BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5578

Length=945
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08361.1|  unnamed protein product                                216   3e-63   Coffea canephora [robusta coffee]
ref|XP_011081281.1|  PREDICTED: RNA-binding protein FUS isoform X1      205   3e-59   Sesamum indicum [beniseed]
gb|AAF14242.1|AF110226_1  nuclear RNA binding protein                   201   1e-58   Nicotiana tabacum [American tobacco]
ref|XP_009613635.1|  PREDICTED: plasminogen activator inhibitor 1...    201   1e-57   Nicotiana tomentosiformis
ref|XP_009607512.1|  PREDICTED: intracellular hyaluronan-binding ...    198   1e-56   Nicotiana tomentosiformis
ref|XP_009789577.1|  PREDICTED: plasminogen activator inhibitor 1...    197   5e-56   Nicotiana sylvestris
ref|XP_011081284.1|  PREDICTED: plasminogen activator inhibitor 1...    194   4e-55   Sesamum indicum [beniseed]
ref|XP_010661405.1|  PREDICTED: plasminogen activator inhibitor 1...    193   1e-54   Vitis vinifera
ref|XP_010677113.1|  PREDICTED: plasminogen activator inhibitor 1...    192   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009772173.1|  PREDICTED: plasminogen activator inhibitor 1...    192   2e-54   Nicotiana sylvestris
ref|XP_006362472.1|  PREDICTED: plasminogen activator inhibitor 1...    190   2e-53   Solanum tuberosum [potatoes]
ref|XP_012070071.1|  PREDICTED: U3 small nucleolar RNA-associated...    189   5e-53   Jatropha curcas
ref|XP_002303373.2|  nuclear RNA-binding family protein                 189   6e-53   
ref|NP_001275449.1|  plasminogen activator inhibitor 1 RNA-bindin...    187   2e-52   Solanum tuberosum [potatoes]
ref|XP_004253373.2|  PREDICTED: plasminogen activator inhibitor 1...    186   3e-52   Solanum lycopersicum
ref|XP_002266051.1|  PREDICTED: uncharacterized protein DDB_G0288133    187   3e-52   Vitis vinifera
emb|CAN75176.1|  hypothetical protein VITISV_016687                     187   3e-52   Vitis vinifera
ref|XP_011031954.1|  PREDICTED: plasminogen activator inhibitor 1...    186   4e-52   Populus euphratica
ref|XP_009594553.1|  PREDICTED: plasminogen activator inhibitor 1...    184   5e-51   Nicotiana tomentosiformis
ref|XP_006362474.1|  PREDICTED: plasminogen activator inhibitor 1...    183   1e-50   Solanum tuberosum [potatoes]
ref|XP_009766508.1|  PREDICTED: plasminogen activator inhibitor 1...    183   1e-50   Nicotiana sylvestris
ref|XP_006362473.1|  PREDICTED: plasminogen activator inhibitor 1...    182   1e-50   
ref|XP_010275458.1|  PREDICTED: plasminogen activator inhibitor 1...    182   2e-50   Nelumbo nucifera [Indian lotus]
gb|EYU19470.1|  hypothetical protein MIMGU_mgv1a008507mg                182   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_010258760.1|  PREDICTED: plasminogen activator inhibitor 1...    181   8e-50   Nelumbo nucifera [Indian lotus]
gb|KJB37651.1|  hypothetical protein B456_006G214200                    177   2e-49   Gossypium raimondii
gb|KJB37646.1|  hypothetical protein B456_006G214200                    178   6e-49   Gossypium raimondii
gb|KDO57096.1|  hypothetical protein CISIN_1g017915mg                   178   7e-49   Citrus sinensis [apfelsine]
ref|XP_006477112.1|  PREDICTED: plasminogen activator inhibitor 1...    178   7e-49   Citrus sinensis [apfelsine]
ref|XP_006440205.1|  hypothetical protein CICLE_v10020747mg             178   8e-49   Citrus clementina [clementine]
ref|XP_007209289.1|  hypothetical protein PRUPE_ppa007665mg             177   1e-48   Prunus persica
gb|KJB24881.1|  hypothetical protein B456_004G166200                    177   1e-48   Gossypium raimondii
gb|KJB24880.1|  hypothetical protein B456_004G166200                    177   1e-48   Gossypium raimondii
gb|AEI59279.1|  RNA binding protein                                     177   2e-48   Suaeda glauca
ref|XP_002531778.1|  Plasminogen activator inhibitor 1 RNA-bindin...    177   2e-48   Ricinus communis
ref|XP_007052327.1|  Hyaluronan / mRNA binding family isoform 1         176   3e-48   
gb|KHG17525.1|  Plasminogen activator inhibitor 1 RNA-binding           176   4e-48   Gossypium arboreum [tree cotton]
gb|KJB24891.1|  hypothetical protein B456_004G166300                    175   7e-48   Gossypium raimondii
gb|KHG05539.1|  Plasminogen activator inhibitor 1 RNA-binding           175   8e-48   Gossypium arboreum [tree cotton]
gb|KJB37647.1|  hypothetical protein B456_006G214200                    174   2e-47   Gossypium raimondii
gb|KDO57095.1|  hypothetical protein CISIN_1g017915mg                   172   8e-47   Citrus sinensis [apfelsine]
gb|KJB37648.1|  hypothetical protein B456_006G214200                    172   9e-47   Gossypium raimondii
ref|XP_004244706.2|  PREDICTED: plasminogen activator inhibitor 1...    172   1e-46   Solanum lycopersicum
gb|KDO57093.1|  hypothetical protein CISIN_1g017915mg                   170   3e-46   Citrus sinensis [apfelsine]
ref|XP_007039722.1|  Hyaluronan / mRNA binding family                   169   1e-45   
ref|XP_008369209.1|  PREDICTED: plasminogen activator inhibitor 1...    169   2e-45   Malus domestica [apple tree]
gb|AAF14244.1|AF110228_1  nuclear RNA binding protein A                 168   4e-45   Spinacia oleracea
ref|XP_008373667.1|  PREDICTED: plasminogen activator inhibitor 1...    167   6e-45   Malus domestica [apple tree]
ref|XP_003521066.1|  PREDICTED: plasminogen activator inhibitor 1...    167   6e-45   Glycine max [soybeans]
gb|ABK94426.1|  unknown                                                 167   7e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006368965.1|  nuclear RNA-binding family protein                 167   8e-45   Populus trichocarpa [western balsam poplar]
ref|XP_003552493.1|  PREDICTED: plasminogen activator inhibitor 1...    166   4e-44   Glycine max [soybeans]
emb|CDP21265.1|  unnamed protein product                                165   6e-44   Coffea canephora [robusta coffee]
ref|XP_007218155.1|  hypothetical protein PRUPE_ppa007410mg             165   7e-44   Prunus persica
ref|XP_009343931.1|  PREDICTED: plasminogen activator inhibitor 1...    165   8e-44   Pyrus x bretschneideri [bai li]
gb|KHN40549.1|  hypothetical protein glysoja_001047                     164   1e-43   Glycine soja [wild soybean]
ref|XP_009368154.1|  PREDICTED: plasminogen activator inhibitor 1...    164   2e-43   
ref|XP_008232490.1|  PREDICTED: plasminogen activator inhibitor 1...    164   2e-43   Prunus mume [ume]
ref|XP_011093236.1|  PREDICTED: plasminogen activator inhibitor 1...    163   3e-43   Sesamum indicum [beniseed]
gb|KHG27284.1|  hypothetical protein F383_11722                         162   4e-43   Gossypium arboreum [tree cotton]
ref|XP_008238397.1|  PREDICTED: plasminogen activator inhibitor 1...    162   5e-43   Prunus mume [ume]
gb|KJB25493.1|  hypothetical protein B456_004G194400                    162   7e-43   Gossypium raimondii
ref|XP_006837401.1|  PREDICTED: plasminogen activator inhibitor 1...    161   1e-42   Amborella trichopoda
ref|XP_004300342.1|  PREDICTED: intracellular hyaluronan-binding ...    161   2e-42   Fragaria vesca subsp. vesca
ref|XP_008347095.1|  PREDICTED: plasminogen activator inhibitor 1...    157   2e-42   
ref|XP_009368155.1|  PREDICTED: plasminogen activator inhibitor 1...    160   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_011047584.1|  PREDICTED: plasminogen activator inhibitor 1...    159   7e-42   Populus euphratica
gb|KJB25494.1|  hypothetical protein B456_004G194400                    158   2e-41   Gossypium raimondii
dbj|BAE71280.1|  putative nuclear antigen homolog                       158   2e-41   Trifolium pratense [peavine clover]
ref|XP_007134461.1|  hypothetical protein PHAVU_010G049300g             158   3e-41   Phaseolus vulgaris [French bean]
dbj|BAE71204.1|  putative nuclear antigen homolog                       158   3e-41   Trifolium pratense [peavine clover]
ref|NP_001241515.1|  uncharacterized protein LOC100807657               158   3e-41   Glycine max [soybeans]
ref|XP_009613636.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    156   7e-41   Nicotiana tomentosiformis
ref|XP_008238398.1|  PREDICTED: plasminogen activator inhibitor 1...    156   1e-40   Prunus mume [ume]
ref|XP_011017364.1|  PREDICTED: plasminogen activator inhibitor 1...    156   1e-40   Populus euphratica
ref|XP_008459799.1|  PREDICTED: plasminogen activator inhibitor 1...    156   1e-40   Cucumis melo [Oriental melon]
ref|XP_011626785.1|  PREDICTED: intracellular hyaluronan-binding ...    156   1e-40   Amborella trichopoda
gb|KCW77830.1|  hypothetical protein EUGRSUZ_D02118                     156   1e-40   Eucalyptus grandis [rose gum]
ref|XP_011032359.1|  PREDICTED: plasminogen activator inhibitor 1...    156   2e-40   Populus euphratica
ref|XP_003529036.1|  PREDICTED: plasminogen activator inhibitor 1...    156   2e-40   Glycine max [soybeans]
ref|XP_011465242.1|  PREDICTED: plasminogen activator inhibitor 1...    155   3e-40   Fragaria vesca subsp. vesca
gb|ERN15257.1|  hypothetical protein AMTR_s00056p00215280               155   5e-40   Amborella trichopoda
gb|KCW77831.1|  hypothetical protein EUGRSUZ_D02118                     154   8e-40   Eucalyptus grandis [rose gum]
ref|XP_011081282.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    153   8e-40   Sesamum indicum [beniseed]
gb|KFK31390.1|  hypothetical protein AALP_AA6G105700                    153   1e-39   Arabis alpina [alpine rockcress]
ref|XP_009776248.1|  PREDICTED: plasminogen activator inhibitor 1...    154   1e-39   Nicotiana sylvestris
ref|XP_008375773.1|  PREDICTED: LOW QUALITY PROTEIN: plasminogen ...    154   1e-39   
gb|KJB24892.1|  hypothetical protein B456_004G166300                    152   1e-39   Gossypium raimondii
ref|XP_006375155.1|  hypothetical protein POPTR_0014s04820g             154   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002301233.2|  transcription factor family protein                153   1e-39   
gb|ABK94354.1|  unknown                                                 153   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010053521.1|  PREDICTED: vasodilator-stimulated phosphopro...    153   2e-39   Eucalyptus grandis [rose gum]
ref|XP_008465866.1|  PREDICTED: plasminogen activator inhibitor 1...    153   2e-39   Cucumis melo [Oriental melon]
ref|XP_011032341.1|  PREDICTED: plasminogen activator inhibitor 1...    152   3e-39   Populus euphratica
ref|XP_009789579.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    152   3e-39   Nicotiana sylvestris
gb|KJB37649.1|  hypothetical protein B456_006G214200                    151   3e-39   Gossypium raimondii
ref|XP_010053519.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    152   5e-39   Eucalyptus grandis [rose gum]
ref|XP_004148350.1|  PREDICTED: plasminogen activator inhibitor 1...    151   6e-39   Cucumis sativus [cucumbers]
ref|XP_007139646.1|  hypothetical protein PHAVU_008G047300g             151   1e-38   Phaseolus vulgaris [French bean]
gb|ABD64914.1|  nuclear RNA binding protein, putative                   150   1e-38   Brassica oleracea
ref|XP_009373211.1|  PREDICTED: plasminogen activator inhibitor 1...    150   3e-38   Pyrus x bretschneideri [bai li]
ref|XP_009607515.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    149   3e-38   Nicotiana tomentosiformis
gb|KHG30709.1|  hypothetical protein F383_14338                         149   4e-38   Gossypium arboreum [tree cotton]
emb|CDY43435.1|  BnaAnng07070D                                          149   4e-38   Brassica napus [oilseed rape]
gb|KJB22277.1|  hypothetical protein B456_004G038700                    149   5e-38   Gossypium raimondii
gb|KJB37650.1|  hypothetical protein B456_006G214200                    147   5e-38   Gossypium raimondii
emb|CDY67886.1|  BnaCnng56800D                                          149   6e-38   Brassica napus [oilseed rape]
ref|XP_008344404.1|  PREDICTED: plasminogen activator inhibitor 1...    149   6e-38   
ref|XP_004140509.1|  PREDICTED: plasminogen activator inhibitor 1...    149   7e-38   Cucumis sativus [cucumbers]
ref|XP_009114287.1|  PREDICTED: uncharacterized protein LOC103839539    148   7e-38   Brassica rapa
ref|XP_004515346.1|  PREDICTED: plasminogen activator inhibitor 1...    149   8e-38   Cicer arietinum [garbanzo]
ref|XP_004306983.1|  PREDICTED: circumsporozoite protein-like           149   9e-38   Fragaria vesca subsp. vesca
ref|XP_006280739.1|  hypothetical protein CARUB_v10026708mg             147   1e-37   Capsella rubella
ref|XP_010924482.1|  PREDICTED: probable H/ACA ribonucleoprotein ...    148   1e-37   Elaeis guineensis
ref|XP_006398418.1|  hypothetical protein EUTSA_v10000938mg             148   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010481348.1|  PREDICTED: plasminogen activator inhibitor 1...    147   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010481347.1|  PREDICTED: plasminogen activator inhibitor 1...    147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010494951.1|  PREDICTED: plasminogen activator inhibitor 1...    147   2e-37   Camelina sativa [gold-of-pleasure]
gb|AFK43517.1|  unknown                                                 147   2e-37   Lotus japonicus
ref|XP_002870130.1|  hypothetical protein ARALYDRAFT_493188             147   3e-37   
ref|XP_010104826.1|  hypothetical protein L484_024026                   149   3e-37   
ref|XP_010918620.1|  PREDICTED: plasminogen activator inhibitor 1...    147   5e-37   Elaeis guineensis
ref|XP_010441486.1|  PREDICTED: plasminogen activator inhibitor 1...    146   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010531668.1|  PREDICTED: plasminogen activator inhibitor 1...    146   6e-37   Tarenaya hassleriana [spider flower]
ref|XP_007052330.1|  Hyaluronan / mRNA binding family isoform 4         144   7e-37   
ref|XP_004150996.1|  PREDICTED: cyclin-dependent kinase 13-like         145   1e-36   Cucumis sativus [cucumbers]
ref|XP_010434652.1|  PREDICTED: plasminogen activator inhibitor 1...    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008810382.1|  PREDICTED: plasminogen activator inhibitor 1...    145   2e-36   Phoenix dactylifera
ref|XP_010449710.1|  PREDICTED: plasminogen activator inhibitor 1...    142   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006644341.1|  PREDICTED: plasminogen activator inhibitor 1...    144   3e-36   Oryza brachyantha
ref|XP_010531670.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    144   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_007142624.1|  hypothetical protein PHAVU_007G003500g             144   4e-36   Phaseolus vulgaris [French bean]
ref|XP_010449600.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    144   5e-36   Camelina sativa [gold-of-pleasure]
gb|AES80534.2|  nuclear RNA-binding-like protein                        146   6e-36   Medicago truncatula
ref|XP_003624316.1|  Transcription factor                               146   7e-36   
ref|NP_001078399.1|  hyaluronan / mRNA binding domain-containing ...    141   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449709.1|  PREDICTED: plasminogen activator inhibitor 1...    143   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009772180.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    142   9e-36   Nicotiana sylvestris
ref|XP_002870099.1|  hypothetical protein ARALYDRAFT_493124             143   1e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010439990.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    143   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004961407.1|  PREDICTED: RNA-binding protein FUS-like            143   1e-35   Setaria italica
ref|XP_008798813.1|  PREDICTED: plasminogen activator inhibitor 1...    143   1e-35   Phoenix dactylifera
ref|XP_009605755.1|  PREDICTED: plasminogen activator inhibitor 1...    142   1e-35   Nicotiana tomentosiformis
emb|CAA66481.1|  transcription factor                                   142   1e-35   Vicia faba var. minor [tick bean]
ref|XP_006414296.1|  hypothetical protein EUTSA_v10025552mg             142   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009395730.1|  PREDICTED: keratin, type II cytoskeletal 2 e...    142   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_193416.1|  hyaluronan / mRNA binding domain-containing pro...    142   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40563.1|  BnaC02g33290D                                          141   3e-35   Brassica napus [oilseed rape]
gb|EAY75654.1|  hypothetical protein OsI_03559                          140   4e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010925494.1|  PREDICTED: protein argonaute 2-like                141   5e-35   Elaeis guineensis
gb|ABD65038.1|  nuclear RNA binding protein, putative                   140   5e-35   Brassica oleracea
ref|XP_009128949.1|  PREDICTED: suppressor protein STM1-like            140   5e-35   Brassica rapa
ref|XP_002511578.1|  RNA binding protein, putative                      139   6e-35   Ricinus communis
ref|XP_010531669.1|  PREDICTED: plasminogen activator inhibitor 1...    140   6e-35   Tarenaya hassleriana [spider flower]
