAQDVQGVDRVVVATDDDRIRT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             C  FGAEV+MTSESCRNGTERC EA Q L   Y+IVV
Sbjct  63   ACEAFGAEVVMTSESCRNGTERCAEAAQALGGGYEIVV  100



>ref|WP_038068247.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava dalianensis]
 gb|KEP68691.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava dalianensis]
Length=266

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +IQR+WE A     +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGASGQSKTLIQRSWEAAISVTGVDRVVVATDDDRIRT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+CRNGTERC EA  +LE  YDI+V
Sbjct  63   AAEGFGAEVVMTSEACRNGTERCAEAAARLESDYDIIV  100



>ref|WP_023937494.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Porphyromonas]
 dbj|GAD05359.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
crevioricanis JCM 15906]
 dbj|GAD08179.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
cansulci JCM 13913]
 gb|KGN91043.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
crevioricanis]
 gb|KGN94641.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
crevioricanis]
Length=251

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +VI IIPAR+ASTR PGKPL+D+LGKPMIQR  E+A  ++A+++V+VATDDE+I      
Sbjct  3    KVIAIIPARYASTRLPGKPLIDMLGKPMIQRVVEQA--SKAVERVIVATDDERIISAVES  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   I+TSESC++GT+RC EAL KL ++ DIV+
Sbjct  61   FGGTAILTSESCKSGTDRCREALDKLGEEADIVI  94



>ref|WP_015814489.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dyadobacter 
fermentans]
 gb|ACT96248.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Dyadobacter 
fermentans DSM 18053]
Length=247

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R++GIIPAR+ASTRFP K LVDI GK MIQR +E+A  A  LDQV+VATDDE+I    R 
Sbjct  2    RILGIIPARYASTRFPAKALVDIGGKSMIQRVYEQASKATQLDQVIVATDDERILYHVRE  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG + +MTS+  ++GT+RC EAL + E  YD V+
Sbjct  62   FGGQAVMTSQDHQSGTDRCFEALSQTEGTYDYVI  95



>ref|WP_026625033.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dysgonomonas 
capnocytophagoides]
Length=248

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR++S+RFPGKPL D+ GKPMIQR +E+ KLA  LD+V VATDD +I E    
Sbjct  2    KFIGIIPARYSSSRFPGKPLADMAGKPMIQRVYEQVKLA--LDEVWVATDDTRILEAVEA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   +MTS S ++GT+RC EA QK+ K +D+++
Sbjct  60   FGGNAVMTSASHKSGTDRCKEAYQKINKDFDVII  93



>ref|WP_038145601.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava sp. 
13D2W-2]
 gb|KFE35103.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava sp. 
13D2W-2]
Length=266

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV++ G     K +IQR+WE A+    +D+VVVATDDE+I  
Sbjct  3    VLIVIPARYASTRYPGKPLVELTGVTGEKKTLIQRSWEAAQAVSGVDRVVVATDDERIRA  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+CRNGTERC EA + L   ++IVV
Sbjct  63   LSEGFGAEVVMTSEACRNGTERCAEAAETLGGGFEIVV  100



>ref|WP_028092696.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Donghicola xiamenensis]
Length=266

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDI-----LGKPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPARFASTR+PGKPLV++      GK +IQR+WE A   R +D+VVVATDD++I E
Sbjct  3    VLVAIPARFASTRYPGKPLVELKGASGQGKSLIQRSWEAASAVRGVDRVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTS SC NGTERC E L  L   YDIVV
Sbjct  63   AAESFGAEVVMTSTSCANGTERCAEVLDNLGGGYDIVV  100



>ref|WP_043868136.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Celeribacter 
indicus]
 gb|AJE44988.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Celeribacter 
indicus]
Length=266

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV++ G     K ++QR+WE A     +D+VVVATDD +I  
Sbjct  3    VLIVIPARYASTRYPGKPLVELAGASGRRKSLVQRSWEAAVSVPGIDRVVVATDDARIRT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+C NGTERC+EAL+ L   YDIVV
Sbjct  63   AAEGFGAEVVMTSETCANGTERCSEALETLGGGYDIVV  100



>ref|WP_040178930.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter 
sp. S60]
 gb|KII17297.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter 
sp. S60]
Length=266

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPARFASTR+PGKPLV + G     + +I+R+W  A     +D+VVVATDDE+I +
Sbjct  3    VLIVIPARFASTRYPGKPLVALTGASGESQTLIERSWRAAMAVNGVDRVVVATDDERIHD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EAL  L   YDIVV
Sbjct  63   AATGFGAEVVMTSESCGNGTERCAEALANLGGGYDIVV  100



>gb|ACN28946.1| unknown [Zea mays]
Length=202

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +3

Query  330  MIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLE  509
            MIQRTWER  LA +LD VVVATDDE+IAECCRGFGA+VIMTS SC+NG+ERC EAL+KL+
Sbjct  1    MIQRTWERVMLASSLDHVVVATDDERIAECCRGFGADVIMTSASCKNGSERCCEALKKLD  60

Query  510  KKYDIVV  530
            K YDIVV
Sbjct  61   KHYDIVV  67



>ref|WP_022456342.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. CAG:409]
 emb|CDE62084.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. CAG:409]
Length=251

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E  ++ +A+D+V VATDDE+I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMDGKPMIQRVYE--QVIQAVDEVCVATDDERIEAAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ K +D+V+
Sbjct  60   FGGKVVMTSDKHRSGTDRCFEAYQKIGKGFDVVI  93



>ref|WP_013455330.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Marivirga tractuosa]
 gb|ADR23188.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Marivirga tractuosa 
DSM 4126]
Length=246

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IGIIPAR+ STRFPGKPLVDI GK MIQR  E+ K + AL +VVVATDD++I E  +  
Sbjct  3    IIGIIPARYGSTRFPGKPLVDIGGKSMIQRVVEQCKKSSALKKVVVATDDDRIFEHVKEL  62

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G EV MTS   +NGTERC+EAL+ +   YD V+
Sbjct  63   GHEVYMTSPDHKNGTERCHEALKLVNDSYDFVI  95



>ref|WP_040175228.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter 
sp. S26]
 gb|KII13169.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter 
sp. S26]
Length=266

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPARFASTR+PGKPLV + G     + +I+R+W  A     +D+VVVATDDE+I +
Sbjct  3    VLIVIPARFASTRYPGKPLVALTGASGESQTLIERSWRAAMAVNGVDRVVVATDDERIRD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EAL  L   YDIVV
Sbjct  63   AATGFGAEVVMTSESCGNGTERCAEALANLGGGYDIVV  100



>ref|WP_037505655.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. H1ai]
Length=248

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IGIIPAR+ASTRFPGKPLVDI GK MIQR +E+A  A++L +VVVATDDE+IA+  + F
Sbjct  1    MIGIIPARYASTRFPGKPLVDIAGKSMIQRVYEQASKAKSLSKVVVATDDERIADEVKRF  60

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G E I TS   ++GT+RC E +++L   YDIV+
Sbjct  61   GGEFIFTSSDHQSGTDRCAEVIEQL-PGYDIVI  92



>ref|WP_014881488.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter 
gallaeciensis]
 gb|AFO93085.1| 3-deoxy-manno-octulosonate cytidylyltransferase KdsB [Phaeobacter 
inhibens DSM 17395]
Length=266

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +I+R+W  A     +D+VVVATDDE+I  
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGASGESQTLIERSWRAAMAVNGVDRVVVATDDERIRG  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EAL  LE  YDIVV
Sbjct  63   AATGFGAEVVMTSESCGNGTERCAEALATLEGGYDIVV  100



>ref|WP_010528306.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thermophagus 
xiamenensis]
Length=252

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            ++GIIPAR+ASTRFPGKPL DI GKPMIQR +E+A  ++ L QVVVATDDE+I E    F
Sbjct  6    ILGIIPARYASTRFPGKPLADIGGKPMIQRVYEQA--SKVLPQVVVATDDERIMEAVSNF  63

Query  432  GAEVIMTSESCRNGTERCNEALQKLE----KKYDIVV  530
            G + +MT++S R+GT+RC EAL K E    + Y +VV
Sbjct  64   GGQGVMTAKSHRSGTDRCQEALNKTEILHNRSYKVVV  100



>ref|WP_014876334.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Phaeobacter 
gallaeciensis]
 gb|AFO89231.1| 3-deoxy-manno-octulosonate cytidylyltransferase KdsB [Phaeobacter 
gallaeciensis 2.10]
Length=266

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +I+R+W  A     +D+VVVATDDE+I  
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGASGESQTLIERSWRAAMAVNGVDRVVVATDDERIRG  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EAL  LE  YDIVV
Sbjct  63   AATGFGAEVVMTSESCGNGTERCAEALATLEGGYDIVV  100



>ref|WP_035255598.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Actibacterium 
mucosum]
 gb|KAJ57305.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Actibacterium 
mucosum KCTC 23349]
Length=266

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPAR+ASTR+PGKPLV + G     K +IQR+WE A     +D VVVATDD++I E
Sbjct  3    VLIAIPARYASTRYPGKPLVPLTGAGGESKTLIQRSWEAAMAVSGVDHVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSE+C NGTERC+EA +KL + +D++V
Sbjct  63   ASEAFGAEVVMTSENCANGTERCSEAFEKLGRDFDVIV  100



>sp|A6L9D4.1|KDSB_PARD8 RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Parabacteroides distasonis 
ATCC 8503]
 gb|ABR42298.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis ATCC 8503]
Length=251

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  3    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKA  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  61   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  94



>ref|WP_005855678.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Parabacteroides]
 gb|EKN23305.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis CL03T12C09]
 emb|CDB48652.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. CAG:2]
Length=250

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  60   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  93



>gb|EEU51150.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. D13]
 gb|EFK61373.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. 20_3]
Length=251

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  3    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKA  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  61   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  94



>ref|WP_005865386.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Parabacteroides]
 gb|EKN27051.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. D25]
 gb|EKN27259.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis CL09T03C24]
 gb|KDS37476.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis str. 3776 D15 i]
 gb|KDS48297.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis str. 3776 Po2 i]
 gb|KDS73705.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis str. 3776 D15 iv]
Length=250

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  60   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  93



>ref|WP_019954246.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Loktanella vestfoldensis]
Length=266

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +I+R+W+ A     +D+VVVATDD++IA+
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGATGVAKTLIRRSWDAAMAVDGIDRVVVATDDDRIAD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              RGFGAEV+MT+ +C NGTERC EA++ L   YDIVV
Sbjct  63   AARGFGAEVVMTAATCANGTERCAEAVETLGGGYDIVV  100



>gb|EEY84280.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Bacteroides 
sp. 2_1_33B]
Length=251

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V +ATDD +I    + 
Sbjct  3    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCIATDDIRIENAVKA  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  61   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  94



>ref|WP_015027427.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Emticicia oligotrophica]
 gb|AFK01724.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Emticicia oligotrophica 
DSM 17448]
Length=246

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +++GIIPARFAS+RFPGKPLVDI GK MIQR +E+A+ A +L  V VATDD++I +   G
Sbjct  2    KILGIIPARFASSRFPGKPLVDIGGKSMIQRVYEQAQKAPSLTSVAVATDDQRIYDHVLG  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKL--EKKYDIVV  530
            FG EV MTSE+  +GT+RC EA QK     K+D V+
Sbjct  62   FGGEVYMTSENHPSGTDRCYEAYQKAGGSSKFDYVI  97



>ref|WP_034531370.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bacteroides 
sp. 2_1_33B]
Length=250

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V +ATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCIATDDIRIENAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  60   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  93



>gb|KEJ86014.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
sp. 31_2]
Length=251

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  3    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKT  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  61   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  94



>gb|EFI07282.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Bacteroides 
sp. 3_1_19]
Length=251

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  3    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKT  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  61   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  94



>ref|WP_034527937.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Bacteroidales]
 gb|KDS65437.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis str. 3999B T(B) 4]
 gb|KDS75537.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
distasonis str. 3999B T(B) 6]
Length=250

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMNGKPMIQRVYEQVK--DVLDSVCVATDDIRIENAVKT  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS+  R+GT+RC EA QK+ + YD++V
Sbjct  60   FGGQVVMTSDQHRSGTDRCYEAYQKIGEGYDVIV  93



>ref|WP_024098828.1| CMP-2-keto-3-deoxyoctulosonic acid synthetase [Phaeobacter gallaeciensis]
 gb|AHD11230.1| CMP-2-keto-3-deoxyoctulosonic acid synthetase [Phaeobacter gallaeciensis 
DSM 26640]
Length=266

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +I+R+W  A     +D+VVVATDDE+I +
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGASGESQTLIERSWRAAMAVNGVDRVVVATDDERIRD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EAL  L   YDIVV
Sbjct  63   AATGFGAEVVMTSESCGNGTERCAEALANLGGGYDIVV  100



>ref|WP_016777332.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Anaerophaga 
thermohalophila]
Length=252

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            ++GIIPAR+ASTRFPGKPL DI GKPMIQR +E+A  ++AL Q+VVATDD +I E  + F
Sbjct  6    ILGIIPARYASTRFPGKPLADIGGKPMIQRVYEQA--SKALTQLVVATDDTRIMEAVKNF  63

Query  432  GAEVIMTSESCRNGTERCNEALQKLE----KKYDIVV  530
            G   +MTS+  R+GT+RC EAL K E    +KY +VV
Sbjct  64   GGVCVMTSDRHRSGTDRCTEALDKTEALNNRKYQVVV  100



>ref|WP_008282626.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. TM1035]
 gb|EDM30187.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. TM1035]
Length=266

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +IQR+WE A   + +D+VVVATDD++I  
Sbjct  3    VVIVIPARYASTRYPGKPLVALTGATGEAKSLIQRSWEAASQVQGVDRVVVATDDDRIRA  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSESC NGTERC EAL  L   YDI+V
Sbjct  63   ASEAFGAEVVMTSESCGNGTERCAEALDVLGGGYDIIV  100



>ref|WP_039843135.1| 3-deoxy-manno-octulosonate cytidylyltransferase, partial [Pedobacter 
agri]
Length=97

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  255  IGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFG  434
            IGIIPAR+ASTRFPGKPLVDI GK MIQR +E+A  A++L +VVVATDDE+IA+  + FG
Sbjct  9    IGIIPARYASTRFPGKPLVDIAGKTMIQRVYEQASKAKSLSKVVVATDDERIADEVKRFG  68

Query  435  AEVIMTSESCRNGTERCNEALQKL  506
             E + T    ++GT+RC E ++KL
Sbjct  69   GEFVFTGSQHQSGTDRCAEVIEKL  92



>ref|WP_026350652.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dyadobacter 
beijingensis]
Length=247

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R++GIIPAR+ASTRFP K LVDI GK MIQR +E+A  A  L QV+VATDDE+I      
Sbjct  2    RILGIIPARYASTRFPAKALVDIGGKSMIQRVYEQASKATQLGQVIVATDDERIFNHVEE  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG + +MTSE  ++GT+RC EAL K +  YD V+
Sbjct  62   FGGKAVMTSEDHQSGTDRCYEALSKTDGGYDYVI  95



>ref|WP_013385423.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ketogulonicigenium 
vulgare]
 ref|YP_005796034.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Ketogulonicigenium 
vulgare WSH-001]
 gb|ADO43775.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ketogulonicigenium 
vulgare Y25]
 gb|AEM42038.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Ketogulonicigenium 
vulgare WSH-001]
Length=266

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPARFASTR+PGKPLV + G     K +I+R+W  A  A  +D+VVVATDD +I  
Sbjct  3    VLVVIPARFASTRYPGKPLVALKGADGTAKTLIERSWLAAMSASGVDRVVVATDDARIKA  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MT+ +CRNGTERC EAL  L  +YDIVV
Sbjct  63   AAEGFGAEVVMTATTCRNGTERCAEALDVLAAQYDIVV  100



>gb|KKB50181.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. HGS0025]
Length=252

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMAGKPMIQRVYEQVK--DVLDAVCVATDDTRIEAAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG EV+MTS+  R+GT+RC EA  K+   YD+VV
Sbjct  60   FGGEVVMTSDQHRSGTDRCYEAYTKVGLGYDVVV  93



>ref|WP_010421691.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Anaerophaga 
thermohalophila]
Length=252

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 6/97 (6%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            ++GIIPAR+ASTRFPGKPL DI GKPMIQR +E+A  ++AL Q+VVATDD +I E  + F
Sbjct  6    ILGIIPARYASTRFPGKPLADIGGKPMIQRVYEQA--SKALTQLVVATDDTRIMEAVKNF  63

Query  432  GAEVIMTSESCRNGTERCNEALQKLE----KKYDIVV  530
            G   +MTS+  R+GT+RC EAL K E    ++Y +VV
Sbjct  64   GGVCVMTSDKHRSGTDRCTEALDKTEALNNRQYQVVV  100



>ref|XP_007508518.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bathycoccus 
prasinos]
 emb|CCO20135.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Bathycoccus 
prasinos]
Length=321

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  243  RSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECC  422
            R++V+G+IPAR+ASTRFPGKPLV I GKPMI RT+ +AK A  LD +VVATDDE+I +  
Sbjct  71   RTKVLGVIPARYASTRFPGKPLVMIAGKPMIVRTYLQAKKASQLDALVVATDDERIRDAI  130

Query  423  RGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               G +V+MT E+  NGTERC +A  +   +YDIVV
Sbjct  131  VKAGGDVVMTDEAIPNGTERCAQAADRTAGEYDIVV  166



>ref|WP_038128468.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava sp. 
DT23-4]
 gb|KEO61095.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thioclava sp. 
DT23-4]
Length=266

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+AS+R+PGKPLV++ G     K +IQR+WE A     +D+VVVATDD +I +
Sbjct  3    VLIVIPARYASSRYPGKPLVELTGATGTAKTLIQRSWEAAMDVTGVDRVVVATDDARIRD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              + FGAEV+MTSE+CRNGTERC EA  KL   Y+IVV
Sbjct  63   AAQAFGAEVVMTSENCRNGTERCAEAAAKLGDTYEIVV  100



>ref|WP_045753550.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. PM2-P1-29]
 emb|CDS93470.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. PM2-P1-29]
Length=247

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +VIGIIPAR+AS+RFPGKPL+DI GK MIQR +E+ K A  L +V+VATDDE+IAE  R 
Sbjct  2    KVIGIIPARYASSRFPGKPLIDIAGKSMIQRVYEQVKSASCLHEVIVATDDERIAEHVRS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F   V MTS + ++GT+RC E + K+   +DI +
Sbjct  62   FAGNVAMTSSAHQSGTDRCAEVVSKI-SGFDIAI  94



>ref|WP_031525651.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dyadobacter 
crusticola]
Length=245

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R++GIIPAR+ASTRFP K LVDI GK MIQR +E++  A  LDQV+VATDD +I +  + 
Sbjct  2    RILGIIPARYASTRFPAKALVDIGGKSMIQRVYEQSSKATRLDQVIVATDDVRIMDHVKS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   +MT+ES ++GT+RC EAL K E  +D ++
Sbjct  62   FGGIAVMTAESHQSGTDRCYEALTKTEGNFDYII  95



>ref|WP_043747234.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicola sp. 
22II-S11g]
 gb|KGM49831.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicola sp. 
22II-S11g]
Length=266

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 5/95 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            +IPAR+ASTR+PGKPLV + G     K +IQR+WE A     +D+VVVATDD++I +   
Sbjct  6    VIPARYASTRYPGKPLVALTGATGEAKSLIQRSWEAASQVAGVDRVVVATDDDRIRDAAE  65

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             FGAEV+MTS++CRNGTERC EAL+ L   +D+VV
Sbjct  66   AFGAEVVMTSDTCRNGTERCAEALEVLGGDFDMVV  100