ref|NP_001078400.1|  hyaluronan / mRNA binding domain-containing ...    140   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KEH17858.1|  nuclear RNA-binding-like protein                        140   1e-34   Medicago truncatula
ref|XP_003556572.1|  PREDICTED: plasminogen activator inhibitor 1...    139   1e-34   Glycine max [soybeans]
ref|XP_002458112.1|  hypothetical protein SORBIDRAFT_03g027110          140   1e-34   Sorghum bicolor [broomcorn]
gb|EPS72575.1|  hypothetical protein M569_02184                         139   2e-34   Genlisea aurea
ref|XP_002863351.1|  hypothetical protein ARALYDRAFT_494257             139   2e-34   
gb|AAF14245.1|AF110229_1  nuclear RNA binding protein B                 137   2e-34   Spinacia oleracea
gb|EAZ13376.1|  hypothetical protein OsJ_03294                          139   2e-34   Oryza sativa Japonica Group [Japonica rice]
emb|CAC85227.1|  salt tolerance protein 1                               139   2e-34   Beta vulgaris [beet]
ref|XP_010692032.1|  PREDICTED: uncharacterized protein DDB_G0288...    139   2e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR25759.1|  nuclear antigen                                         136   2e-34   Oryza sativa Indica Group [Indian rice]
gb|AAM64962.1|  nuclear RNA binding protein A-like protein              139   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001044098.1|  Os01g0721900                                       139   4e-34   
gb|AAM61393.1|  nuclear antigen homolog                                 138   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434762.1|  PREDICTED: plasminogen activator inhibitor 1...    138   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009145376.1|  PREDICTED: plasminogen activator inhibitor 1...    137   5e-34   Brassica rapa
ref|XP_002440366.1|  hypothetical protein SORBIDRAFT_09g030400          138   6e-34   Sorghum bicolor [broomcorn]
gb|ABI18976.1|  nuclear-localized RNA binding protein                   138   7e-34   Capsicum annuum
ref|XP_008798814.1|  PREDICTED: plasminogen activator inhibitor 1...    138   8e-34   Phoenix dactylifera
ref|XP_009101440.1|  PREDICTED: suppressor protein STM1                 137   8e-34   Brassica rapa
ref|XP_009145362.1|  PREDICTED: plasminogen activator inhibitor 1...    137   9e-34   Brassica rapa
ref|NP_001043502.1|  Os01g0603000                                       137   1e-33   
ref|XP_004969088.1|  PREDICTED: plasminogen activator inhibitor 1...    137   1e-33   Setaria italica
ref|XP_010919739.1|  PREDICTED: plasminogen activator inhibitor 1...    137   1e-33   Elaeis guineensis
ref|XP_009396539.1|  PREDICTED: plasminogen activator inhibitor 1...    137   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD65067.1|  nuclear RNA binding protein, putative                   136   3e-33   Brassica oleracea
ref|XP_006285507.1|  hypothetical protein CARUB_v10006948mg             136   3e-33   Capsella rubella
ref|XP_006284012.1|  hypothetical protein CARUB_v10005134mg             135   4e-33   Capsella rubella
gb|ACG24258.1|  plasminogen activator inhibitor 1 RNA-binding pro...    135   4e-33   Zea mays [maize]
ref|NP_193485.1|  hyaluronan / mRNA binding family                      135   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108277.1|  PREDICTED: plasminogen activator inhibitor 1...    133   6e-33   Brassica rapa
ref|XP_004961035.1|  PREDICTED: insulin receptor substrate 4-like       135   6e-33   Setaria italica
ref|XP_009410905.1|  PREDICTED: plasminogen activator inhibitor 1...    135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG04303.1|  hypothetical protein F383_01005                         134   1e-32   Gossypium arboreum [tree cotton]
ref|NP_001148572.1|  plasminogen activator inhibitor 1 RNA-bindin...    134   2e-32   Zea mays [maize]
gb|EAY74854.1|  hypothetical protein OsI_02745                          134   2e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001056483.1|  Os05g0589600                                       134   2e-32   
gb|EYU19467.1|  hypothetical protein MIMGU_mgv1a008831mg                134   2e-32   Erythranthe guttata [common monkey flower]
gb|AFW81314.1|  plasminogen activator inhibitor 1 RNA-binding pro...    134   3e-32   
ref|XP_009108330.1|  PREDICTED: plasminogen activator inhibitor 1...    133   4e-32   Brassica rapa
emb|CDX76567.1|  BnaA08g08330D                                          133   4e-32   
ref|XP_006654864.1|  PREDICTED: plasminogen activator inhibitor 1...    133   5e-32   Oryza brachyantha
gb|KJB37652.1|  hypothetical protein B456_006G214200                    132   5e-32   Gossypium raimondii
ref|XP_009416461.1|  PREDICTED: plasminogen activator inhibitor 1...    133   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX76586.1|  BnaA08g08140D                                          132   6e-32   
ref|XP_011626786.1|  PREDICTED: intracellular hyaluronan-binding ...    132   6e-32   Amborella trichopoda
gb|EAY99238.1|  hypothetical protein OsI_21200                          132   7e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010919740.1|  PREDICTED: plasminogen activator inhibitor 1...    132   7e-32   Elaeis guineensis
emb|CDY28966.1|  BnaA02g25100D                                          132   9e-32   Brassica napus [oilseed rape]
ref|XP_011101848.1|  PREDICTED: plasminogen activator inhibitor 1...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_006414219.1|  hypothetical protein EUTSA_v10025512mg             131   2e-31   Eutrema salsugineum [saltwater cress]
gb|KFK24045.1|  hypothetical protein AALP_AAs42697U000600               132   2e-31   Arabis alpina [alpine rockcress]
dbj|BAG90611.1|  unnamed protein product                                128   2e-31   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE71297.1|  hypothetical protein                                   131   2e-31   Trifolium pratense [peavine clover]
emb|CDY65881.1|  BnaAnng21260D                                          129   5e-31   Brassica napus [oilseed rape]
ref|XP_004492923.1|  PREDICTED: intracellular hyaluronan-binding ...    130   5e-31   Cicer arietinum [garbanzo]
ref|XP_004969787.1|  PREDICTED: eukaryotic translation initiation...    130   6e-31   Setaria italica
ref|XP_002440127.1|  hypothetical protein SORBIDRAFT_09g026550          129   8e-31   Sorghum bicolor [broomcorn]
ref|NP_001056139.1|  Os05g0533100                                       127   1e-30   
gb|KDO57094.1|  hypothetical protein CISIN_1g017915mg                   128   1e-30   Citrus sinensis [apfelsine]
ref|XP_009108276.1|  PREDICTED: plasminogen activator inhibitor 1...    128   1e-30   Brassica rapa
ref|XP_006440206.1|  hypothetical protein CICLE_v10020747mg             128   1e-30   Citrus clementina [clementine]
ref|XP_003567795.1|  PREDICTED: plasminogen activator inhibitor 1...    129   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_006477113.1|  PREDICTED: plasminogen activator inhibitor 1...    128   2e-30   Citrus sinensis [apfelsine]
emb|CDY35615.1|  BnaC01g21370D                                          127   3e-30   Brassica napus [oilseed rape]
ref|NP_001281195.1|  plasminogen activator inhibitor 1 RNA-bindin...    128   3e-30   Zea mays [maize]
gb|EYU40365.1|  hypothetical protein MIMGU_mgv1a008102mg                128   3e-30   Erythranthe guttata [common monkey flower]
gb|EEE64473.1|  hypothetical protein OsJ_19323                          128   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ABD65145.1|  nuclear RNA binding protein, putative                   127   4e-30   Brassica oleracea
gb|EEC79581.1|  hypothetical protein OsI_20751                          128   4e-30   Oryza sativa Indica Group [Indian rice]
gb|KFK22256.1|  hypothetical protein AALP_AAs66747U001100               127   5e-30   Arabis alpina [alpine rockcress]
gb|AAT47083.1|  unknown protein                                         127   6e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EMS68133.1|  hypothetical protein TRIUR3_26332                       130   9e-30   Triticum urartu
ref|XP_008675099.1|  PREDICTED: plasminogen activator inhibitor 1...    127   1e-29   Zea mays [maize]
ref|NP_001275394.1|  nuclear RNA binding protein                        126   1e-29   Solanum tuberosum [potatoes]
gb|EMT09866.1|  hypothetical protein F775_32096                         125   2e-29   
dbj|BAJ96699.1|  predicted protein                                      125   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF14246.1|AF110230_1  nuclear RNA binding protein C                 123   3e-29   Spinacia oleracea
dbj|BAJ89734.1|  predicted protein                                      124   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY33522.1|  BnaA06g35510D                                          123   7e-29   Brassica napus [oilseed rape]
emb|CDY38403.1|  BnaC01g10120D                                          124   7e-29   Brassica napus [oilseed rape]
ref|XP_004229741.1|  PREDICTED: plasminogen activator inhibitor 1...    124   8e-29   
gb|EMS59053.1|  hypothetical protein TRIUR3_33029                       122   1e-28   Triticum urartu
gb|EMT08444.1|  hypothetical protein F775_29168                         127   1e-28   
ref|XP_003569708.1|  PREDICTED: RNA-binding protein FUS-like            123   1e-28   Brachypodium distachyon [annual false brome]
emb|CDM84169.1|  unnamed protein product                                123   2e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009130695.1|  PREDICTED: intracellular hyaluronan-binding ...    121   4e-28   Brassica rapa
ref|XP_002991714.1|  hypothetical protein SELMODRAFT_448524             121   1e-27   Selaginella moellendorffii
ref|XP_008459800.1|  PREDICTED: plasminogen activator inhibitor 1...    120   2e-27   Cucumis melo [Oriental melon]
ref|XP_006655517.1|  PREDICTED: plasminogen activator inhibitor 1...    120   2e-27   
ref|XP_006414295.1|  hypothetical protein EUTSA_v10025552mg             119   2e-27   
ref|XP_003568032.1|  PREDICTED: probable H/ACA ribonucleoprotein ...    119   3e-27   Brachypodium distachyon [annual false brome]
emb|CDY43474.1|  BnaC08g10790D                                          119   7e-27   Brassica napus [oilseed rape]
ref|XP_012083710.1|  PREDICTED: plasminogen activator inhibitor 1...    118   8e-27   Jatropha curcas
ref|XP_006284013.1|  hypothetical protein CARUB_v10005134mg             117   1e-26   
ref|XP_009406178.1|  PREDICTED: plasminogen activator inhibitor 1...    117   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM63072.1|  nuclear RNA binding protein A-like protein              117   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093237.1|  PREDICTED: plasminogen activator inhibitor 1...    117   2e-26   Sesamum indicum [beniseed]
ref|XP_008650627.1|  PREDICTED: DNA ligase 1-like                       114   2e-26   
emb|CDX90469.1|  BnaA03g43120D                                          115   9e-26   
ref|XP_009136852.1|  PREDICTED: plasminogen activator inhibitor 1...    114   1e-25   Brassica rapa
ref|XP_002458418.1|  hypothetical protein SORBIDRAFT_03g033140          112   1e-24   Sorghum bicolor [broomcorn]
ref|XP_010053520.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    111   2e-24   Eucalyptus grandis [rose gum]
ref|XP_001760974.1|  predicted protein                                  109   7e-24   
tpg|DAA57853.1|  TPA: hypothetical protein ZEAMMB73_322547              108   1e-23   
ref|NP_199532.1|  Hyaluronan / mRNA binding family protein              108   2e-23   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA57846.1|  TPA: hypothetical protein ZEAMMB73_955694              107   3e-23   
ref|XP_008793172.1|  PREDICTED: uncharacterized protein DDB_G0288...    108   3e-23   Phoenix dactylifera
gb|ACL54182.1|  unknown                                                 105   3e-23   Zea mays [maize]
gb|KHN27127.1|  hypothetical protein glysoja_032895                     106   7e-23   Glycine soja [wild soybean]
ref|XP_009388577.1|  PREDICTED: plasminogen activator inhibitor 1...    103   2e-21   
ref|XP_001767830.1|  predicted protein                                  103   2e-21   
gb|EPS59059.1|  hypothetical protein M569_15751                         102   3e-21   Genlisea aurea
gb|ACU21341.1|  unknown                                                 100   5e-21   Glycine max [soybeans]
ref|XP_001785274.1|  predicted protein                                99.4    4e-20   
gb|ABY60453.1|  putative nuclear RNA binding protein                  92.4    3e-19   Adonis aestivalis var. palaestina
ref|NP_001078724.1|  Hyaluronan / mRNA binding family protein         94.7    5e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KHN00198.1|  hypothetical protein glysoja_034729                   90.1    1e-18   Glycine soja [wild soybean]
gb|ABR26138.1|  salt tolerance protein 2                              91.3    2e-18   Oryza sativa Indica Group [Indian rice]
gb|KHN11561.1|  hypothetical protein glysoja_006014                   87.8    2e-17   Glycine soja [wild soybean]
ref|XP_010440090.1|  PREDICTED: uncharacterized protein LOC104723416  82.8    6e-16   
gb|AGV54489.1|  plasminogen activator inhibitor 1 RNA-binding pro...  87.4    6e-16   Phaseolus vulgaris [French bean]
gb|ADE76006.1|  unknown                                               81.6    2e-15   Picea sitchensis
dbj|BAJ98247.1|  predicted protein                                    81.6    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAS75737.1|  thermoinhibition-associated THB-4 protein             79.3    8e-15   Tagetes minuta
gb|EMT12851.1|  hypothetical protein F775_28068                       82.4    9e-15   
gb|KHN41588.1|  hypothetical protein glysoja_038326                   77.8    5e-14   
ref|XP_008811725.1|  PREDICTED: uncharacterized protein LOC103722810  77.0    8e-14   
ref|WP_035019856.1|  hypothetical protein                             73.2    6e-13   
ref|XP_010231993.1|  PREDICTED: uncharacterized protein LOC100831026  71.6    6e-12   
ref|XP_010445782.1|  PREDICTED: ATP-dependent RNA helicase vasa, ...  71.6    7e-12   
gb|EMS56112.1|  hypothetical protein TRIUR3_18406                     72.8    8e-12   
ref|XP_008798618.1|  PREDICTED: plasminogen activator inhibitor 1...  72.8    1e-11   
ref|XP_001756282.1|  predicted protein                                74.3    1e-11   
ref|XP_010246647.1|  PREDICTED: aspartate, glycine, lysine and se...  72.0    1e-10   
ref|XP_010445332.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  68.6    4e-10   
ref|XP_009383830.1|  PREDICTED: keratin, type I cytoskeletal 9-like   68.6    1e-09   
ref|XP_010926667.1|  PREDICTED: protein argonaute 3-like              68.6    2e-09   
ref|XP_008792951.1|  PREDICTED: circumsporozoite protein-like         67.0    5e-09   
gb|AGT16571.1|  plasminogen activator inhibitor 1 RNA-binding pro...  65.5    5e-09   
gb|ERN10027.1|  hypothetical protein AMTR_s00013p00244720             65.9    1e-08   
ref|XP_002988573.1|  hypothetical protein SELMODRAFT_447366           65.1    2e-08   
ref|XP_006848446.2|  PREDICTED: RNA-binding protein FUS               65.5    2e-08   
ref|XP_005647348.1|  hypothetical protein COCSUDRAFT_47703            65.1    2e-08   
gb|KHN46561.1|  hypothetical protein glysoja_032653                   65.1    2e-08   
ref|XP_008778873.1|  PREDICTED: U3 small nucleolar RNA-associated...  63.2    7e-08   
ref|XP_002979268.1|  hypothetical protein SELMODRAFT_444118           62.4    1e-07   
gb|KHN13635.1|  UDP-glucose 4-epimerase GEPI48                        60.5    3e-07   
gb|AIG51271.1|  salt tolerance protein                                58.9    6e-07   
ref|XP_002534519.1|  RNA binding protein, putative                    59.3    1e-06   
tpg|DAA57848.1|  TPA: hypothetical protein ZEAMMB73_955694            57.8    2e-06   
ref|NP_001173713.1|  Os03g0845300                                     58.9    2e-06   
gb|EAY92561.1|  hypothetical protein OsI_14301                        59.3    2e-06   
gb|AAS07374.1|  hypothetical protein                                  59.3    2e-06   
emb|CAN80478.1|  hypothetical protein VITISV_018750                   58.5    3e-06   
ref|XP_003635425.2|  PREDICTED: interleukin enhancer-binding fact...  58.5    3e-06   
ref|NP_001078723.1|  Hyaluronan / mRNA binding family protein         58.2    3e-06   
tpg|DAA57854.1|  TPA: hypothetical protein ZEAMMB73_322547            56.6    4e-06   
ref|XP_001760895.1|  predicted protein                                57.8    6e-06   
ref|XP_010646835.1|  PREDICTED: uncharacterized protein LOC100262339  57.8    6e-06   
ref|XP_010685112.1|  PREDICTED: epsin-like                            54.3    8e-05   
ref|XP_001694669.1|  vasa intronic gene                               53.5    1e-04   
ref|XP_011008634.1|  PREDICTED: spore wall protein 2-like             52.4    3e-04   
ref|XP_002539777.1|  conserved hypothetical protein                   48.9    4e-04   
dbj|BAH56853.1|  AT5G47210                                            48.5    6e-04   
ref|XP_002307871.1|  hypothetical protein POPTR_0006s01090g           51.2    7e-04   
emb|CDX71517.1|  BnaC04g17520D                                        49.7    8e-04   
dbj|BAD87405.1|  nuclear RNA binding protein A-like                   48.1    0.001   



>emb|CDP08361.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 169/229 (74%), Gaps = 14/229 (6%)
 Frame = -3

Query  916  LSNGENADGEY----PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGV  749
             SNGE ADGE+    PRR ++RRSGTGRG+EIKREG+GRGNWG+PTDEIAPE EEP    
Sbjct  159  FSNGEAADGEHGERPPRRIFDRRSGTGRGNEIKREGAGRGNWGTPTDEIAPETEEP----  214

Query  748  VNDGVNTDAFEKQHGQEDAGDAKKDSPL--depevkepedkEMTLDEYEKLLEEKRKAIL  575
            VN+G      EKQ GQE  GD  KDS +   E + KEPE+KEMTL+EY+KLLEEKRK++L
Sbjct  215  VNEGEKNADAEKQSGQETVGDGNKDSHVDEPEEKEKEPEEKEMTLEEYQKLLEEKRKSLL  274

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLK  395
            AS+PEERKV LDKEFESM LL+NKKNDD+VF+KLGS  +DK+++AGEK KK  SINEFLK
Sbjct  275  ASKPEERKVNLDKEFESMQLLSNKKNDDDVFIKLGS-DKDKRRDAGEKAKKAVSINEFLK  333

Query  394  PAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            PAEGE        G          G  GNN+ + E PSI DVGQFP+LG
Sbjct  334  PAEGEN---YYRPGGRGRGRGRGRGGYGNNSYNVEAPSIADVGQFPSLG  379



>ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X1 [Sesamum indicum]
Length=365

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 166/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE A+G+ PRRA++RRSGTGRG+E KREG+GRGNWG+PTDEI PE EEP     N+G
Sbjct  149  YNNGEAAEGDRPRRAFDRRSGTGRGTEFKREGAGRGNWGTPTDEIVPETEEP----TNEG  204

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G++D  DA KDS  +E E KEPE+KEMTL+EYEK+LEEKRKA+LA + EE
Sbjct  205  VKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKSEE  264

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKKNDDEVF+KLGS  +DK+KEA EK KK+ SINEFLKPAEG+ 
Sbjct  265  RKVGLDKELESMQLLSNKKNDDEVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPAEGD-  322

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              +    G          G  G N  + E P+IEDVGQFP+L +K
Sbjct  323  --KYYRAGGRGRGRGRGRGGFGGNNYNVEAPAIEDVGQFPSLVAK  365



>gb|AAF14242.1|AF110226_1 nuclear RNA binding protein [Nicotiana tabacum]
Length=299

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAF  719
            +GE PRR ++RRSGTGRG+E IKREGSGRGNWG+P D+IA E E P    VNDG      
Sbjct  86   EGERPRRVFDRRSGTGRGNEYIKREGSGRGNWGTPADDIAQETEVP----VNDGEKIVEA  141

Query  718  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
            EK+ GQE+A D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LD
Sbjct  142  EKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLD  201

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpgg  359
            KE ESM LL+NKKNDDE+F+KLGS +++K+KEA EK +KT+SINEFLKPAEGE Y R GG
Sbjct  202  KELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTQSINEFLKPAEGENYSRRGG  260

Query  358  rgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            RGRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  261  RGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  299



>ref|XP_009613635.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 170/219 (78%), Gaps = 6/219 (3%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAF  719
            +GE PRR ++RRSGTGRG+E IKREGSGRGNWG+P D+IA E E P    VNDG      
Sbjct  160  EGERPRRVFDRRSGTGRGNEYIKREGSGRGNWGTPADDIAQETEVP----VNDGEKIVEA  215

Query  718  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
            EK+ GQE+A D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LD
Sbjct  216  EKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLD  275

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpgg  359
            KE ESM LL+NKKNDDE+F+KLGS +++K+KEA EK +KT+SINEFLKPAEGE Y R GG
Sbjct  276  KELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTQSINEFLKPAEGENYSRRGG  334

Query  358  rgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            RGRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  335  RGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  373



>ref|XP_009607512.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=359

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 174/225 (77%), Gaps = 9/225 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNG+ AD E PRRA+ERRSGTGRG+E KREG+GRGNWG+P DE APE EEP+N    +G
Sbjct  144  FSNGDTAD-ERPRRAFERRSGTGRGNEFKREGAGRGNWGTPADEFAPEKEEPLN----EG  198

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   Q DA DA KDSP  EP+ KEPE+KEMTL+EYEKLLE+KRKA+LA +PEE
Sbjct  199  EKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEDKRKALLALKPEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA EK KKTKSINEFLKPA+G +
Sbjct  259  RKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVEKAKKTKSINEFLKPADGGS  317

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            YYR GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  318  YYRRGGRGRGGRDHGRDGVVGNNSVSA---PSIEDVRQFPSLGAK  359



>ref|XP_009789577.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=374

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 169/229 (74%), Gaps = 9/229 (4%)
 Frame = -3