>ref|XP_005840663.1| hypothetical protein GUITHDRAFT_91881, partial [Guillardia theta 
CCMP2712]
 gb|EKX53683.1| hypothetical protein GUITHDRAFT_91881, partial [Guillardia theta 
CCMP2712]
Length=218

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAE  440
            IIPAR AS RFPGKPL  I GKP++QRT ER K AR +D+V VATDD++IA    G GA+
Sbjct  22   IIPARMASKRFPGKPLALIGGKPLVQRTLERVKRARHVDEVFVATDDQRIANLIEGIGAK  81

Query  441  VIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             IMTS  C +GTER  EA Q+L  ++DI+V
Sbjct  82   CIMTSHECESGTERVREASQQLSAEFDIIV  111



>ref|WP_037275977.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
mucosus]
 gb|KGM89490.1| CMP-2-keto-3-deoxyoctulosonic acid synthetase [Roseovarius mucosus 
DSM 17069]
Length=266

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +IQR+WE A   + +D+VVVATDD++I  
Sbjct  3    VVIVIPARYASTRYPGKPLVALTGATGEAKSLIQRSWEAACQVQGVDRVVVATDDDRIRA  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSESC NGTERC EAL+ +   YDI+V
Sbjct  63   ASEAFGAEVVMTSESCGNGTERCAEALEVMGGSYDIIV  100



>ref|WP_015808397.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter heparinus]
 gb|ACU04786.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Pedobacter 
heparinus DSM 2366]
Length=242

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +V+GIIPAR+ASTRFPGKPL++I GK MIQR +E+A  A +L +VVVATDDE+IAE    
Sbjct  2    KVLGIIPARYASTRFPGKPLIEIQGKSMIQRVYEQALKAISLTKVVVATDDERIAEAINN  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FGAE +MT +  ++GT+RC E  Q     +DIV+
Sbjct  62   FGAEFVMTRDDHQSGTDRCAEVSQHF-PDFDIVI  94



>ref|WP_015497229.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Octadecabacter 
arcticus]
 gb|AGI74281.1| 3-deoxy-manno-octulosonate cytidylyltransferase KdsB [Octadecabacter 
arcticus 238]
Length=266

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIA  413
            +V+ +IPAR+ASTR+PGKPLV++ G     + +IQR+W+ A+    +D+V VATDD++I 
Sbjct  2    KVLVVIPARYASTRYPGKPLVELRGATGEARSLIQRSWDAAQGVTGVDRVAVATDDDRIK  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                 FGAEV+MTS  C+NGTERC EAL KL   YDIVV
Sbjct  62   SAAEAFGAEVVMTSADCQNGTERCAEALDKLGGGYDIVV  100



>ref|WP_013446517.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Paludibacter 
propionicigenes]
 gb|ADQ81148.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Paludibacter 
propionicigenes WB4]
Length=260

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R +GIIPARFASTRFPGKPLVDI GK MIQR +E  ++++AL+ V VATDD +I E    
Sbjct  13   RFVGIIPARFASTRFPGKPLVDIGGKTMIQRVYE--QVSKALENVYVATDDNRIFEAVIS  70

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG + IMTS+  ++GT+RC EA  KL++ +D+VV
Sbjct  71   FGGKAIMTSDKHKSGTDRCFEAFTKLDEWFDVVV  104



>ref|WP_009570326.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Celeribacter 
baekdonensis]
 gb|EKE74478.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Celeribacter 
baekdonensis B30]
Length=266

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV++ G     K +I+R+W+ A     +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVELTGATGEAKSLIRRSWDAAIAVSGVDRVVVATDDDRIRT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSE+C NGTERC EAL+ L   YDIVV
Sbjct  63   AAEAFGAEVVMTSEACANGTERCAEALENLGGGYDIVV  100



>ref|XP_001758202.1| predicted protein [Physcomitrella patens]
 gb|EDQ77024.1| predicted protein, partial [Physcomitrella patens]
Length=167

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +3

Query  264  IPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGFGAEV  443
            IPAR+ S RF G+PLV I   PMIQRTWE+AK   +L  VVVA DD +IA+  R FGA+V
Sbjct  1    IPARYKSPRFEGEPLVHISDIPMIQRTWEQAKQFTSLKAVVVAIDDGRIADFYRAFGADV  60

Query  444  IMTSESCRNGTERCNEALQKLEKKYDIVV  530
             MTSE+C +GTERCNEAL+KL  +YDIVV
Sbjct  61   -MTSENCLSGTERCNEALEKLAAEYDIVV  88



>ref|WP_008561601.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria sp. 
R11]
 gb|EEB71597.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Ruegeria sp. 
R11]
Length=266

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGK-----PMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G       +I+R+W  A     +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVSLTGADGDSLTLIERSWRAAMAVTGVDRVVVATDDDRIRT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EAL  L   YDIVV
Sbjct  63   AAEGFGAEVVMTSESCANGTERCAEALANLGGGYDIVV  100



>ref|WP_045089745.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonadaceae 
bacterium ING2-E5B]
 emb|CEA16003.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonadaceae 
bacterium ING2-E5B]
Length=250

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            RV  IIPAR+ASTRFPGKPL D+ GKPMI+R +E+ +  + L  + VATDD +I E  + 
Sbjct  2    RVAAIIPARYASTRFPGKPLADMYGKPMIRRVYEQVQ--KVLPDLYVATDDMRIYEAVQN  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F   V+MTS+  R+GT+RC EA+ K++KKYD+V+
Sbjct  60   FQGNVVMTSQHHRSGTDRCMEAISKIDKKYDVVI  93



>ref|WP_015501886.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Octadecabacter 
antarcticus]
 gb|AGI70001.1| 3-deoxy-manno-octulosonate cytidylyltransferase KdsB [Octadecabacter 
antarcticus 307]
Length=266

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ IIPAR+ASTR+PGKPLV++ G     K +I+R+W  A+    +D+VVVATDD++I  
Sbjct  3    VLVIIPARYASTRYPGKPLVELRGATGESKSLIRRSWAAAQGVTGVDRVVVATDDDRIKS  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTS  C+NGTERC EAL KL   YDIVV
Sbjct  63   AAEAFGAEVVMTSTDCQNGTERCAEALDKLGGGYDIVV  100



>ref|WP_009159832.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thalassobium 
sp. R2A62]
 gb|EET48772.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Thalassobium 
sp. R2A62]
Length=266

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPARFASTR+PGKPLV++ G     K +I+R+W+ A+    +D+VVVATDD +I  
Sbjct  3    VLIVIPARFASTRYPGKPLVELRGASGEAKSLIRRSWDAAQQVSGIDRVVVATDDVRIQS  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             C  FGAEV+MTSE+C NGTERC EA + L   Y+IVV
Sbjct  63   ACEAFGAEVVMTSEACVNGTERCAEAHEALGGSYEIVV  100



>ref|WP_039533129.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria sp. 
ANG-S4]
 gb|KIC40893.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria sp. 
ANG-S4]
Length=266

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKP-----MIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G       +I+R+W  A     +D+VVVATDDE+I +
Sbjct  3    VLIVIPARYASTRYPGKPLVPLTGASGATMTLIERSWRAAMAVSGVDRVVVATDDERIRD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTS++CRNGTERC EA   L   YDIVV
Sbjct  63   VSEGFGAEVVMTSDTCRNGTERCAEAHAALGGGYDIVV  100



>ref|WP_035405825.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia suis]
 gb|ESN89537.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Chlamydia 
suis MD56]
Length=254

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  246  SRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            S+ IGI+PAR+ S+RFPGKPL +ILGK +IQR +E A L+R+LD VVVATDD++I +   
Sbjct  7    SKKIGILPARWGSSRFPGKPLAEILGKSLIQRAYENALLSRSLDCVVVATDDQRIFDHVV  66

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            GFG   +MTSE+C NGTER  EA+ +   + +IVV
Sbjct  67   GFGGLCVMTSEACANGTERVEEAVSQYFPQAEIVV  101



>ref|WP_036556332.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicola sp. 
MCTG156(1a)]
Length=266

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +IQR+WE A+    +D+VVVATDD++I +
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGPDGTAKSLIQRSWEAAQAVTGVDRVVVATDDDRIRD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MT+E+C NGTERC EAL++L   ++I+V
Sbjct  63   AAEAFGAEVVMTAETCANGTERCAEALERLGGGFEIIV  100



>dbj|GAO28025.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Geofilum rubicundum 
JCM 15548]
Length=252

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 6/100 (6%)
 Frame = +3

Query  243  RSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECC  422
            +  +IGIIPAR+ASTRFPGKPL DI GKPMIQR +E+A  ++AL  V VATDD++I++  
Sbjct  3    QESIIGIIPARYASTRFPGKPLADIGGKPMIQRVYEQA--SKALTNVYVATDDQRISKAV  60

Query  423  RGFGAEVIMTSESCRNGTERCNEALQKLE----KKYDIVV  530
              FG +VIMTS   ++GT+RC EAL  +E    + +D+V+
Sbjct  61   THFGGKVIMTSPDHQSGTDRCTEALNLIEMEEKRSFDVVI  100



>ref|WP_028728574.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
gordonii]
 gb|KKB60658.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
gordonii MS-1]
Length=252

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMAGKPMIQRVYEQVK--DVLDAVCVATDDVRIEAAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG EV+MTS+  ++GT+RC EA  K+   YD+VV
Sbjct  60   FGGEVVMTSDQHQSGTDRCYEAYTKVGLGYDVVV  93



>ref|WP_009504025.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Citreicella 
sp. 357]
 gb|EIE51483.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Citreicella 
sp. 357]
Length=262

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIA  413
            + +  IPARFASTRFPGKPL+++ G     K +IQR+W+ A+ A+ +D V V TDD +IA
Sbjct  2    KTVIFIPARFASTRFPGKPLIELAGTSGVRKTLIQRSWDAARQAQGVDAVYVLTDDARIA  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +  RGFGA+V+MTS   RNGTERC EAL +L    DIV+
Sbjct  62   DAARGFGADVLMTSSDARNGTERCAEALTQLGTDPDIVI  100



>ref|WP_013666771.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. 21]
 gb|ADZ80052.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. 21]
Length=244

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
             +IGIIPAR+ASTRFPGKPL+DI GK MI+R +E+A  A +L +VVVATDDE+IA   + 
Sbjct  2    NIIGIIPARYASTRFPGKPLIDINGKSMIRRVYEQALKASSLKRVVVATDDERIAHHVQN  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  VI+T+ S ++GT+RC E + K E  +DI +
Sbjct  62   FGGNVILTASSHQSGTDRCAEVIAK-ENSFDIAI  94



>ref|WP_039472359.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter kyungheensis]
 gb|KIA95879.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter kyungheensis]
Length=251

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +3

Query  246  SRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            S +IGIIPAR+ASTRFPGKPLVDI GK MIQR +E+A  A++L +VV+ATDDE+IA+  +
Sbjct  2    SEIIGIIPARYASTRFPGKPLVDIAGKTMIQRVYEQASKAKSLSKVVIATDDERIADEVK  61

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             FG E   T+   ++GT+RC E +++L   +DIV+
Sbjct  62   RFGGEFAFTAAHHQSGTDRCAEVIEQL-PGFDIVI  95



>ref|WP_029274713.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter borealis]
Length=248

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IGIIPAR+ASTRFPGKPLVDI GK MIQR +E+A  A +L +VV+ATDD +IA+  + F
Sbjct  1    MIGIIPARYASTRFPGKPLVDIAGKTMIQRVYEQASKAESLSKVVIATDDVRIADEVKRF  60

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G E I TS + ++GT+RC E ++ L  +YDIV+
Sbjct  61   GGEFIFTSTNHQSGTDRCAEVIETL-PEYDIVI  92



>ref|WP_028979558.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sporocytophaga 
myxococcoides]
Length=244

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
             +IGIIPAR+ASTRFP KPLV+I GK MI+R +E+A  AR L QVVVATD+ +I +  + 
Sbjct  2    NIIGIIPARYASTRFPAKPLVEIGGKSMIRRVYEQAGKARLLSQVVVATDNNEIFDHVKS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  V+MT E   +GT+RC EAL+K   K+D V+
Sbjct  62   FGGNVVMTREEHPSGTDRCFEALEKTSGKFDFVI  95



>ref|WP_039540163.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria sp. 
ANG-R]
 gb|KIC40402.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria sp. 
ANG-R]
Length=266

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGK-----PMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPAR+ASTR+PGKPLV + G       +I+R+W  A     +D+VVVATDD++I E
Sbjct  3    VLIAIPARYASTRYPGKPLVPLTGANGTSMTLIERSWRAAISVAGVDRVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+CRNGTERC EA   L+  YDIVV
Sbjct  63   VSEGFGAEVVMTSETCRNGTERCAEAHAVLDSGYDIVV  100



>ref|WP_035249396.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Actibacterium 
atlanticum]
 gb|KCV82473.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Actibacterium 
atlanticum]
Length=266

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +IQR+WE A   + +D+VVVATDD +I +
Sbjct  3    VLVVIPARYASTRYPGKPLVALKGASGESRTLIQRSWEAAMAVQGVDRVVVATDDNRIKD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSESC NGTERC EA   +   +DIVV
Sbjct  63   AAEAFGAEVVMTSESCANGTERCAEAFDNIGGGFDIVV  100



>ref|WP_040299194.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Arcticibacter 
svalbardensis]
Length=247

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R++G+IPAR+AS RFPGKPL+DI GK MIQR +E+A  +  L  V +ATDD++I E  R 
Sbjct  2    RILGLIPARYASKRFPGKPLIDIHGKSMIQRVYEQALKSATLSDVAIATDDDRILEHVRS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +VIMTS + ++GT+RC EA +KL   +D+++
Sbjct  62   FGGQVIMTSSNHQSGTDRCAEAAEKL-PGFDVII  94



>ref|WP_007811891.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. AzwK-3b]
 gb|EDM73178.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. AzwK-3b]
Length=266

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIA  413
            R + +IPAR+AS+R+PGKPLV++ G     K +IQR+WE A       +VVVATDD++I 
Sbjct  2    RALIVIPARYASSRYPGKPLVELTGASGAKKSLIQRSWEAACKVGGNHRVVVATDDDRIR  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +   GFGAEV MTSE+CRNGTERC EA + L   YDIVV
Sbjct  62   QAAEGFGAEVAMTSEACRNGTERCAEAHEVLGGGYDIVV  100



>ref|WP_039423526.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGN92644.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
Length=254

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  240  FRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAEC  419
              + VI IIPAR+AS+RFPGKPL D+LGKPMIQR +ER  +A  + + VVATDDE+I + 
Sbjct  1    MNTEVIAIIPARYASSRFPGKPLADMLGKPMIQRVYER--IAGVVPRAVVATDDERIRQA  58

Query  420  CRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               FG EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  59   VEDFGGEVVMTSPECSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_005651239.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae]
 gb|EKN27635.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae CL09T00C40]
Length=261

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ +    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADLAGKPMIQRVYEQVQ--NVLDSVCVATDDNRIEAAVQA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  VIMTS+  ++GT+RC EA  K+   YD+VV
Sbjct  60   FGGNVIMTSDQHKSGTDRCYEAYCKIGDGYDVVV  93



>ref|WP_039432450.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGN68001.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGN75559.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
Length=254

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  240  FRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAEC  419
              + VI IIPAR+AS+RFPGKPL D+LGKPMIQR +ER  +A  + + VVATDDE+I + 
Sbjct  1    MNTEVIAIIPARYASSRFPGKPLADMLGKPMIQRVYER--IAGVVPRAVVATDDERIRQA  58

Query  420  CRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               FG EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  59   VEDFGGEVVMTSPECSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_039417760.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Porphyromonas]
 gb|KGL50568.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGL54722.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
sp. COT-052 OH4946]
 gb|KGN86346.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGO02441.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
Length=254

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = +3

Query  240  FRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAEC  419
              + VI IIPAR+AS+RFPGKPL D+LGKPMIQR +ER  +A  + + VVATDDE+I + 
Sbjct  1    MNTEVIAIIPARYASSRFPGKPLADMLGKPMIQRVYER--IAGVVPRAVVATDDERIRQA  58

Query  420  CRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               FG EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  59   VEDFGGEVVMTSPECSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_008155288.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
johnsonii]
 gb|EKN12931.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
johnsonii CL02T12C29]
Length=253

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ +    LD V VATDD++I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMAGKPMIQRVYEQVQ--NVLDAVCVATDDDRIEAAVQA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  V+MTS+  ++GT+RC EA  K+   YD+VV
Sbjct  60   FGGHVVMTSDQHKSGTDRCYEAYCKIGDGYDVVV  93



>ref|WP_008150585.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
johnsonii]
 gb|EEC95784.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
johnsonii DSM 18315]
Length=253

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ +    LD V VATDD++I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMAGKPMIQRVYEQVQ--NVLDAVCVATDDDRIEAAVQA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  V+MTS+  ++GT+RC EA  K+   YD+VV
Sbjct  60   FGGHVVMTSDQHKSGTDRCYEAYCKIGDGYDVVV  93



>gb|EOR95637.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Arcticibacter 
svalbardensis MN12-7]
Length=256

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R++G+IPAR+AS RFPGKPL+DI GK MIQR +E+A  +  L  V +ATDD++I E  R 
Sbjct  11   RILGLIPARYASKRFPGKPLIDIHGKSMIQRVYEQALKSATLSDVAIATDDDRILEHVRS  70

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +VIMTS + ++GT+RC EA +KL   +D+++
Sbjct  71   FGGQVIMTSSNHQSGTDRCAEAAEKL-PGFDVII  103



>ref|WP_026462832.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Adhaeribacter 
aquaticus]
Length=248

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR++STRFPGKPLVDI GK MIQR +E+AK A  L+ VVVATDDE+IAE    
Sbjct  2    KSIGIIPARYSSTRFPGKPLVDIGGKTMIQRVYEQAKKAN-LEHVVVATDDERIAETVLQ  60

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F  EV++TS   ++GT+RC EA QK     D ++
Sbjct  61   FNGEVVLTSAHHQSGTDRCFEAFQKFSYPADCII  94



>ref|WP_039434264.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGN75733.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGN89543.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGO04381.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
Length=254

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            VI IIPAR+AS+RFPGKPL D+LGKPMIQR +ER  +A  + + VVATDDE+I +    F
Sbjct  5    VIAIIPARYASSRFPGKPLADMLGKPMIQRVYER--IAGVVPRAVVATDDERIRQAVEDF  62

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  63   GGEVVMTSPGCSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_043140282.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ponticoccus 
sp. UMTAT08]
 gb|KHQ53390.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ponticoccus 
sp. UMTAT08]
Length=262

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 68/95 (72%), Gaps = 5/95 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
             IPAR+ASTR+PGKPLV++ G     K +IQR+WE A+  +  D V V TDD +IAE  R
Sbjct  6    FIPARYASTRYPGKPLVELKGATGEAKSLIQRSWEAAQSVKGADAVYVLTDDARIAEAAR  65

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            GFGAEV+MTSES RNGTERC E + +L +  D VV
Sbjct  66   GFGAEVLMTSESARNGTERCAEGVAQLSQTPDCVV  100



>ref|WP_024810562.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicola sp. 
HL-35]
Length=266

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR ASTR+PGKPLV + G     + +I+R+W  A+    +D+VVVATDDE+I E
Sbjct  3    VLIVIPARHASTRYPGKPLVGLTGAGGTNRTLIERSWRAARDVTGVDRVVVATDDERIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              +GFGAEV+MTSE CRNGTERC +A + +   +DIVV
Sbjct  63   AAQGFGAEVVMTSEDCRNGTERCAQAHEVMGGGFDIVV  100



>ref|WP_018965264.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
 gb|KGN81669.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gulae]
Length=254