Query  916  LSNGENADGE--YPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVV  746
             SNG+ A+GE   PRR ++RRSGTGRG+E IKREGSGRGNWG+P D+IA E E P    V
Sbjct  151  FSNGDAAEGEGERPRRVFDRRSGTGRGNEYIKREGSGRGNWGTPADDIAQETEVP----V  206

Query  745  NDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR  566
            NDG      EK+ GQEDA D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +
Sbjct  207  NDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALK  266

Query  565  PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAE  386
            PEERKV LDKE E+M LL+NKKNDDE+F+KLGS +++K+KEA EK +KTKSINEFLKPA+
Sbjct  267  PEERKVNLDKELETMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTKSINEFLKPAD  325

Query  385  GETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLGSK  242
            GE+ Y   G           G  GG   + +F  PSIEDVGQFP+L +K
Sbjct  326  GESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSLVAK  374



>ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=358

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 163/225 (72%), Gaps = 8/225 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            L+NGE A G++PRR ++RRSGTGRG+E KREG+GRGNWG+ TDEI  + EEP +    +G
Sbjct  142  LNNGEAAAGDHPRRVFDRRSGTGRGTEYKREGAGRGNWGTHTDEIVQDTEEPDS----EG  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ GQ+D GDA KD+   E E KEPE+KEMTL+EYEK+LEEKRKA+LA +  E
Sbjct  198  VKNVESEKRSGQDDVGDANKDTSAKEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKSRE  257

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKKNDD+VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE 
Sbjct  258  RKVDLDKELESMQLLSNKKNDDDVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPAEGE-  315

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              +  G  R         G  G N    + P+IEDVGQFP+L +K
Sbjct  316  --KYYGAVRRGRGHGRGRGGYGGNNYDLQAPAIEDVGQFPSLVAK  358



>ref|XP_010661405.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Vitis vinifera]
 emb|CBI16673.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 177/231 (77%), Gaps = 6/231 (3%)
 Frame = -3

Query  928  RRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGV  749
            RRGG SNGE  DG+ PRRA+ERRSGTGRG+E+KREGSGRGNWG+ TDE++   EE    V
Sbjct  135  RRGGFSNGEAGDGDRPRRAFERRSGTGRGNELKREGSGRGNWGTETDELSGVTEE----V  190

Query  748  VNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILAS  569
            VN+G      EK  G+ED  D  K++P++EPE KEPE+KEMTL+EYEK+LEE+RKA+   
Sbjct  191  VNEGEKNLGAEKPVGEEDVADGNKENPVNEPEEKEPEEKEMTLEEYEKVLEERRKALQTL  250

Query  568  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLK  395
            + EERKV +DKEF+SM  L++KK +D++F+KLGS+K+ +K+ A +  + KK  SINEFLK
Sbjct  251  KTEERKVDVDKEFKSMQQLSSKKGNDDIFIKLGSDKDKRKEAAEKEERAKKAVSINEFLK  310

Query  394  PAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            PAEGE +Y PGGRGRGRG GS  G  GGN  S+   PSIED GQFPTLG+K
Sbjct  311  PAEGERFYSPGGRGRGRGRGSRGGYGGGNAMSNVAAPSIEDPGQFPTLGAK  361



>ref|XP_010677113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Beta vulgaris subsp. vulgaris]
 emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris]
Length=356

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 167/224 (75%), Gaps = 9/224 (4%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            NGE A+GE PRR YERRSGTGRG EIKREGSGRGNWGSPTDEIAPE EEP+  V N+   
Sbjct  139  NGEAAEGERPRRMYERRSGTGRGGEIKREGSGRGNWGSPTDEIAPETEEPV--VENEAAV  196

Query  730  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
              A +K  G+ +  DA+K+S   E    EPE+KEMTL+EYEK+LEEKRKA+L+ + EERK
Sbjct  197  --AADKPAGEGENVDAEKESQEKEVVEAEPEEKEMTLEEYEKVLEEKRKALLSLKGEERK  254

Query  550  VCLDKEFESMALLANKKNDDEVFVKLGSekedkkkea--gekvkktKSINEFLKPAEGET  377
            V LDKEFESM L++ KKNDDEVF+KLGS+K+ +K+ A   E+ KK+ SINEFLKPAEG+ 
Sbjct  255  VDLDKEFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAEREERSKKSVSINEFLKPAEGDG  314

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  245
            Y+R G      G G   GGYG NN S+   PSIED  QFP+LG+
Sbjct  315  YHRRGRGRGRGGRGGYGGGYGMNNASA---PSIEDPNQFPSLGA  355



>ref|XP_009772173.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 177/225 (79%), Gaps = 8/225 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNG+ ADGE PRRA+ERRSGTGRG+E KREG+GRGNWG+P DE+APE EEP    VN+G
Sbjct  140  FSNGDAADGERPRRAFERRSGTGRGNEFKREGAGRGNWGTPADELAPEKEEP----VNEG  195

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EKQ  Q DA DA KDSP  EP+ KEPE+KEMTL+EYEKLLEEKRKA+LA +PEE
Sbjct  196  EKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEEKRKALLALKPEE  255

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA EK KKTKSINEFLKPA+GE+
Sbjct  256  RKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVEKAKKTKSINEFLKPADGES  314

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            YY  GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  315  YYGRGGRGRGGRDRGRDGFVGNNSVSA---PSIEDVRQFPSLGAK  356



>ref|XP_006362472.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum tuberosum]
Length=366

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 161/219 (74%), Gaps = 7/219 (3%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAF  719
            +GE PRR ++RRSGTGRG+E IKREGSGRGNWG+  D+IAP  EE     VNDG      
Sbjct  154  EGERPRRVFDRRSGTGRGNEFIKREGSGRGNWGTTADDIAPVTEE----SVNDGEKIVDA  209

Query  718  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
            EKQ GQEDAGD  KDS   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LD
Sbjct  210  EKQSGQEDAGDTNKDSSAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLD  269

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpgg  359
             E +SM LL+NKKNDDE+F+KLG+ ++DKKKEA EK KKTKSINEFLKPAEGE+ Y   G
Sbjct  270  NELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVEKNKKTKSINEFLKPAEGES-YYRPG  327

Query  358  rgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                        G G    +S  +PSIEDVGQFP+L +K
Sbjct  328  GRGRGRGRGRGNGGGYGGINSVSSPSIEDVGQFPSLAAK  366



>ref|XP_012070071.1| PREDICTED: U3 small nucleolar RNA-associated protein 25 [Jatropha 
curcas]
 gb|KDP39931.1| hypothetical protein JCGZ_03462 [Jatropha curcas]
Length=366

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 160/227 (70%), Gaps = 9/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE A+GE PRR YERRSGTGRG+EIKR+G+GRGNWG+PTDEIA E EEP+  +  + 
Sbjct  147  FSNGETAEGERPRRLYERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEPVTEIEKNV  206

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK  G+EDA DA K+SP  +   ++ EDKEMTL+EYEK+LEEKRKA+L+S+ EE
Sbjct  207  V----AEKPSGEEDAADANKESP-ADEPEEKVEDKEMTLEEYEKILEEKRKALLSSKTEE  261

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEG  383
            RKV ++KEF SM  L+NKK +D++F+KLGSEK+ +K  A ++   KK+ SI EFLKPA+G
Sbjct  262  RKVDVEKEFGSMLQLSNKKGNDDIFIKLGSEKDKRKDAADKEDRAKKSVSITEFLKPADG  321

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E      G          RGGY G N      PSIED GQFP+LG K
Sbjct  322  E--KYYSGGRGRGRGRGSRGGYVGGNARDVAAPSIEDRGQFPSLGGK  366



>ref|XP_002303373.2| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|EEE78352.2| nuclear RNA-binding family protein [Populus trichocarpa]
Length=361

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 164/230 (71%), Gaps = 10/230 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ +GE PRR YER SGTGRG+EIKREGSGRGNWG+PTDEIAPE E+P   VV++ 
Sbjct  137  YSNGEDGEGERPRRMYERHSGTGRGNEIKREGSGRGNWGTPTDEIAPETEDP---VVDNE  193

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             N    EKQ G+EDA DA KD+  ++PE KEPE+KEMTL+EYEK+LEEKRKA+L  + EE
Sbjct  194  KNV-ITEKQQGEEDAADANKDT-AEKPEEKEPEEKEMTLEEYEKVLEEKRKALLDLKTEE  251

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEG  383
            RKV LDK+ + M  L++KK++DE+F+KLGSEK+ +K  A ++   KK  SINEFLKPAEG
Sbjct  252  RKVGLDKDLQCMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAEG  311

Query  382  E---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E      R G        G G G   G+N      PSIED GQFP+LG K
Sbjct  312  ERSYNSGRGGRGRGRGRGGYGSGSGYGSNARDVAAPSIEDPGQFPSLGGK  361



>ref|NP_001275449.1| plasminogen activator inhibitor 1 RNA-binding protein-like [Solanum 
tuberosum]
 gb|ABA81884.1| nuclear RNA binding protein-like [Solanum tuberosum]
Length=363

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 160/219 (73%), Gaps = 7/219 (3%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAF  719
            +GE PRR ++RRSGTGRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      
Sbjct  151  EGERPRRVFDRRSGTGRGNEFIKREGSGRGNWGTTADDIAPETEVP----VIDGEKIVEA  206

Query  718  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
            EKQ GQEDAGD  K+S   EPE KEPE+KE+TL+EYEK++EEKRKA++A + EERKV LD
Sbjct  207  EKQAGQEDAGDTNKESTAAEPEEKEPEEKEITLEEYEKVMEEKRKALVALKQEERKVNLD  266

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpgg  359
            KE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA EK KKTKSINEFLKPAEGE+ Y   G
Sbjct  267  KELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVEKTKKTKSINEFLKPAEGES-YYRPG  324

Query  358  rgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                        G G    +S   PSIEDVGQFP+L  K
Sbjct  325  GRGRGRGRGRGNGGGYGGINSVSAPSIEDVGQFPSLAVK  363



>ref|XP_004253373.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like, 
partial [Solanum lycopersicum]
Length=327

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 159/224 (71%), Gaps = 9/224 (4%)
 Frame = -3

Query  898  ADGEY--PRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNT  728
            ADGE   PRR ++RRSGTGRG+E IKREGSGRGNWG+  D+IA E E P    V DG   
Sbjct  104  ADGEIERPRRVFDRRSGTGRGNEYIKREGSGRGNWGTTADDIALETEVP----VVDGEKI  159

Query  727  DAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
               EKQ GQEDAGD  KDS   E E KEPE+KEMTL+EYEK++EEKRKA++A + EERKV
Sbjct  160  VEAEKQTGQEDAGDDNKDSTAAELEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKV  219

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyr  368
             LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA EK KK +SINEFLKPAEGE+ Y 
Sbjct  220  NLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVEKAKKAQSINEFLKPAEGES-YY  277

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK*G  236
              G            G G    SS   PSIEDVGQFP+L  K G
Sbjct  278  RPGGRGRGRGRGRGNGGGYGGISSVSAPSIEDVGQFPSLAVKKG  321



>ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288133 [Vitis vinifera]
 emb|CBI29539.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 166/227 (73%), Gaps = 10/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +GE PRRAYERRSGTGRG+EIKR+G+GRGNWG+P DEIAPE EEPIN      
Sbjct  145  FSNGEVGEGERPRRAYERRSGTGRGNEIKRDGAGRGNWGTPADEIAPENEEPINETEK--  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             NT A EKQ G+E A DA K++P++E E KEPEDKEMTL+EY+K+LEEKRKA+LA + EE
Sbjct  203  -NTSA-EKQLGEEIAADANKENPVNESEEKEPEDKEMTLEEYQKVLEEKRKALLALKTEE  260

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEG  383
            RKV + K+FE+M  L++KK++D+VF+KLGSEK+ +K   +  E+ KK+ SINEFLKPA  
Sbjct  261  RKVDV-KDFEAMQQLSSKKDNDDVFIKLGSEKDKRKELADKEERAKKSVSINEFLKPA--  317

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                R  G          RGG+ GN  S+   PSIED GQFPTLG K
Sbjct  318  -EGERYYGGRGRGRGRGTRGGFAGNTYSNVAAPSIEDPGQFPTLGGK  363



>emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera]
Length=363

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 166/227 (73%), Gaps = 10/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +GE PRRAYERRSGTGRG+EIKR+G+GRGNWG+P DEIAPE EEPIN      
Sbjct  145  FSNGEVGEGERPRRAYERRSGTGRGNEIKRDGAGRGNWGTPADEIAPENEEPINETEK--  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             NT A EKQ G+E A DA K++P++E E KEPEDKEMTL+EY+K+LEEKRKA+LA + EE
Sbjct  203  -NTSA-EKQLGEEIAADANKENPVNESEEKEPEDKEMTLEEYQKVLEEKRKALLALKTEE  260

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEG  383
            RKV + K+FE+M  L++KK++D+VF+KLGSEK+ +K   +  E+ KK+ SINEFLKPA  
Sbjct  261  RKVDV-KDFEAMQQLSSKKDNDDVFIKLGSEKDKRKELADKEERAKKSVSINEFLKPA--  317

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                R  G          RGG+ GN  S+   PSIED GQFPTLG K
Sbjct  318  -EGERYYGGRGRGCGRGTRGGFAGNTYSNVAAPSIEDPGQFPTLGGK  363