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            VI IIPAR+AS+RFPGKPL D+LGKPMIQR +ER  +A  + + VVATDDE+I +    F
Sbjct  5    VIAIIPARYASSRFPGKPLADMLGKPMIQRVYER--IAGVVPRAVVATDDERIRQAVEDF  62

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  63   GGEVVMTSPECSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_005641144.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Parabacteroides]
 gb|EDN84550.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae ATCC 43184]
 gb|EKN07423.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae CL03T12C32]
 emb|CDD13511.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
merdae CAG:48]
Length=261

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ GKPMIQR +E+ +    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADLAGKPMIQRVYEQVQ--NVLDAVCVATDDNRIEAAVQA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  VIMTS+  ++GT+RC EA  K+   YD+VV
Sbjct  60   FGGNVIMTSDQHKSGTDRCYEAYCKIGDGYDVVV  93



>ref|WP_045467694.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sporocytophaga 
myxococcoides]
 dbj|GAL87049.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sporocytophaga 
myxococcoides]
Length=244

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
             ++GIIPAR+ASTRFP KPL+DI GK MI+R +E+AK A+ L  VVVATD+ +I +  + 
Sbjct  2    NILGIIPARYASTRFPAKPLIDIGGKSMIRRVYEQAKKAKLLSNVVVATDNNEIFDHVKS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  V+MT E   +GT+RC EAL+K    +D V+
Sbjct  62   FGGNVVMTKEEHPSGTDRCFEALEKTSGNFDFVI  95



>ref|WP_013934884.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Zymomonas mobilis]
 gb|AEI38496.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Zymomonas 
mobilis subsp. pomaceae ATCC 29192]
Length=266

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            IIPARFASTR+PGKPLV + G     KP+I R+WE A     +D+VVVATDDE+IAE  R
Sbjct  6    IIPARFASTRYPGKPLVPLTGIEGEQKPLIIRSWEAACSVEGVDRVVVATDDERIAEVVR  65

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              G E +MT  SCRNGTERC  AL +L   +D+++
Sbjct  66   KAGGEALMTPSSCRNGTERCAAALDQLGDDFDLII  100



>ref|WP_040650434.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. 217]
Length=266

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 5/95 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            +IPARFASTR+PGKPLV + G     K +I+R+WE A   + +D+VVVATDD++I     
Sbjct  6    VIPARFASTRYPGKPLVSLTGATGEAKSLIRRSWEAACQVQGVDRVVVATDDDRIRSASE  65

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             FGAEV+MTSE+C NGTERC EAL+ L   +DI+V
Sbjct  66   AFGAEVVMTSEACGNGTERCAEALEVLGDGFDIIV  100



>gb|EAQ24665.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. 217]
Length=269

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 5/95 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            +IPARFASTR+PGKPLV + G     K +I+R+WE A   + +D+VVVATDD++I     
Sbjct  9    VIPARFASTRYPGKPLVSLTGATGEAKSLIRRSWEAACQVQGVDRVVVATDDDRIRSASE  68

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             FGAEV+MTSE+C NGTERC EAL+ L   +DI+V
Sbjct  69   AFGAEVVMTSEACGNGTERCAEALEVLGDGFDIIV  103



>ref|WP_029285309.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter sp. 
R20-19]
Length=248

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IGIIPAR+ASTRFPGKPLVDI GK MIQR +E+A  A++L +VV+ATDD++IA+    F
Sbjct  1    MIGIIPARYASTRFPGKPLVDIAGKSMIQRVYEQALKAKSLSKVVIATDDQRIADEVEKF  60

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G E + T+   ++GT+RC E +++L  ++DIV+
Sbjct  61   GGEFVFTAAHHQSGTDRCAEVIEQL-PEFDIVI  92



>ref|WP_003007365.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
spiritivorum]
 gb|EEI92933.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Sphingobacterium 
spiritivorum ATCC 33300]
Length=246

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+AS+RFPGKPLVDI GK MIQR +E+ K    L +VVVATDD +I E  R 
Sbjct  2    KTIGIIPARYASSRFPGKPLVDIAGKSMIQRVYEQVKQTPGLHEVVVATDDTRIEEHVRS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F   V++TSE+  +GT+RC E + K+   +DI V
Sbjct  62   FAGNVVLTSETHESGTDRCAEVISKV-SGFDIAV  94



>ref|WP_026630897.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dyadobacter 
alkalitolerans]
Length=246

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R++GIIPAR+ASTRFP K LVDI GK MIQR +E++  A  LDQV+VATDDE+I      
Sbjct  2    RILGIIPARYASTRFPAKALVDIGGKSMIQRVYEQSSKATQLDQVIVATDDERIFNHVVD  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG + IMT  + ++GT+RC EAL K +  Y+ V+
Sbjct  62   FGGKAIMTDSAHQSGTDRCFEALSKTDGVYEYVI  95



>ref|WP_010138030.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicola sp. 
S124]
Length=261

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 4/85 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG----KPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +IPAR+ASTR+PGKPLV + G    K +I+R+WE A      D V VATDDE+IAE  RG
Sbjct  6    LIPARYASTRYPGKPLVTLTGPDGAKTLIRRSWEAAMSVPEADAVYVATDDERIAEAARG  65

Query  429  FGAEVIMTSESCRNGTERCNEALQK  503
            FGAEVIMTSE CRNGTERC +AL K
Sbjct  66   FGAEVIMTSEDCRNGTERCADALAK  90



>ref|WP_010800182.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Parabacteroides]
 gb|EMZ36152.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
sp. ASF519]
 gb|EOS14583.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
goldsteinii dnLKV18]
Length=252

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ G+PMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMAGRPMIQRVYEQVK--DVLDTVCVATDDSRIEAAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  V+MTS+  R+GT+R  EA  K+ + YD+VV
Sbjct  60   FGGNVVMTSDQHRSGTDRVYEAYTKVGQGYDVVV  93



>ref|WP_007657616.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
goldsteinii]
 gb|EKN09238.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
goldsteinii CL02T12C30]
 gb|KKB54600.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Parabacteroides 
goldsteinii DSM 19448 = WAL 12034]
Length=252

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ASTRFPGKPL D+ G+PMIQR +E+ K    LD V VATDD +I    + 
Sbjct  2    KFIGIIPARYASTRFPGKPLADMAGRPMIQRVYEQVK--DVLDAVCVATDDSRIEAAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG  V+MTS+  R+GT+R  EA  K+ + YD+VV
Sbjct  60   FGGNVVMTSDQHRSGTDRVYEAYTKVGQGYDVVV  93



>ref|WP_028714048.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Paracoccus]
Length=266

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR ASTR+PGKPLV++ G     + +I+R+WE A+  R +D+V+VATDDE+I +
Sbjct  3    VVIVIPARHASTRYPGKPLVELRGATGEGQSLIRRSWEAARAVRGIDRVIVATDDERIRD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV MTS + RNGTERC EA+ KL   ++IVV
Sbjct  63   HAEGFGAEVAMTSTAARNGTERCAEAVAKLGLTHEIVV  100



>ref|WP_005979887.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria lacuscaerulensis]
 gb|EEX09089.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Silicibacter 
lacuscaerulensis ITI-1157]
Length=266

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG---KPM--IQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPAR+ASTR+PGKPLV + G   KPM  I+R+W  A     +D+VVVATDD++I  
Sbjct  3    VLIAIPARYASTRYPGKPLVPLTGATGKPMTLIERSWRAAMSVSGVDRVVVATDDDRIRA  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EA  +L   Y+IVV
Sbjct  63   AAEGFGAEVVMTSESCANGTERCAEAHDRLGGGYEIVV  100



>ref|WP_008205584.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. SK209-2-6]
 gb|EBA16939.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. SK209-2-6]
Length=266

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+AS+R+PGKPL ++ G     + +I+R+W  A   + +D+VVVATDD++I E
Sbjct  3    VLLVIPARYASSRYPGKPLAELTGATGEKRTLIERSWRAACKVQGIDRVVVATDDDRIKE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSESC NGTERC EA Q L   YDIVV
Sbjct  63   AAEAFGAEVVMTSESCGNGTERCAEAHQVLGGGYDIVV  100



>ref|WP_022700420.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicaulis 
alexandrii]
Length=258

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            VI +IPAR+ STRFPGKPL +I G PM++R    A  A A+D+V+VATDD +I E  + F
Sbjct  3    VIAVIPARYGSTRFPGKPLHEIAGVPMVERVRRLAAAAPAIDRVIVATDDARILEAVKAF  62

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G E +MT ESCRNGTER  EA++   +  D++V
Sbjct  63   GGEAVMTPESCRNGTERAFEAVRDFAQPNDVIV  95



>ref|WP_013631698.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter saltans]
 gb|ADY51196.1| 3-deoxy-D-manno-octulosonatecytidylyltransferase [Pedobacter 
saltans DSM 12145]
Length=246

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +++G+IPARFASTRFPGKPLVDI GK MIQR +E++  A  L+ +VVATDD++I +  + 
Sbjct  2    KILGVIPARFASTRFPGKPLVDIAGKTMIQRVYEKSSSATTLNDLVVATDDKRIYDTVKS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F   VIMTS   ++GT+RC E  +K+   YD ++
Sbjct  62   FNGNVIMTSSDHQSGTDRCAEIAEKV-TGYDAII  94



>ref|WP_037247226.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. MCTG156(2b)]
Length=266

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +IQR+W  A   + +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGATGEGKSLIQRSWRAACQVQGVDRVVVATDDDRIRT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSE+C NGTERC EAL+ L   +DIVV
Sbjct  63   ASEAFGAEVVMTSEACGNGTERCAEALEALGGGFDIVV  100



>ref|WP_028955684.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sulfitobacter 
sp. 20_GPM-1509m]
Length=267