>ref|XP_011031954.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=362

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 162/230 (70%), Gaps = 9/230 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ +GE PRR YER SGTGRG+EIKREGSGRGNWG+PTDEI PE E+P   VV++ 
Sbjct  137  YSNGEDREGERPRRLYERHSGTGRGNEIKREGSGRGNWGTPTDEIVPETEDP---VVDNE  193

Query  736  VNTDAFEKQHGQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRP  563
             N    EKQ G+E+A DA KD+     E + KEPE+KEMTL+EYEK+LEEKRKA+LA + 
Sbjct  194  KNV-ITEKQQGEENAADANKDTAEKEPEEKEKEPEEKEMTLEEYEKVLEEKRKALLALKT  252

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPA  389
            EERKV LDK+ + M  L++KK++DE+F+KLGSEK+ +K  A ++   KK  SINEFLKPA
Sbjct  253  EERKVGLDKDLQCMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPA  312

Query  388  EGE-TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EGE +Y    G         G G   G+N      PSIED GQFP+LG K
Sbjct  313  EGERSYNPGRGGRGRGRGRGGYGSGYGSNARDVAAPSIEDPGQFPSLGGK  362



>ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=365

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 173/225 (77%), Gaps = 5/225 (2%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +N E  +G+ PRR Y+RRSGTGRG++ KREG+GRGNWG+PTDEIAPE EEP      +G
Sbjct  146  FNNEEGGEGDRPRRVYDRRSGTGRGNDFKREGAGRGNWGTPTDEIAPETEEP----AAEG  201

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDAGDAKKDS + EPE KEPE+KEMTL+EYEKLLEEKRKA+LA +PEE
Sbjct  202  EKIVDSEKPAGEEDAGDAKKDSSVAEPEEKEPEEKEMTLEEYEKLLEEKRKALLAQKPEE  261

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKEFESM LL+NKKN+D+VF+KLG+ ++DK+KEA EK KKTKSINEFLKPAEG  
Sbjct  262  RKVNLDKEFESMQLLSNKKNEDDVFIKLGA-EKDKRKEAVEKAKKTKSINEFLKPAEGGN  320

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            YYR  GRG     G G     G N  S E P IEDVGQFP+LG+K
Sbjct  321  YYRGRGRGGRGRGGRGGYEGNGGNNYSVEAPKIEDVGQFPSLGAK  365



>ref|XP_006362474.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Solanum tuberosum]
Length=364

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 158/217 (73%), Gaps = 7/217 (3%)
 Frame = -3

Query  889  EYPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEK  713
            E PR+ ++RRSGTGRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      EK
Sbjct  154  ERPRKVFDRRSGTGRGNEYIKREGSGRGNWGTTADDIAPETEVP----VIDGEKIVEAEK  209

Query  712  QHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
            Q GQEDAGD  KDS   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LDKE
Sbjct  210  QAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDKE  269

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrg  353
             +SM LL+NKKNDDE+F+KLG+ ++DKKKEA EK KKT++INEFLKPAEGE  Y   G  
Sbjct  270  LQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVEKAKKTQNINEFLKPAEGEN-YYRSGGR  327

Query  352  rgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                      G G    +S   PSIEDVGQFP+L +K
Sbjct  328  GRGRGRGRGNGGGYVGNNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=369

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 172/228 (75%), Gaps = 8/228 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +N E A+G+ PRR Y+RRSGTGRG++ KREG+GR NWG+PTDEIAPE EEP    V +G
Sbjct  147  FNNEEGAEGDRPRRVYDRRSGTGRGNDFKREGAGRANWGTPTDEIAPETEEP----VTEG  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDAGDAKKDS    PE KEPE+KEMTL+EYEKLLEEKRKA+LA +PEE
Sbjct  203  EKIVDPEKPAGEEDAGDAKKDSSAAAPEEKEPEEKEMTLEEYEKLLEEKRKALLAQKPEE  262

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE-  380
            RKV LDKEFESM LL+NKKN+D+VF+KLG+ ++DK+KEA EK KKTKSINEFLKPAEGE 
Sbjct  263  RKVNLDKEFESMQLLSNKKNEDDVFIKLGA-EKDKRKEAVEKAKKTKSINEFLKPAEGEN  321

Query  379  --TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                   GGRG     G G  G  G N  S E P IEDVGQFP+LG+K
Sbjct  322  YYRGRGRGGRGGRGRGGYGGNGGNGGNNYSVEAPKIEDVGQFPSLGAK  369



>ref|XP_006362473.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Solanum tuberosum]
Length=364

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 158/217 (73%), Gaps = 7/217 (3%)
 Frame = -3

Query  889  EYPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEK  713
            E PR+ ++RRSGTGRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      EK
Sbjct  154  ERPRKVFDRRSGTGRGNEYIKREGSGRGNWGTTADDIAPETEVP----VIDGEKIVEAEK  209

Query  712  QHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
            Q GQEDAGD  KDS   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LDKE
Sbjct  210  QAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDKE  269

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrg  353
             +SM LL+NKKNDDE+F+KLG+ ++DKKKEA EK KKT++INEFLKPAEGE  Y   G  
Sbjct  270  LQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVEKAKKTQNINEFLKPAEGEN-YYRSGGR  327

Query  352  rgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                      G G    +S   PSIEDVGQFP+L +K
Sbjct  328  GRGRGRGRGNGGGYVGNNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_010275458.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=359

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 161/228 (71%), Gaps = 11/228 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +N E A+GE+P+R +ERRSGTGRG+E+KREGSGRGNWG+PTDEI  E EE     +   
Sbjct  140  FNNDEVAEGEHPKRIFERRSGTGRGNEMKREGSGRGNWGTPTDEIVQETEEVEKTTIT--  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+++ GD  K++P++EPE KEPEDKEMTLDEYEK+LEEKRKA+ A + EE
Sbjct  198  ------EKTGGEDETGDTNKENPVNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTEE  251

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAE-  386
            RKV LDK+FESM  LA+KK +D+VF+KLGSEK+ +K+     E+ KK+ SINEFLKPAE 
Sbjct  252  RKVNLDKDFESMQQLASKKGNDDVFIKLGSEKDKRKEAIDKEERTKKSVSINEFLKPAEG  311

Query  385  GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            G  Y   G      G GS  G  G N  S+   PSIED GQFPTLG K
Sbjct  312  GRYYSPGGRGRGRGGRGSRGGFSGVNQASNVVAPSIEDPGQFPTLGGK  359



>gb|EYU19470.1| hypothetical protein MIMGU_mgv1a008507mg [Erythranthe guttata]
Length=371

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 171/230 (74%), Gaps = 8/230 (3%)
 Frame = -3

Query  928  RRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGV  749
            RRGG SNG++ +GE PRR Y+R SGTGRG+E KREG+GRGNWG+ T++IAPE EEP + V
Sbjct  149  RRGGFSNGDSEEGERPRRTYDRHSGTGRGNEFKREGAGRGNWGTHTEDIAPETEEPASEV  208

Query  748  -VNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA  572
             + D       EK  G+EDA DA KDSP ++ E +  E+KEMTL+EYEK+ EEKRKA+L+
Sbjct  209  KIVDP------EKPSGEEDAVDANKDSPKEQEEKEPEEEKEMTLEEYEKVREEKRKALLS  262

Query  571  SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKP  392
             + EERKV LDKE E+M LL+ KKNDDEVF+KLGS  +DK+KEA EK KK+ SINEFLKP
Sbjct  263  LKSEERKVNLDKELEAMQLLSTKKNDDEVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKP  321

Query  391  AEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            AEGE YYR GGRG     G GR G  G + +    P+I DVGQFP+LG K
Sbjct  322  AEGENYYRGGGRGGRGRGGRGREGGFGRSNAGERAPAIGDVGQFPSLGGK  371



>ref|XP_010258760.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=358

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 170/229 (74%), Gaps = 11/229 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEE-PINGVVND  740
             SNGE  +GE PRR +ERRSGTGRG+EIKREG+GRGNWG   DE+  E EE  I      
Sbjct  137  FSNGEEGEGERPRRVFERRSGTGRGNEIKREGAGRGNWGRQADELVQETEELSIE-----  191

Query  739  GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
               T   EK  G+E+AGDA K++P +EPE KEPEDKEMTLDEYEK+LEEKRKA+ A + E
Sbjct  192  --KTAITEKPVGEEEAGDANKENPTNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTE  249

Query  559  ERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            ERKV LDK+FESM  LANKK +D+VF+KLGS+K+ +K   +  E+ KK+ SINEFLKP+E
Sbjct  250  ERKVNLDKDFESMQQLANKKGNDDVFIKLGSDKDKRKDNTDKEERAKKSVSINEFLKPSE  309

Query  385  GETyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLGSK  242
            GE YY PGGRGRGRG    +GG+GG N +S E  PSI D GQFPTLG K
Sbjct  310  GEKYYNPGGRGRGRGGRGSKGGFGGGNMTSNEVAPSIGDPGQFPTLGGK  358



>gb|KJB37651.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=306

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 161/226 (71%), Gaps = 8/226 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG+E KR+GSGRGNWGSPTD IAPE EE     V + 
Sbjct  88   FNDGESGEGERPRRMYDRRSGTGRGNEFKRDGSGRGNWGSPTDGIAPETEEN----VPEN  143

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EE
Sbjct  144  EKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEE  203

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGE  380
            RKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE
Sbjct  204  RKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGE  262

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                 G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  263  R--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  306



>gb|KJB37646.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=357

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 161/226 (71%), Gaps = 8/226 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG+E KR+GSGRGNWGSPTD IAPE EE     V + 
Sbjct  139  FNDGESGEGERPRRMYDRRSGTGRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPEN  194

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EE
Sbjct  195  EKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEE  254

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGE  380
            RKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE
Sbjct  255  RKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGE  313

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                 G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  314  R--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  357



>gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=364

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 177/227 (78%), Gaps = 9/227 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETE  199

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  200  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  259  RKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  318

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  319  ERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  364



>ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Citrus sinensis]
Length=364

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 177/227 (78%), Gaps = 9/227 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETE  199

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  200  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  259  RKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  318

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  319  ERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  364



>ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=364

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 178/227 (78%), Gaps = 9/227 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETE  199

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  200  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  259  RKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  318

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  ++S+   P IED GQFP+LG K
Sbjct  319  ERYFNPSGRGRGRGRGSRGGYGGSTSSSAA-APKIEDPGQFPSLGGK  364



>ref|XP_007209289.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
 gb|EMJ10488.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
Length=360

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 173/233 (74%), Gaps = 7/233 (3%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RR G +NG++A+GE PRR ++RRSGTG GSE KR+G+GRGNWG+PTD+IA E EEP  
Sbjct  133  GGRRSGFNNGDDAEGERPRRVFDRRSGTGHGSEFKRDGAGRGNWGTPTDDIAQETEEPGT  192

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
             +     N  A EKQ G+ +A DA K++ ++E E KEPE+KEMTL+EYEK+LEEKRKA+L
Sbjct  193  EIEK---NVGA-EKQLGENEAADANKENTVNESEEKEPEEKEMTLEEYEKVLEEKRKALL  248

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEF  401
            A + EERKV LDKE +SM  L+NKK ++++F+KLGSEK+ +K+ A ++   KK+ SINEF
Sbjct  249  ALKTEERKVDLDKELKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEF  308

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            LKPAEGE YY   GRGRGRG   G  G  G  + S   PSIED GQFPTLG K
Sbjct  309  LKPAEGERYYGGRGRGRGRGPRGGYSGGPGGYSGSA-APSIEDPGQFPTLGGK  360



>gb|KJB24881.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 157/227 (69%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ADGE PRR YERRSGTGRG+E+KREGSGRGNWG+ TDE+A   EE    V N+G
Sbjct  143  FSNGEDADGERPRRLYERRSGTGRGNELKREGSGRGNWGTQTDELAQVTEE----VANEG  198

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDA DA K+S  +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  199  ERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEG
Sbjct  259  RKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKPAEG  317

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y              RG  GGN       PSIED G FP LG K
Sbjct  318  E-RYYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  363



>gb|KJB24880.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 157/227 (69%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ADGE PRR YERRSGTGRG+E+KREGSGRGNWG+ TDE+A   EE    V N+G
Sbjct  143  FSNGEDADGERPRRLYERRSGTGRGNELKREGSGRGNWGTQTDELAQVTEE----VANEG  198

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDA DA K+S  +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  199  ERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEG
Sbjct  259  RKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKPAEG  317

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y              RG  GGN       PSIED G FP LG K
Sbjct  318  E-RYYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  363



>gb|AEI59279.1| RNA binding protein [Suaeda glauca]
Length=359

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 171/226 (76%), Gaps = 9/226 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            + NGE A+G+  RR YERRSGTGRG EIKR+G+GRGNWG+PTDEIAPE+ EP+  V N+ 
Sbjct  140  IVNGEIAEGDRSRRVYERRSGTGRGGEIKRDGAGRGNWGTPTDEIAPESGEPV--VENEA  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V  D  EK  G E+    +K++P  E E  EPE+K+MTL+EY+K+LEEKRKA+LA + EE
Sbjct  198  VAAD--EKPSGDENVV-VEKENPEKEAEETEPEEKQMTLEEYQKVLEEKRKALLALKAEE  254

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV LDK+FESM L++ KKNDDEVF+KLGS+K+ +K+ A +  + KK+ SINEFL+PAEG
Sbjct  255  RKVDLDKDFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAEKDERAKKSVSINEFLRPAEG  314

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  245
            + +YR GGRGR RG   G GG  G N +S   PSIED  QFP+LG+
Sbjct  315  DGHYRRGGRGRSRGGRGGYGGGYGMNNAS--APSIEDPSQFPSLGA  358



>ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
 gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
Length=364

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 164/227 (72%), Gaps = 11/227 (5%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEP-INGVVNDG  737
            SNGE  +GE PRR Y+RRSGTGRG+E KREG+GRGNWG+P DEIAPE EEP I    N G
Sbjct  146  SNGEAGEGERPRRLYDRRSGTGRGNEFKREGAGRGNWGTPADEIAPEIEEPLIENEKNIG  205

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            +     EK  G+E A DA KD+P++E E KEPEDKEMTL+EYEKL EE++K++  S+ EE
Sbjct  206  I-----EKPSGEEGAADANKDNPMNELEEKEPEDKEMTLEEYEKLREERKKSLSLSKAEE  260

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEG  383
            RKV ++KEF +M  L+NKK  DE+F+KLGSEK+ +K  A ++   KK  SINEFLKPAEG
Sbjct  261  RKVDVEKEFGTMLQLSNKKGSDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAEG  320

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+   GRGRGRG   G G     + ++   PSIED GQFPTLG K
Sbjct  321  ERYFGGRGRGRGRGSRGGYGLGSARDVAA---PSIEDRGQFPTLGGK  364



>ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052328.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052329.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96484.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96485.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96486.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
Length=375

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 157/227 (69%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE   GE PRR YER SGTGRG+E+KREGSGRGNWG+ TDE+A   EE    VVN+ 
Sbjct  155  FSNGEVGQGERPRRMYERHSGTGRGNELKREGSGRGNWGTQTDELAQVTEE----VVNES  210

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDAGDA K+SP +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  211  EKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEE  270

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEF +M  L+NKK++DEVF+KLGSEK+ +K+     E+ KK+ SINEFLKPAEG
Sbjct  271  RKVDA-KEFATMQQLSNKKSNDEVFIKLGSEKDKRKEAFDKEERAKKSVSINEFLKPAEG  329

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y              RG  GG+   +   PSIED GQFPTLG K
Sbjct  330  E-RYYNPSGRGRGRGRGSRGFGGGSAAGNVSAPSIEDPGQFPTLGGK  375



>gb|KHG17525.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=361

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 156/227 (69%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ADGE PRR YERRSGTGRG+E+KREGSGRGNWG+ TDE+A   EE    V N G
Sbjct  141  FSNGEDADGERPRRLYERRSGTGRGNELKREGSGRGNWGTQTDELAQVTEE----VANGG  196

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDA DA K+S  +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  197  ERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEE  256

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEG
Sbjct  257  RKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKPAEG  315

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y              RG  GGN       PSIED G FP LG K
Sbjct  316  E-RYYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  361



>gb|KJB24891.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=361

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 157/227 (69%), Gaps = 9/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ADGE PRR YERRSGTGRG+E+KREGSGRGNWG+ TDE+A      +  V N+G
Sbjct  142  FSNGEDADGEQPRRLYERRSGTGRGNELKREGSGRGNWGTQTDELA-----QVTEVTNEG  196

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDA +A K+S  +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  197  ERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEE  256

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEFESM  L+NKKN+DEVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEG
Sbjct  257  RKVDA-KEFESMQQLSNKKNNDEVFIKLGSDKDKRKEAYEKEERAKKSVSINEFLKPAEG  315

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y              RG  GG+       PSIED G FPTLG K
Sbjct  316  E-RYYNPSGRGRGRGRGSRGFGGGSAARDVAAPSIEDPGHFPTLGGK  361



>gb|KHG05539.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=362

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 158/227 (70%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            +SNGE+ADGE PRR YERRSGTGRG+E+KREGSGRGNWG+ TD +A   EE    V N+G
Sbjct  142  ISNGEDADGERPRRLYERRSGTGRGNELKREGSGRGNWGTQTDNLAQVTEE----VTNEG  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDA DA K+S  +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  198  ERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEE  257

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEFESM  L+NKK++DEVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEG
Sbjct  258  RKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYEKEERAKKSVSINEFLKPAEG  316

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y              RG  GG+       PSIED G FPTLG K
Sbjct  317  E-RYYNPSGRGRGRGRGSRGFGGGSAARDVAAPSIEDPGHFPTLGGK  362



>gb|KJB37647.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 155/226 (69%), Gaps = 9/226 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG+E KR+GSGRGNWGSPTD IAPE EE     V + 
Sbjct  139  FNDGESGEGERPRRMYDRRSGTGRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPEN  194

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                + EKQ G+EDA DA K++       ++  + +MTL+EYEK++EEKRKA+LA + EE
Sbjct  195  EKNVSIEKQSGEEDAMDAGKEN-AANEAEEKEPENKMTLEEYEKIVEEKRKALLALKTEE  253

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGE  380
            RKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE
Sbjct  254  RKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGE  312

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                 G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  313  R--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  356



>gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=363

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 176/227 (78%), Gaps = 10/227 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETE  199

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  200  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  258

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  259  RKVDVDEEFKSMQPLSNKKSNDDVFIK-GSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  317

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  318  ERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  363



>gb|KJB37648.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 160/226 (71%), Gaps = 9/226 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG + KR+GSGRGNWGSPTD IAPE EE     V + 
Sbjct  139  FNDGESGEGERPRRMYDRRSGTGRG-QFKRDGSGRGNWGSPTDGIAPETEE----NVPEN  193

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EE
Sbjct  194  EKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEE  253

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGE  380
            RKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE
Sbjct  254  RKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGE  312

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                 G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  313  R--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  356



>ref|XP_004244706.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=340

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 142/177 (80%), Gaps = 8/177 (5%)
 Frame = -3

Query  898  ADGEY--PRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNT  728
            ADGE   PR+ ++RRSGTGRG+E IKREGSGRGNWG+  D+IAPE E P    V DG   
Sbjct  149  ADGEIERPRKVFDRRSGTGRGNEYIKREGSGRGNWGTTADDIAPETEVP----VVDGEKI  204

Query  727  DAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
               EKQ GQEDAGD  KDS   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV
Sbjct  205  VEAEKQTGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKV  264

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
             LDKE +SM LL+NKKNDDE+F+KLG+ ++DKKKEA EK KKT++INEFLKPAEGE+
Sbjct  265  NLDKELQSMQLLSNKKNDDEIFIKLGA-EKDKKKEAVEKAKKTQTINEFLKPAEGES  320



>gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=335

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 147/180 (82%), Gaps = 8/180 (4%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            +GE+ +GE PRR +ERRSGTGRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  N
Sbjct  145  DGESKEGERPRRVFERRSGTGRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETEN  200

Query  730  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEER  554
            T+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EER
Sbjct  201  TNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEER  259

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGE  380
            KV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEGE
Sbjct  260  KVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGE  319



>ref|XP_007039722.1| Hyaluronan / mRNA binding family [Theobroma cacao]
 gb|EOY24223.1| Hyaluronan / mRNA binding family [Theobroma cacao]
Length=358

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 162/224 (72%), Gaps = 8/224 (4%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            N E+ +GE PRR Y+RRSGTGRG+E KR+G+GRGNWG+ TDEIAPE E  +N V  +  N
Sbjct  142  NEESGEGERPRRQYDRRSGTGRGNEFKRDGAGRGNWGTSTDEIAPETE--VN-VPENEKN  198

Query  730  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
              A EKQ G+ED  DA K++  +EPE KEPE+KEMTL+EYEK+L+EKRKA+LA + EERK
Sbjct  199  VGA-EKQSGEEDVVDASKENAANEPEEKEPENKEMTLEEYEKILDEKRKALLALKTEERK  257

Query  550  VCLDKEFESMALLANKKNDDEVFVKLGSek-edkkkeagekvkktKSINEFLKPAEGETy  374
            V + KEFESM  L+NKK++D++F+KLGSEK + K  +  E+VKK+ SINEFLKPAEGE Y
Sbjct  258  VDV-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGERY  316

Query  373  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            Y PG          G  G      S+   P+IED GQFPTLG K
Sbjct  317  YGPGRGRGRGRGPRGGYGGIAG--SNVPAPAIEDRGQFPTLGGK  358



>ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Malus domestica]
Length=359

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 169/227 (74%), Gaps = 6/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ +GE PRR ++RRSGTGRGS+ KREGSGRGNWG+P+D+IAPE EEP        
Sbjct  137  YNNGEDGEGERPRRVFDRRSGTGRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEK--  194

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             N  A EKQ G+ +A DA K+  ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EE
Sbjct  195  -NVGA-EKQSGENEAADANKEDTVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEE  252

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEG
Sbjct  253  RKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEG  312

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+   GRGRGRG   G  G  G  +S+   PSI D GQFP+LG K
Sbjct  313  ERYHGGRGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  359



>gb|AAF14244.1|AF110228_1 nuclear RNA binding protein A [Spinacia oleracea]
Length=356

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 155/228 (68%), Gaps = 7/228 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
              NGE A+GE PRR YERRSGTGRG ++KREGSGRGNWG+P DEIA E EEP   V N+ 
Sbjct  132  FENGEAAEGERPRRTYERRSGTGRGGDVKREGSGRGNWGTPADEIAQETEEPA-VVENEA  190

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V   A EK  G+E A DA K++P  E E  EPE+K+MTL+EYEK+LEEKRKA+LA + EE
Sbjct  191  VV--AAEKPAGEEVA-DAGKENPEKEAEEVEPEEKQMTLEEYEKVLEEKRKALLALKAEE  247

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkkeagekvkktKSINEFLKPAEG  383
            RKV +DK+FESM L   KK DDEVF++L S  +K+ +  E  EK KK+ SINEFL+PAEG
Sbjct  248  RKVDVDKDFESMQLKTKKKVDDEVFIQLNSDKDKKKEAAEKEEKAKKSVSINEFLRPAEG  307

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLGSK  242
               Y+  G     G G   G  GG    +  T P IED  QFPTLG K
Sbjct  308  GDQYQRRGGRGRGGRGGRGGNGGGGYGMNHATAPKIEDPNQFPTLGGK  355



>ref|XP_008373667.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=365

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 168/229 (73%), Gaps = 13/229 (6%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            NGE+ +GE PRR ++R SGTGRGS+IKREGSGRGNWG+P+D+IAPE EEP       G  
Sbjct  144  NGEDGEGERPRRVFDRHSGTGRGSDIKREGSGRGNWGTPSDDIAPEIEEP-------GTE  196

Query  730  TD---AFEKQHGQEDAGDAKKDSPLd-epevkepedkEMTLDEYEKLLEEKRKAILASRP  563
            T+     EKQ G+ +A DA KDS ++   E +  E+KEMTL+EYEK+LEEKRKA+LA + 
Sbjct  197  TEKNFGAEKQSGENEAADANKDSTVNETEEKESEEEKEMTLEEYEKVLEEKRKALLALKT  256

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPA  389
            EERKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A ++   KK+ SIN+FLKPA
Sbjct  257  EERKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINQFLKPA  316

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EGE YY   GRGRGRG   G  G  G  +S+   PSIED GQFP+LG K
Sbjct  317  EGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIEDPGQFPSLGGK  365



>ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 151/227 (67%), Gaps = 9/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  D   PRRA+ER SGTGRG+E KREGSGRGNWG+  D+IA   EE    VVN+ 
Sbjct  149  FSNGETGDEGRPRRAFERHSGTGRGNEFKREGSGRGNWGTQNDDIAEVTEE----VVNET  204

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                A EK  G+EDA +  KDSP +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E 
Sbjct  205  EKVLADEKPVGEEDAAEGNKDSPANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEA  264

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEG  383
            RKV + KEF SM  L+NKK +DE+F+KLGS+K+ +K    ++ K  KS+N  EFLKPAEG
Sbjct  265  RKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLKPAEG  323

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E      G          RGGY GN  S+   PSIED G FP+LG K
Sbjct  324  ER--YYPGGRGRGRGRGSRGGYSGNAYSNAPAPSIEDPGHFPSLGGK  368



>gb|ABK94426.1| unknown [Populus trichocarpa]
Length=370

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 158/234 (68%), Gaps = 17/234 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +GE PRR Y+R SGTGRG+E+KREGSGRGNWG+P DEIAPE EEP    V D 
Sbjct  145  YSNGEAGEGERPRRQYDRHSGTGRGNELKREGSGRGNWGTPADEIAPETEEP----VVDN  200

Query  736  VNTDAFEKQHGQE-------DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              +   EKQ  +E       DA DA KD+ ++EPE KEPEDKEMTL+EYEK+LEEKRKA+
Sbjct  201  EKSVITEKQPEEEDAAAASKDAADASKDAAVNEPEEKEPEDKEMTLEEYEKVLEEKRKAL  260

Query  577  LASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINE  404
            L+ + EERKV LDK+ +SM  L++KK++DE+F+KLGSEK+ +K  A ++   KK  SINE
Sbjct  261  LSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINE  320

Query  403  FLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            FLKPA G+                   G  G NT   E PSIED GQFPTLG K
Sbjct  321  FLKPAGGD----RYYNPGRGRGRGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  370



>ref|XP_006368965.1| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|ERP65534.1| nuclear RNA-binding family protein [Populus trichocarpa]
Length=374