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G       +I+R+W  A   + +D+VVVATDD++IA+
Sbjct  3    VLVVIPARYASTRYPGKPLVALTGASGVASTLIERSWRAAMSVQGVDRVVVATDDDRIAD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              R FGAEV+MTS  C NGTERC EA   L   YD+VV
Sbjct  63   AARAFGAEVVMTSTQCANGTERCAEAHATLGGGYDVVV  100



>ref|WP_037922448.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sulfitobacter 
pseudonitzschiae]
 gb|KEJ96952.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sulfitobacter 
pseudonitzschiae]
Length=267

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G       +I+R+W  A   + +D+VVVATDD++IA+
Sbjct  3    VLVVIPARYASTRYPGKPLVALTGASGVASTLIERSWRAAMSVQGVDRVVVATDDDRIAD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              R FGAEV+MTS  C NGTERC EA   L   YD+VV
Sbjct  63   AARAFGAEVVMTSTQCANGTERCAEAHAALGGGYDVVV  100



>ref|WP_007118349.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanibulbus 
indolifex]
 gb|EDQ06280.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanibulbus 
indolifex HEL-45]
Length=266

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +I+R+W  A     +D+VVVATDD +I E
Sbjct  3    VLIVIPARYASTRYPGKPLVALTGASGKKQTLIERSWRAACAVSGVDRVVVATDDARIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+C NGTERC EA   L   YDIVV
Sbjct  63   AAEGFGAEVVMTSEACANGTERCAEAHAALGGGYDIVV  100



>ref|WP_021188746.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. IITKGP-BTPF85]
 gb|EQB82970.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
sp. IITKGP-BTPF85]
Length=247

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +VIGIIPAR+AS+RFPGKPLV I GK MIQR +E+ K    L +V+VATDD++IAE  + 
Sbjct  2    KVIGIIPARYASSRFPGKPLVGIGGKSMIQRVYEQVKNTSCLHEVIVATDDDRIAEHVKS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F   VIMT+ S ++GT+RC E + K+   +DIV+
Sbjct  62   FAGNVIMTASSHQSGTDRCAEVIAKV-SGFDIVI  94



>ref|WP_037314625.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria halocynthiae]
Length=266

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGK-----PMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPAR+ASTR+PGKPLV + G       +I+R+W  A     +D+VVVATDD++I E
Sbjct  3    VLIAIPARYASTRYPGKPLVPLTGANGVAMTLIERSWRAACSVSGVDKVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EA   L   YDIVV
Sbjct  63   VAEGFGAEVVMTSESCGNGTERCAEAHTTLGAGYDIVV  100



>ref|WP_023451750.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Asticcacaulis 
sp. AC460]
 gb|ESQ93029.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Asticcacaulis 
sp. AC460]
Length=261

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLV-----DILGKPMIQRTWERAKLARALDQVVVATDDEKIA  413
            + + IIPAR+AS+R+PGKPLV     D + K +IQR+WE AK  R +D V VATDD++I 
Sbjct  2    KTVVIIPARYASSRYPGKPLVMLKGRDGVAKSLIQRSWEAAKAVRGVDAVFVATDDDRIK  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +    FGAEVIMTSE C NGTER  +AL  L   YD+ V
Sbjct  62   DAAEAFGAEVIMTSELCANGTERVADALPGLPHAYDLYV  100



>ref|WP_039162639.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leisingera sp. 
ANG-M1]
 gb|KIC10330.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leisingera sp. 
ANG-M1]
Length=266

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +++R+W  A   + +D+VVVATDD++I +
Sbjct  3    VLIVIPARYASTRYPGKPLVPLTGATGEKRTLVERSWRAACSVQGVDRVVVATDDDRIKD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+C NGTERC EA   L   YDIVV
Sbjct  63   AAEGFGAEVVMTSETCANGTERCAEAHAALGGGYDIVV  100



>ref|WP_008232471.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. CCS2]
 gb|EBA14199.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. CCS2]
Length=266

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     K +I+R+W+ A     +++VV+ATDD +IA+
Sbjct  3    VLIVIPARYASTRYPGKPLVTLRGASGAAKSLIRRSWDAACDVAGIEKVVIATDDTRIAD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
              + FGAEV+MTS +C+NGTERC E L+KLE  +D+VV
Sbjct  63   ASQAFGAEVVMTSATCQNGTERCAETLKKLEGDFDLVV  100



>ref|WP_002994153.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sphingobacterium 
spiritivorum]
 gb|EFK55962.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Sphingobacterium 
spiritivorum ATCC 33861]
Length=246

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            ++IGIIPAR+AS+RFPGKPL+DI GK MIQR +E+ K    L +VVVATDD +I E  R 
Sbjct  2    KIIGIIPARYASSRFPGKPLIDIAGKSMIQRVYEQVKQTPGLHEVVVATDDIRIEEHVRS  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            F   V+MTS++  +GT+RC E + K+   +DI +
Sbjct  62   FAGNVVMTSDTHESGTDRCAEVISKV-SGFDIAI  94



>ref|WP_037359120.1| hypothetical protein [Schleiferia thermophila]
 gb|KFD39048.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Schleiferia 
thermophila str. Yellowstone]
Length=249

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + +GIIPAR+ASTR PGKPL+D+ GKPMIQ  +ER  +  ++D +VVATDD++IA+    
Sbjct  2    KTLGIIPARYASTRLPGKPLIDLAGKPMIQHVYER--VLHSVDHLVVATDDQRIADRVAA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLE---KKYDIVV  530
            FG   ++TS    NGT RCNE L+ L+   + YD+VV
Sbjct  60   FGGHAVITSPHHPNGTSRCNETLKILQNSGEHYDVVV  96



>ref|XP_010320532.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like, 
partial [Solanum lycopersicum]
Length=112

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  351  RAKLARALDQVVVATDDEKIAECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             AKLA  LD VVVATDDE I ECC+GFG EVIMTS+SCRNGTERCNEALQKL  KYDIVV
Sbjct  1    HAKLAATLDHVVVATDDENIVECCQGFGVEVIMTSKSCRNGTERCNEALQKLGNKYDIVV  60



>ref|WP_045680503.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. BRH_c41]
 gb|KJS45571.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
sp. BRH_c41]
Length=266

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 5/95 (5%)
 Frame = +3

Query  261  IIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAECCR  425
            +IPARFASTR+PGKPLV + G     K +I+R+WE A   + +D+VVVATDD++I     
Sbjct  6    VIPARFASTRYPGKPLVSLTGATGEAKSLIRRSWEAACQVQGVDRVVVATDDDRIRRASE  65

Query  426  GFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             FGAEV+MTSE+C NGTERC EAL  L   +DI+V
Sbjct  66   AFGAEVVMTSEACGNGTERCAEALGVLGDGFDIIV  100



>ref|WP_009813430.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
nubinhibens]
 gb|EAP78029.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseovarius 
nubinhibens ISM]
Length=266

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPAR+ASTR+PGKPL  + G     K ++QR+WE A   + +D+VVVATDD++I E
Sbjct  3    VLLAIPARYASTRYPGKPLATLTGATGEAKSLVQRSWEAACEVKGVDRVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTS  C NGTERC EAL  L   +D+VV
Sbjct  63   AAEGFGAEVVMTSPDCANGTERCAEALDVLGGGFDMVV  100



>ref|WP_026903068.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter glucosidilyticus]
Length=250

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +++G+IPARFASTRFPGKPL+D+ GK MIQR +E+ + A +L  V+VATDD KI +  + 
Sbjct  2    KILGVIPARFASTRFPGKPLIDLAGKSMIQRVYEQTQQASSLADVIVATDDTKIFQAVKQ  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKL  506
            FG  VIMT+++  +GT+RC E  QK+
Sbjct  62   FGGNVIMTADTHVSGTDRCAEVAQKV  87



>ref|WP_010665507.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Marinilabilia 
salmonicolor]
Length=252

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +3

Query  243  RSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECC  422
            +  ++GIIPAR+ASTRFPGKPL DI G  MIQR + +   ++ L QVVVATDD++I +  
Sbjct  3    KDDILGIIPARYASTRFPGKPLADIGGTSMIQRVYHQT--SQVLSQVVVATDDQRIFDAV  60

Query  423  RGFGAEVIMTSESCRNGTERCNEALQKLEKK  515
            + FG +V+MTSE+ ++GT+RC EAL  LE++
Sbjct  61   KAFGGKVVMTSENHQSGTDRCTEALNNLEQE  91



>ref|WP_018622429.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Spirosoma luteum]
Length=254

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IG+IPAR+ STRFPGKPL DI GK MIQR  E+AK A++L +V+VATDDE+IAE  R  
Sbjct  2    IIGVIPARYGSTRFPGKPLADIGGKSMIQRVLEQAKQAKSLVKVIVATDDERIAEAVRRL  61

Query  432  GAEVIMTSESCRNGTERCNEALQKL  506
            G EVIMT     +GT+RC EA  +L
Sbjct  62   GEEVIMTRTDHPSGTDRCQEAYARL  86



>ref|WP_009801887.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicaulis 
sp. HTCC2633]
 gb|EAP90032.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Oceanicaulis 
sp. HTCC2633]
Length=258

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            VI +IPAR+ STRFPGKPL +I G PM++R    A  A ++D+V+VATDD +I     GF
Sbjct  3    VIAVIPARYGSTRFPGKPLHEIAGVPMVERVRRLAAAAPSIDRVIVATDDARILAAVEGF  62

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G E +MT ESCRNGTER  EA++   K  D++V
Sbjct  63   GGEAVMTPESCRNGTERAFEAVKDFAKPDDVIV  95



>ref|WP_027420620.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Crocinitomix 
catalasitica]
Length=249

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +V+GIIP+R+ S+RFPGKPL+D++GK MIQR +E+AK   A D V+VATD  +I      
Sbjct  2    KVLGIIPSRYGSSRFPGKPLIDLMGKSMIQRVYEQAKKCSAFDTVLVATDHPEIEAHVLA  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG EV+MTS    +GTERC E +QK    +DI+V
Sbjct  62   FGGEVMMTSSDHNSGTERCGEVIQKY-NDFDIIV  94



>emb|CBL29028.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Fretibacterium 
fastidiosum]
Length=249