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 158/234 (68%), Gaps = 17/234 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +GE PRR Y+R SGTGRG+E+KREGSGRGNWG+P DEIAPE EEP    V D 
Sbjct  149  YSNGEAGEGERPRRQYDRHSGTGRGNELKREGSGRGNWGTPADEIAPETEEP----VVDN  204

Query  736  VNTDAFEKQHGQE-------DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              +   EKQ  +E       DA DA KD+ ++EPE KEPEDKEMTL+EYEK+LEEKRKA+
Sbjct  205  EKSVITEKQPEEEDAAAASKDAADASKDAAVNEPEEKEPEDKEMTLEEYEKVLEEKRKAL  264

Query  577  LASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINE  404
            L+ + EERKV LDK+ +SM  L++KK++DE+F+KLGSEK+ +K  A ++   KK  SINE
Sbjct  265  LSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINE  324

Query  403  FLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            FLKPA G+                   G  G NT   E PSIED GQFPTLG K
Sbjct  325  FLKPAGGD----RYYNPGRGRGRGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  374



>ref|XP_003552493.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=370

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 162/239 (68%), Gaps = 13/239 (5%)
 Frame = -3

Query  934  GDRRGGLSNGENADGE--YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEP  761
            G RRGG SNGE  +GE   PRRA++RRSGTGRG+E KREGSGRGNWG+ TDE+A   +E 
Sbjct  137  GGRRGGFSNGETGEGEDGRPRRAFDRRSGTGRGNEFKREGSGRGNWGTQTDELAQVTDE-  195

Query  760  INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKA  581
               VVN+       EK   +ED  D  KDSP +E E KEPEDKEMTL+EYEK+LEE+RKA
Sbjct  196  ---VVNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEEYEKVLEERRKA  252

Query  580  ILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSIN  407
              A + EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+     EK KK+ SI 
Sbjct  253  FQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEKSKKSVSIT  311

Query  406  EFLKPAEGET----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EFLKPAEGE         G     RG G G G Y G++T++   PSIED G FP LG+K
Sbjct  312  EFLKPAEGEAYYNPGRGRGRGRGSRGGGGGGGVYRGSSTNNAPAPSIEDPGHFPNLGAK  370



>emb|CDP21265.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 157/227 (69%), Gaps = 10/227 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            SNGE  DGE PRRA+ERRSGTGRG+EIKREG+GRGNWG+ +DE+A  AEE     VN+G 
Sbjct  145  SNGEVGDGERPRRAFERRSGTGRGNEIKREGAGRGNWGTESDEVAQAAEE-----VNEGE  199

Query  733  NTDAFEKQ-HGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                 EKQ  G+ED  D  K++P +E E KEPE+KEMTL+EYEK+LEEKRK +   + EE
Sbjct  200  KNPNAEKQPPGEEDTADGSKETPANESEEKEPENKEMTLEEYEKVLEEKRKTLQTLKTEE  259

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkkeagekvkktKSINEFLKPAEG  383
            RKV   K F SM  LANKK +++VF+KLGS  +K+ +  E  EK KK+ SINEFLKPAEG
Sbjct  260  RKVDA-KAFASMQQLANKKANEDVFIKLGSDKDKKKEANEKEEKAKKSLSINEFLKPAEG  318

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  +   G          RG  GGN+  + ETPSIED+  FP+LGSK
Sbjct  319  E-KFYNPGGRGRGRGRGSRGYGGGNSYGNVETPSIEDLVLFPSLGSK  364



>ref|XP_007218155.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
 gb|EMJ19354.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
Length=369

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 159/227 (70%), Gaps = 6/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
              NGE +DGE PRR +ERRSGTGRGSEIKREGSGRGNWGS TDE++   EE    V N  
Sbjct  147  FGNGEVSDGERPRRVFERRSGTGRGSEIKREGSGRGNWGSETDELSQVIEE----VANVT  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+ DA D  K++P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A +  E
Sbjct  203  ERNLGDEKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSE  262

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEG  383
             +    KEF S+  L+NKK +D++F+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEG
Sbjct  263  ERKVDTKEFASLQQLSNKKGNDDIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKPAEG  322

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E +Y PGGRGRGRG G   G     +  S   PSIED GQFPTLG+K
Sbjct  323  ERFYNPGGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGAK  369



>ref|XP_009343931.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=367

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 166/229 (72%), Gaps = 13/229 (6%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            NGE+ +GE PRR ++R SGTGRGS+IKREGSGRGNWG+P+D+IAPE EEP       G  
Sbjct  146  NGEDGEGERPRRVFDRHSGTGRGSDIKREGSGRGNWGTPSDDIAPEIEEP-------GTE  198

Query  730  TD---AFEKQHGQEDAGDAKKDSPLd-epevkepedkEMTLDEYEKLLEEKRKAILASRP  563
            T+     EKQ G+ +  DA KDS ++   E +  E+KEMTL+EYEK+LEEKRKA+LA + 
Sbjct  199  TEKNVGAEKQSGENETADANKDSTVNETEEKEPEEEKEMTLEEYEKVLEEKRKALLALKT  258

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPA  389
            EERKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A ++   KK+ SIN+FLKP 
Sbjct  259  EERKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINQFLKPT  318

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EGE YY   GRGRGRG   G  G  G  +S+   PSIED GQFP+LG K
Sbjct  319  EGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIEDPGQFPSLGGK  367



>gb|KHN40549.1| hypothetical protein glysoja_001047 [Glycine soja]
Length=363

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 163/241 (68%), Gaps = 15/241 (6%)
 Frame = -3

Query  934  GDRRGGLSNGENADGE--YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEP  761
            G RRGG SNGE  +GE   PRRA++RRSGTGRG+E KREGSGRGNWG+ TDE+A   +E 
Sbjct  128  GGRRGGFSNGETGEGEDGRPRRAFDRRSGTGRGNEFKREGSGRGNWGTQTDELAQVTDE-  186

Query  760  INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKA  581
               VVN+       EK   +ED  D  KDSP +E E KEPEDKEMTL+EYEK+LEE+RKA
Sbjct  187  ---VVNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEEYEKVLEERRKA  243

Query  580  ILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSIN  407
              A + EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+     EK KK+ SI 
Sbjct  244  FQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEKSKKSVSIT  302

Query  406  EFLKPAEGET------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  245
            EFLKPAEGE           G   RG G G G G Y G++T++   PSIED G FP LG+
Sbjct  303  EFLKPAEGEAYYNPGRGRGRGRGSRGGGGGGGGGVYRGSSTNNAPAPSIEDPGHFPNLGA  362

Query  244  K  242
            K
Sbjct  363  K  363



>ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Pyrus x bretschneideri]
Length=362

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 169/227 (74%), Gaps = 6/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ +GE PRR ++RRSGTGRGS+ KREGSGRGNWG+P+D+IAPE EEP        
Sbjct  140  YNNGEDGEGERPRRVFDRRSGTGRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEK--  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             N  A EKQ G+ +A DA K+  ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EE
Sbjct  198  -NVSA-EKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEE  255

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEG
Sbjct  256  RKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEG  315

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E YY   GRGRGRG   G  G  G  +S+   PSI D GQFP+LG K
Sbjct  316  ERYYGGRGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  362



>ref|XP_008232490.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Prunus mume]
Length=369

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 157/227 (69%), Gaps = 6/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
              NGE  DGE PRR +ERRSGTGRGSEIKREGSGRGNWGS TDE++   EE    V N  
Sbjct  147  FGNGEVGDGERPRRVFERRSGTGRGSEIKREGSGRGNWGSETDELSQVTEE----VANVT  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+ DA D  K++P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A +  E
Sbjct  203  ERNLGDEKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSE  262

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEG  383
             +    KEF S+  L+NKK +D++F+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEG
Sbjct  263  ERKVDTKEFASLQQLSNKKGNDDIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKPAEG  322

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E +Y PGGRGRGRG G   G     +  S   PSIED GQFPTLG K
Sbjct  323  ERFYNPGGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGGK  369



>ref|XP_011093236.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Sesamum indicum]
Length=376

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 163/221 (74%), Gaps = 8/221 (4%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            D E PRR ++RRSGTG+G+EIKREG+GRGNWG+ TDE+A EAE  + G    G+N    E
Sbjct  161  DRERPRRVFDRRSGTGQGNEIKREGAGRGNWGTQTDELAQEAEG-VGGEAEKGLNA---E  216

Query  715  KQHGQED-AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
            K  G+ED A D   ++  +E   KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV + 
Sbjct  217  KPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLEEYEKVLEEKRKALQALKTEERKVDV-  275

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrp  365
            KEFES+  L+NKK +D+VF+KLGSEK+ K+   E  E+ KK  SINEFLKPAEGE YY P
Sbjct  276  KEFESLKPLSNKKTNDDVFIKLGSEKDKKRELAEKEERAKKAVSINEFLKPAEGERYYNP  335

Query  364  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            GGRGRGRG GS  G  GGN  S+ + PSIED GQFPTLG K
Sbjct  336  GGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQFPTLGGK  376



>gb|KHG27284.1| hypothetical protein F383_11722 [Gossypium arboreum]
Length=354

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 153/222 (69%), Gaps = 9/222 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            ++ +GE PRR Y+R SGTGRG+E KR+GSGRGNWGS TDEIAPE E              
Sbjct  141  DSGEGERPRRQYDRHSGTGRGNEFKRDGSGRGNWGSSTDEIAPETE-----ENVTENEKK  195

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK+LEEKRKA+ A + E RKV 
Sbjct  196  STEKQFGEEDAADANKENAANETEEKEPENKEMTLEEYEKILEEKRKALAALKTEGRKVD  255

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyr  368
            + KEFESM  L+NKK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE    
Sbjct  256  V-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEEKVKKSVSINEFLKPAEGER--Y  312

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
             G           RGGYGGN  S+ + PSI D G FP+LG K
Sbjct  313  YGPGRGRGRSRGPRGGYGGNTASNVQAPSIADPGHFPSLGGK  354



>ref|XP_008238397.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Prunus mume]
Length=360

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 166/223 (74%), Gaps = 7/223 (3%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            ++A+GE PRR ++RRSGTG GSE KR+G+GRGNWG+PTD+IA E EEP   +     N  
Sbjct  143  DDAEGERPRRVFDRRSGTGHGSEFKRDGAGRGNWGTPTDDIAQETEEPGTEIEK---NVG  199

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            A EKQ G+ +A DA K++ ++E E KE E+KEMTL+EYEK+LEEKRKA+LA + EERKV 
Sbjct  200  A-EKQLGENEAADANKENTVNESEEKELEEKEMTLEEYEKVLEEKRKALLALKTEERKVD  258

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEGETyy  371
            LDK+ +SM  L+NKK ++++F+KLGSEK+ +K+ A ++   KK+ SINEFLKPAEGE YY
Sbjct  259  LDKDLKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYY  318

Query  370  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
               GRGRGRG   G GG  G  + S   PSIED GQFPTLG K
Sbjct  319  GGRGRGRGRGPRGGYGGGPGGYSGSA-APSIEDPGQFPTLGGK  360



>gb|KJB25493.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=354

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 149/219 (68%), Gaps = 9/219 (4%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            +GE PRR Y+R SGTGRG+E KR+GSGRGNWGS TDEIAPE E              + E
Sbjct  144  EGERPRRQYDRHSGTGRGNEFKRDGSGRGNWGSSTDEIAPETE-----ENVTENEKKSTE  198

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            KQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK+LEEKRKA+ A + E RKV + K
Sbjct  199  KQFGEEDAADANKENAANEAEEKEPENKEMTLEEYEKILEEKRKALDALKTEGRKVDV-K  257

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpgg  359
            EFESM  L+NKK++D++F+KLGSEK+ +K    E+  K   SINEFLKPAEGE     G 
Sbjct  258  EFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEEKAKKSVSINEFLKPAEGER--YYGP  315

Query  358  rgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                      RGGYGGN  S+ + PSI D G FP+LG K
Sbjct  316  GRGRGRGRGPRGGYGGNTASNVQAPSIADPGHFPSLGGK  354



>ref|XP_006837401.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Amborella trichopoda]
 gb|ERN00255.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
Length=362

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 162/230 (70%), Gaps = 9/230 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIA-PEAEEPINGVVND  740
             +NGEN D + PRR +ERRSGTGRG+E KR+G+GRGNWG+P DE A  E+EE    VV +
Sbjct  137  FNNGENGDLDRPRRQFERRSGTGRGNEFKRDGAGRGNWGAPIDEGAVQESEE----VVGE  192

Query  739  GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
                 + EK   +E+     KD+ ++EPE KEPE+KEMTL EYEK+LEEKRKA+ A + E
Sbjct  193  NGKVTSPEKPSEEENNAAVNKDNAVNEPEQKEPENKEMTLSEYEKVLEEKRKALQALKNE  252

Query  559  ERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv----kktKSINEFLKP  392
            ERKV LDK+FESM  L++KK +D+VF+KLGSEK+  +++   +     KK+ SINEFLKP
Sbjct  253  ERKVNLDKDFESMLQLSDKKANDDVFIKLGSEKDAARRKEIAEKEERIKKSVSINEFLKP  312

Query  391  AEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
             +G  YY P GRGRG+G G   GG   N+T+S   PSIED  QFPTL +K
Sbjct  313  VDGGRYYSPRGRGRGQGRGGFGGGISSNSTNSIAAPSIEDQNQFPTLAAK  362



>ref|XP_004300342.1| PREDICTED: intracellular hyaluronan-binding protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=385