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +++G+IPAR+AS+R PGKPL DI GKPMIQ  +ER   AR L  V VATDDE+IA   R 
Sbjct  5    KILGVIPARYASSRLPGKPLADICGKPMIQHVYERTMAARRLTSVAVATDDERIASAVRA  64

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   +MTS    NGT R  EAL+ L    D VV
Sbjct  65   FGGCAVMTSPDHPNGTSRAEEALRILAPDADAVV  98



>ref|WP_014225875.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella forsythia]
 gb|AEW21852.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Tannerella 
forsythia ATCC 43037]
Length=252

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + +GIIPAR+ASTRFPGKPL D+ G+PMI+R +E  ++   +D++ VATDD +I    + 
Sbjct  2    KFLGIIPARYASTRFPGKPLADMDGRPMIRRVYE--QVIETVDRLYVATDDARIEAAVKA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG EV+MTSE+ R+GT+RC+EA  K+ +++D+V+
Sbjct  60   FGGEVVMTSEAHRSGTDRCHEACTKVGEEFDVVI  93



>ref|WP_027257045.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leisingera aquimarina]
Length=266

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +I+R+W  A L + +D+VVVATDD++I +
Sbjct  3    VLIVIPARYASTRYPGKPLVPLTGATGEARTLIERSWRAACLVQGVDRVVVATDDDRIKQ  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
                FGAEV+MTSE+C NGTERC EA   L   Y+IVV
Sbjct  63   AAEAFGAEVVMTSETCANGTERCAEAHAALGGGYEIVV  100



>gb|KIC72214.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Protochlamydia 
amoebophila]
Length=263

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  222  FLRSGKFRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDD  401
             L+  +   ++IGIIPAR+ STRFPGKPL  ILGK ++QRT+E +  A AL  ++VATDD
Sbjct  4    LLKHAEMTGQIIGIIPARYGSTRFPGKPLASILGKTLLQRTYENSLRASALSDLIVATDD  63

Query  402  EKIAECCRGFGAEVIMTSESCRNGTERCNEAL  497
            E+I E  R F  +V+MTSE C  GT+R  E L
Sbjct  64   ERIFEHVRSFNGKVVMTSEQCPTGTDRLAEVL  95



>ref|WP_036845736.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
cangingivalis]
 gb|KGL49635.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
cangingivalis]
Length=250

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            VIGIIPAR+ STR PGKPL+ I  KP+IQ  +ERA  +  L  VVVATDDE+I E  +GF
Sbjct  3    VIGIIPARYGSTRLPGKPLLKIGDKPIIQHVYERA--SAVLSYVVVATDDERIVEAVKGF  60

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G  VI+TS   R+GT+RC EAL+K   K D+V+
Sbjct  61   GGNVILTSTEHRSGTDRCEEALRKCGVKADVVI  93



>ref|WP_036851249.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
cangingivalis]
 gb|KGN81706.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
cangingivalis]
Length=250

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 2/93 (2%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            VIGIIPAR+ STR PGKPL+ I  KP+IQ  +ERA  +  L  VVVATDDE+I E  +GF
Sbjct  3    VIGIIPARYGSTRLPGKPLLKIGDKPIIQHVYERA--SAVLSYVVVATDDERIVEAVKGF  60

Query  432  GAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            G  VI+TS   R+GT+RC EAL+K   K D+V+
Sbjct  61   GGNVILTSTEHRSGTDRCEEALRKCGVKADVVI  93



>ref|WP_045639512.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Flavobacteriales 
bacterium BRH_c54]
 gb|KJS06570.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Flavobacteriales 
bacterium BRH_c54]
Length=241

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +++GIIP+R+ASTRFPGKPLV+I GK MIQR +E+AK A  L  V++ATDDE+I    + 
Sbjct  2    KILGIIPSRYASTRFPGKPLVEIKGKSMIQRVYEQAKKATCLSDVIIATDDERIYNHAQA  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               +V+ T    ++GT+RC E L KL+  YD+V+
Sbjct  62   LNFKVVYTDTVHQSGTDRCAEVLNKLDADYDVVI  95



>ref|WP_010442943.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Ruegeria conchae]
Length=266

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+  IPAR+ASTR+PGKPLV + G       +I+R+W  A     +D+VVVATDD++I E
Sbjct  3    VLIAIPARYASTRYPGKPLVPLTGVNGTAMTLIERSWRAAISVAGVDRVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEVIMTS++CRNGTERC EA   L   Y+IVV
Sbjct  63   VSEGFGAEVIMTSDTCRNGTERCAEAHTALGSGYEIVV  100



>ref|WP_037439749.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella sp. 
YQH10]
 gb|KFZ38507.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella sp. 
YQH10]
Length=245

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +VI IIPAR+ S+RFPGKPL  I GKPMIQR +ERA LA+ +D+V VATDDE+IA    G
Sbjct  2    KVILIIPARYGSSRFPGKPLAMIKGKPMIQRVYERALLAKGIDEVYVATDDERIASAVHG  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKL  506
            F  +V+MT+    +GT+R N+A+  L
Sbjct  62   FNGKVVMTTAELASGTDRINQAITHL  87



>ref|WP_006271654.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Asticcacaulis 
biprosthecium]
 gb|EGF92479.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Asticcacaulis 
biprosthecum C19]
Length=260

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLV-----DILGKPMIQRTWERAKLARALDQVVVATDDEKIA  413
            + + IIPAR+AS+R+PGKPLV     D + K +IQR+WE AK  + +D V VATDD++I 
Sbjct  2    KTVVIIPARYASSRYPGKPLVMLKGKDGVAKSLIQRSWEAAKAVKGVDAVYVATDDDRIR  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +    FGAEVIMTSE C NGTER  +AL  L   YD+ V
Sbjct  62   DAAEAFGAEVIMTSELCANGTERVADALPGLPHAYDLYV  100



>ref|WP_016412439.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella sp. 
CAG:1031]
 emb|CCX45002.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Prevotella sp. 
CAG:1031]
Length=248

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+AS+RFPGKPL  I GKPMI R  ERA+   ALD+VVVATDDE+IA CC  
Sbjct  2    KFIGIIPARYASSRFPGKPLAIIDGKPMIVRVAERAE--SALDEVVVATDDERIAACCAD  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
             G   IMTS   R+GT+RC EAL       D+V+
Sbjct  60   HGHRAIMTSADHRSGTDRCREALDLSGSAADVVI  93



>ref|WP_023447991.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Asticcacaulis 
sp. AC402]
 gb|ESQ77202.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Asticcacaulis 
sp. AC402]
Length=260

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLV-----DILGKPMIQRTWERAKLARALDQVVVATDDEKIA  413
            + + IIPAR+AS+R+PGKPLV     D + K +IQR+WE AK  + +D V VATDD++I 
Sbjct  2    KTVVIIPARYASSRYPGKPLVMLKGKDGVAKSLIQRSWEAAKAVKGVDAVFVATDDDRIR  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            +    FGAEVIMTSE C NGTER  +AL  L   YD+ V
Sbjct  62   DAAEAFGAEVIMTSELCANGTERVADALPGLPHAYDLYV  100



>ref|WP_038011846.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella sp. 
oral taxon BU063]
 gb|ETK01207.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella sp. 
oral taxon BU063 isolate Cell 2]
Length=248

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + +GIIPAR+ASTRFPGKPL D+ GKPMIQR +ER +    +D++ VATDDE+I +    
Sbjct  2    KFLGIIPARYASTRFPGKPLADLGGKPMIQRVYERVR--PTVDELWVATDDERIRQAVEA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS++ R+GT+RC EA  K+    D+V+
Sbjct  60   FGGDVVMTSDTHRSGTDRCREACDKVGATADVVI  93



>ref|WP_037906212.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sulfitobacter 
mediterraneus]
 gb|KAJ03847.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Sulfitobacter 
mediterraneus]
Length=266

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +I+R+W  A   R +D+VVVATDD++I +
Sbjct  3    VLIVIPARYASTRYPGKPLVALKGAGGASRNLIERSWLAAGEVRGVDRVVVATDDDRIKD  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTS  C NGTERC EA   L   YDIVV
Sbjct  63   AAEGFGAEVVMTSSDCVNGTERCAEAHTALGGGYDIVV  100



>ref|WP_008240969.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter sp. 
BAL39]
 gb|EDM36864.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pedobacter sp. 
BAL39]
Length=243

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +V+G+IPAR+AS+RFPGKPL+DI GK MIQR +E+A  A A+DQVVVATDD++IA   + 
Sbjct  2    KVLGVIPARYASSRFPGKPLIDIDGKVMIQRVYEQAMKATAIDQVVVATDDDRIAAAVQQ  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   I+T    ++GT+RC E   KL   +D+++
Sbjct  62   FGGSCILTGMQHQSGTDRCAEVASKL-PGFDVII  94



>ref|WP_011919382.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Shewanella putrefaciens]
 sp|A4Y7B5.1|KDSB_SHEPC RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Shewanella putrefaciens 
CN-32]
 gb|ABP75848.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Shewanella 
putrefaciens CN-32]
Length=245

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
             VI +IPAR+ S+RFPGKPL  I GKPMIQ  +ERA LA+ L  + VATDDE+I     G
Sbjct  2    NVILLIPARYGSSRFPGKPLAPINGKPMIQHVYERASLAKGLTNIYVATDDERIKATVEG  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS    +GT+R NEA++ L  K D +V
Sbjct  62   FGGKVVMTSPDAASGTDRINEAIKLLGLKDDDLV  95



>ref|WP_028522996.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Runella limosa]
Length=254

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IGIIP+R+ASTRFPGKPL DILGK MIQR +E+A  A+ L +V+VAT+D++I +    F
Sbjct  2    IIGIIPSRYASTRFPGKPLADILGKTMIQRVYEQASQAKCLSKVIVATEDKRIVDHVESF  61

Query  432  GAEVIMTSESCRNGTERCNEALQKLEK  512
            G + IMTS +  +GTERC EA + ++K
Sbjct  62   GGQAIMTSTNHFSGTERCFEAYELIKK  88



>ref|WP_011789211.1| MULTISPECIES: 3-deoxy-manno-octulosonate cytidylyltransferase 
[Shewanella]
 sp|A1RJ74.1|KDSB_SHESW RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Shewanella sp. W3-18-1]
 gb|ABM24719.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Shewanella 
sp. W3-18-1]
 gb|ADV54339.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Shewanella 
putrefaciens 200]
Length=245

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
             VI +IPAR+ S+RFPGKPL  I GKPMIQ  +ERA LA+ L  + VATDDE+I     G
Sbjct  2    NVILLIPARYGSSRFPGKPLAPINGKPMIQHVYERASLAKGLTNIYVATDDERIKATVEG  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS    +GT+R NEA++ L  K D +V
Sbjct  62   FGGKVVMTSPDAASGTDRINEAIKLLGLKDDDLV  95



>ref|WP_021931200.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella sp. 
CAG:118]
 emb|CCY37776.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella sp. 
CAG:118]
Length=246

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +  GIIPAR+ASTRFPGKPLVD+ GK MIQR +E+  +   LD V VATDD +I E    
Sbjct  2    KFTGIIPARYASTRFPGKPLVDMKGKTMIQRVYEQVSIV--LDSVYVATDDSRIYETVEA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   IMTSE  R+GT+RC EA  K  +K D+++
Sbjct  60   FGGRAIMTSEKHRSGTDRCEEAYYKTGEKSDVII  93



>ref|WP_022707949.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Paracoccus zeaxanthinifaciens]
Length=266

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ IIPARFASTR+PGKPLV++ G     + +I+R+W+ A     +D+VVVATDD++I E
Sbjct  3    VVIIIPARFASTRYPGKPLVELRGADGQPRSLIRRSWDAAMQVAGVDRVVVATDDDRIRE  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTS  CRNGTERC EA+  +  + +IVV
Sbjct  63   HAEGFGAEVVMTSPECRNGTERCAEAVANMGIRPEIVV  100



>ref|WP_039184863.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leisingera sp. 
ANG-M7]
 gb|KIC35996.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Leisingera sp. 
ANG-M7]
Length=266

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV + G     + +++R+W  A   + +D+VVVATDD++I +
Sbjct  3    VLIVIPARYASTRYPGKPLVPLTGASGEKRSLVERSWRAACSVQGVDRVVVATDDDRIKQ  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSE+C NGTERC EA   L   Y+IVV
Sbjct  63   AAEGFGAEVVMTSETCANGTERCAEAHAALGGGYEIVV  100



>ref|WP_044227886.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Coprobacter 
sp. 177]
 gb|KHM47746.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Coprobacter 
sp. 177]
Length=246

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +  GIIPAR+ASTRFPGKPLVD+ GK MIQR +E+  +   LD V VATDD +I E    
Sbjct  2    KFTGIIPARYASTRFPGKPLVDMKGKTMIQRVYEQVSIV--LDSVYVATDDSRIYETVEA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   IMTSE  R+GT+RC EA  K  +K D+++
Sbjct  60   FGGRAIMTSEKHRSGTDRCEEAYYKTGEKSDVII  93



>ref|WP_005036959.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Holophaga 
foetida]
Length=260

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            R + ++P+R+ +TRFPGKPL  I G+PMIQR W+ AK A  +D+VVVATDDE+I      
Sbjct  2    RTLAVLPSRYKATRFPGKPLAPIAGQPMIQRVWQAAKAAEGVDRVVVATDDERIQAAVLA  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG EV+MT  +  +GT+R   AL+ L + +D++V
Sbjct  62   FGGEVVMTDPALPSGTDRVAAALEALGESFDVIV  95



>ref|WP_025763583.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Dyadobacter 
tibetensis]
Length=246

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            +++GIIPAR+ASTRFP K LVDI GK MIQR +E+A  A  L +V+VATDD++I +    
Sbjct  2    QILGIIPARYASTRFPAKALVDIGGKSMIQRVYEQAIQASKLTKVIVATDDQRILDHVNA  61

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG   +MTS   ++GT+RC EA + L   YD V+
Sbjct  62   FGGHAVMTSTEHQSGTDRCYEAFKSLGTHYDYVI  95



>ref|WP_009810335.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. MED193]
 gb|EAQ46343.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Roseobacter 
sp. MED193]
Length=266

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILG-----KPMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV++ G     + +I+R+W  A   + +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVELTGAKGDKRTLIERSWRAACAVQGVDRVVVATDDDRIRL  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTSESC NGTERC EA   L   Y++VV
Sbjct  63   AAEGFGAEVVMTSESCANGTERCAEAHAALGGTYEVVV  100



>ref|WP_039000332.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Halocynthiibacter 
sp. PAMC 20958]
Length=263

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLV-----DILGKPMIQRTWERAKLARALDQVVVATDDEKIA  413
            + + +IPAR+ASTR+PGKPLV     D   K +IQ ++E AK  R  D+V V TDDE+IA
Sbjct  2    KTVILIPARYASTRYPGKPLVKLTLPDGTQKSLIQMSYEAAKSVRGADEVFVTTDDERIA  61

Query  414  ECCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            E  R FGA+VIMTSE+C NGTERC EA++    + DI+V
Sbjct  62   EAARAFGADVIMTSENCANGTERCAEAMKNAGLEADIIV  100



>ref|WP_012458505.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gingivalis]
 sp|B2RLM4.1|KDSB_PORG3 RecName: Full=3-deoxy-manno-octulosonate cytidylyltransferase; 
AltName: Full=CMP-2-keto-3-deoxyoctulosonic acid synthase; 
Short=CKS; Short=CMP-KDO synthase [Porphyromonas gingivalis 
ATCC 33277]
 dbj|BAG34269.1| putative 3-deoxy-D-manno-octulosonate cytidylyltransferase [Porphyromonas 
gingivalis ATCC 33277]
 gb|AIJ34555.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Porphyromonas 
gingivalis]
Length=254

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +3

Query  240  FRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAEC  419
              + VI IIPARFAS+RFPGKPL D+LGK MIQR  ER  +A  + + VVATDDE+I + 
Sbjct  1    MNTEVIAIIPARFASSRFPGKPLADMLGKSMIQRVHER--IAGVVPRAVVATDDERIRQA  58

Query  420  CRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               FG EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  59   VEDFGGEVVMTSPECSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_027242172.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Pseudophaeobacter 
arcticus]
Length=266

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%), Gaps = 5/98 (5%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGK-----PMIQRTWERAKLARALDQVVVATDDEKIAE  416
            V+ +IPAR+ASTR+PGKPLV++ G       +I+R+W  A   + +D+VVVATDD++I  
Sbjct  3    VLIVIPARYASTRYPGKPLVELTGANGDRLTLIERSWRAACAVQGVDRVVVATDDDRIQT  62

Query  417  CCRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               GFGAEV+MTS+SC NGTERC EA   L   Y++VV
Sbjct  63   AAHGFGAEVVMTSQSCANGTERCAEAHAALGGGYEVVV  100



>ref|WP_020600800.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Spirosoma panaciterrae]
Length=249

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  252  VIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRGF  431
            +IGIIPAR+ASTRFPGKPL DI GK MIQR  E+AK A +L +VVVATDDE+IAE  R  
Sbjct  2    IIGIIPARYASTRFPGKPLADIGGKSMIQRVLEQAKKATSLSKVVVATDDERIAEAVRRL  61

Query  432  GAEVIMTSESCRNGTERCNEALQKL  506
            G E +MT     +GT+RC EA  +L
Sbjct  62   GEEAVMTRTDHPSGTDRCWEAYDRL  86



>ref|WP_021677637.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Porphyromonas 
gingivalis]
 gb|ERJ82162.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Porphyromonas 
gingivalis F0185]
 gb|ERJ85941.1| 3-deoxy-D-manno-octulosonate cytidylyltransferase [Porphyromonas 
gingivalis F0566]
Length=254

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +3

Query  240  FRSRVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAEC  419
              + VI IIPARFAS+RFPGKPL D+LGK MIQR  ER  +A  + + VVATDDE+I + 
Sbjct  1    MNTEVIAIIPARFASSRFPGKPLADMLGKSMIQRVHER--IAGVVPRAVVATDDERIRQA  58

Query  420  CRGFGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
               FG EV+MTS  C +GTERC EA  K+ +   IV+
Sbjct  59   VEDFGGEVVMTSPECSSGTERCREAFDKVGRGEKIVL  95



>ref|WP_037987160.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella sp. 
oral taxon BU063]
 gb|ETK03134.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Tannerella sp. 
oral taxon BU063 isolate Cell 5]
Length=248

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + +GIIPAR+ASTRFPGKPL D+ GKPMIQR +ER +    +D + VATDDE+I +    
Sbjct  2    KFLGIIPARYASTRFPGKPLADLGGKPMIQRVYERVR--PTVDSLWVATDDERIRQAVEA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG +V+MTS++ R+GT+RC EA  K+    D+V+
Sbjct  60   FGGDVVMTSDTHRSGTDRCREACDKVGATADVVI  93



>ref|WP_019187057.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Candidatus Prevotella 
conceptionensis]
Length=250

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +3

Query  249  RVIGIIPARFASTRFPGKPLVDILGKPMIQRTWERAKLARALDQVVVATDDEKIAECCRG  428
            + IGIIPAR+ S+RFPGKPL  + GKP+IQR +E  ++A+ALD+  VATDDE+I      
Sbjct  2    KFIGIIPARYGSSRFPGKPLAQLGGKPVIQRVYE--QVAQALDETYVATDDERIYNKVLA  59

Query  429  FGAEVIMTSESCRNGTERCNEALQKLEKKYDIVV  530
            FG + +MTS   ++GT+R NEA+QK+   YD+VV
Sbjct  60   FGGKAVMTSTEHQSGTDRVNEAVQKIGGNYDVVV  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 580605835400