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 159/230 (69%), Gaps = 14/230 (6%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E+A+GE PRR ++RRSGTGRGS+ KR+G+GRGNWG+PTDEIA E  EP   V  D    D
Sbjct  161  EDAEGERPRRTFDRRSGTGRGSDFKRDGAGRGNWGTPTDEIASEV-EPGTEVEKD---VD  216

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            A EK  G+ +A DA K++  DEP+ KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV 
Sbjct  217  A-EKPLGENEAADANKENAEDEPKEKEPEEKEMTLEEYEKVLEEKRKALAALKTEERKVD  275

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyy  371
            LDKE +SM  L++KK +DE+F+KLGSEK+ +K+ A ++ +  K  SINEFLKPAEGE+  
Sbjct  276  LDKELKSMQQLSSKKTNDEIFIKLGSEKDKRKEAAEKEERAKKVVSINEFLKPAEGESQR  335

Query  370  r-------pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                     GGRG   G+     G   +N ++   PSI D   FP+LG K
Sbjct  336  HYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPSIADTALFPSLGGK  385



>ref|XP_008347095.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=236

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 155/229 (68%), Gaps = 7/229 (3%)
 Frame = -3

Query  922  GGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
            GG  NGE  DGE  RR YERRSGTGRGSE+KREGSGRGNWG+  DE++   EE    V N
Sbjct  13   GGFGNGEVGDGER-RRVYERRSGTGRGSEVKREGSGRGNWGAQADELSEVTEE----VAN  67

Query  742  DGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRP  563
                    EK   + DA D  KD+P  EP  KEPEDKEMTL+EYEK+LEEKRKA+ A + 
Sbjct  68   VTEKNLGDEKLVEEGDAADGNKDTPAKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKT  127

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAE  386
             E +    KEFES   L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAE
Sbjct  128  TEERKVDAKEFESFQQLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAE  187

Query  385  GETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  242
            GE  Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  188  GERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  236



>ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Pyrus x bretschneideri]
Length=359

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 168/227 (74%), Gaps = 9/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ +GE PRR ++RRSGTGRGS+ KREGSGRGNWG+P+D+IAPE EEP        
Sbjct  140  YNNGEDGEGERPRRVFDRRSGTGRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEK--  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             N  A EKQ G+ +A DA K+  ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EE
Sbjct  198  -NVSA-EKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEE  255

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +DK+ ++M LL+NKK +DE+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEG
Sbjct  256  RKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEG  315

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E YY   GRGRGRG   G  G  G N +    PSI D GQFP+LG K
Sbjct  316  ERYYGGRGRGRGRGPRGGYSGGPGGNAA---PPSIGDPGQFPSLGGK  359



>ref|XP_011047584.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=364

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 154/234 (66%), Gaps = 17/234 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +GE PRR Y+R SGTGRG+EIKREGSGRGNWG+  DEIAPE EEP    V D 
Sbjct  139  YSNGEAGEGERPRRQYDRHSGTGRGNEIKREGSGRGNWGTHADEIAPETEEP----VVDN  194

Query  736  VNTDAFEKQ-------HGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              +   EKQ          +DA DA KD+   EPEVKEPEDKEMTL+EYEK+LEEKRKA+
Sbjct  195  EKSFIAEKQPEEEEAAAASKDAADASKDAAAKEPEVKEPEDKEMTLEEYEKVLEEKRKAL  254

Query  577  LASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINE  404
            L+ + EERKV LDK+ +SM  L++KK++ E+F+KLGSEK+ +K  A ++   KK  SINE
Sbjct  255  LSLKAEERKVGLDKDLQSMQQLSSKKSNAEIFIKLGSEKDKRKDAADKEDRAKKAVSINE  314

Query  403  FLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            FLKPA G+                   G  G NT   E PSIED GQFPTLG K
Sbjct  315  FLKPAGGD----RHYNPGRGRGRGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  364



>gb|KJB25494.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=353

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 145/222 (65%), Gaps = 10/222 (5%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            ++ +GE PRR Y+R SGTGRG+E KR+GSGRGNWGS TDEIAPE E              
Sbjct  141  DSGEGERPRRQYDRHSGTGRGNEFKRDGSGRGNWGSSTDEIAPETE-----ENVTENEKK  195

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            + EKQ G+EDA DA K++       ++  + +MTL+EYEK+LEEKRKA+ A + E RKV 
Sbjct  196  STEKQFGEEDAADANKEN-AANEAEEKEPENKMTLEEYEKILEEKRKALDALKTEGRKVD  254

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyr  368
            + KEFESM  L+NKK++D++F+KLGSEK+ +K    E+  K   SINEFLKPAEGE    
Sbjct  255  V-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEEKAKKSVSINEFLKPAEGER--Y  311

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
             G           RGGYGGN  S+ + PSI D G FP+LG K
Sbjct  312  YGPGRGRGRGRGPRGGYGGNTASNVQAPSIADPGHFPSLGGK  353



>dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 153/233 (66%), Gaps = 7/233 (3%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RRGG SNGE  +   PRR +ER SGTGRG+E KREG+GRGNWG+ TDEIA   EE   
Sbjct  144  GGRRGGFSNGEAGEEGRPRRTFERHSGTGRGNEFKREGAGRGNWGTETDEIAQVTEE---  200

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
              V +G      EK   + DA +  KDS  +E E KE EDKEMTL+EY+K+LEEKRKA+ 
Sbjct  201  -AVIEGEKNIGDEKPAVENDAAEGNKDSAANEAEEKEAEDKEMTLEEYQKVLEEKRKALQ  259

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEF  401
              + EERKV   KEFE+M  L+ KK++ E+F KLGS+K+ +K+     EK KK+ SINEF
Sbjct  260  VVKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEF  318

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            LKPAEG+ Y+R  G       G G G  GGN   +   PSIED G FPTLG+K
Sbjct  319  LKPAEGDAYHRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGHFPTLGAK  371



>ref|XP_007134461.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
 gb|ESW06455.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
Length=359

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 160/231 (69%), Gaps = 11/231 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +   PRRA+ER SGTGRG+++KR+G+GRGNWG+ +D+IA   EE    V ++ 
Sbjct  134  FSNGEVGEDGRPRRAFERHSGTGRGNDLKRDGAGRGNWGTQSDDIAQVTEE----VGDET  189

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+E A D  KDSP +E E KEPE+KEMTL+EYEK+LEE+RKA+ A + E 
Sbjct  190  EKNFGDEKPVGEESAADGNKDSPANENEEKEPEEKEMTLEEYEKVLEERRKALQALKTET  249

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEG  383
            RKV + KEF SM  L+NKK++DE+F+KLGS+K+ +K    ++ +  KS+N  EFLKPAEG
Sbjct  250  RKVDI-KEFASMQPLSNKKDNDEIFIKLGSDKDKRKDALEKEERSKKSVNITEFLKPAEG  308

Query  382  E----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E    T  R  GRGRG G G G GGY GN  S+   PSIED GQFPTLG K
Sbjct  309  ERYYNTSGRGRGRGRGGGRGGGGGGYSGNAGSNVSAPSIEDPGQFPTLGGK  359



>dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 153/233 (66%), Gaps = 7/233 (3%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RRGG SNGE  +   PRR +ER SGTGRG+E KREG+GRGNWG+ TDEIA   EE   
Sbjct  144  GGRRGGFSNGEAGEEGRPRRTFERHSGTGRGNEFKREGAGRGNWGTETDEIAQVTEE---  200

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
              V +G      EK   + DA +  KDS  +E E KE EDKEMTL+EY+K+LEEKRKA+ 
Sbjct  201  -AVIEGEKNIGDEKPAVENDAAEGNKDSAANEAEEKEAEDKEMTLEEYQKVLEEKRKALQ  259

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEF  401
              + EERKV   KEFE+M  L+ KK++ E+F KLGS+K+ +K+     EK KK+ SINEF
Sbjct  260  VVKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEF  318

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            LKPAEG+ YYR  G       G G G  GGN   +   PSIED G FPTLG+K
Sbjct  319  LKPAEGDAYYRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGHFPTLGAK  371



>ref|NP_001241515.1| uncharacterized protein LOC100807657 [Glycine max]
 gb|ACU21122.1| unknown [Glycine max]
Length=367

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 155/229 (68%), Gaps = 9/229 (4%)
 Frame = -3

Query  916  LSNGENADGE--YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
             SNGE  + E   PRRA++RRSGTGRG+E KREGSGRGNWG+ TDE+A   +E    V N
Sbjct  144  FSNGETGEAEEGRPRRAFDRRSGTGRGNEFKREGSGRGNWGAQTDELAQVTDE----VAN  199

Query  742  DGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRP  563
            +       EK   +ED  D  KDSP +E E KEPEDKEMTL+EYEK+LEE+RKA  A + 
Sbjct  200  ETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEEYEKVLEERRKAFQALKT  259

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPA  389
            EERKV   KEFESM  L++KK++ ++F+KLGS+K+ +K+     EK KK+ SI EFLKPA
Sbjct  260  EERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLKPA  318

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EGE YY PG          G GGY G+ T++   PSIED G FPTL +K
Sbjct  319  EGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIEDPGHFPTLSAK  367



>ref|XP_009613636.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=350

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 150/218 (69%), Gaps = 27/218 (12%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            +GE PRR ++RRSGTGRG                      E E P    VNDG      E
Sbjct  160  EGERPRRVFDRRSGTGRG----------------------ETEVP----VNDGEKIVEAE  193

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            K+ GQE+A D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LDK
Sbjct  194  KEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLDK  253

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggr  356
            E ESM LL+NKKNDDE+F+KLGS +++K+KEA EK +KT+SINEFLKPAEGE Y R GGR
Sbjct  254  ELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTQSINEFLKPAEGENYSRRGGR  312

Query  355  grgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            GRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  313  GRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  350



>ref|XP_008238398.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Prunus mume]
Length=359

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 165/223 (74%), Gaps = 8/223 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            ++A+GE PRR ++RRSGTG G E KR+G+GRGNWG+PTD+IA E EEP   +     N  
Sbjct  143  DDAEGERPRRVFDRRSGTGHG-EFKRDGAGRGNWGTPTDDIAQETEEPGTEIEK---NVG  198

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            A EKQ G+ +A DA K++ ++E E KE E+KEMTL+EYEK+LEEKRKA+LA + EERKV 
Sbjct  199  A-EKQLGENEAADANKENTVNESEEKELEEKEMTLEEYEKVLEEKRKALLALKTEERKVD  257

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEGETyy  371
            LDK+ +SM  L+NKK ++++F+KLGSEK+ +K+ A ++   KK+ SINEFLKPAEGE YY
Sbjct  258  LDKDLKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYY  317

Query  370  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
               GRGRGRG   G GG  G  + S   PSIED GQFPTLG K
Sbjct  318  GGRGRGRGRGPRGGYGGGPGGYSGSA-APSIEDPGQFPTLGGK  359



>ref|XP_011017364.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
 ref|XP_011017365.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=359

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 156/224 (70%), Gaps = 8/224 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            +NGE+ +GE PRR YERRSGTGRG+E+KREG+GRGNWG+ TDE+A   EE    V N+G 
Sbjct  144  ANGEDGEGERPRRIYERRSGTGRGNEMKREGAGRGNWGTQTDELAEITEE----VGNEGD  199

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 EK    E A D  K++  +EP  KEPE+KEMTL+EYEK+LEEKRKA+LA + EER
Sbjct  200  KNLGDEKPV-TEAAADGNKENLDNEPGEKEPEEKEMTLEEYEKVLEEKRKALLALKTEER  258

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETy  374
            KV   KEF+SM  +++KK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  
Sbjct  259  KVDA-KEFQSMQQISSKKENNDVFIKLGS-DKDKRKEASEKAKKSVSINEFLKPAEGE-R  315

Query  373  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            Y+  G          RG    +  S+   PSIED GQFPTLG K
Sbjct  316  YQGSGGRGRGRGRGARGFGNRDGISNVPAPSIEDPGQFPTLGGK  359



>ref|XP_008459799.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=361

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 154/227 (68%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GENA+GE PRRA+ER SGTGRG+E KREGSGRGNWG  TDE A  AEE     VN+ 
Sbjct  141  FNDGENAEGERPRRAFERHSGTGRGNEFKREGSGRGNWGRSTDEFAEVAEE----TVNET  196

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   + D   A  D P  EPE  EPEDKEMTL+EYEKLLE+KRK++LA + EE
Sbjct  197  EKNVGDEKPIQENDTSGANTDDPAKEPEETEPEDKEMTLEEYEKLLEDKRKSLLALKTEE  256

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEG  383
            RKV   KEF SM  L++KK+++++F+KLGSEK+ +K   +  E+ KK+ SINEFL+PAEG
Sbjct  257  RKVD-PKEFASMQQLSSKKDNNDIFIKLGSEKDKRKEIADKEERTKKSLSINEFLRPAEG  315

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  +   G          RGGY G++ S+   PSIED GQFP LG+K
Sbjct  316  E-RHYTPGGRGRGRGRGSRGGYSGSSMSNVAAPSIEDPGQFPILGAK  361



>ref|XP_011626785.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X1 [Amborella trichopoda]
Length=389

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 161/228 (71%), Gaps = 13/228 (6%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAF  719
            D E PRR +ERRSGTGRG+E KREG+GRGNWG+PTD+  A +  E    V N        
Sbjct  165  DSERPRRQFERRSGTGRGNETKREGAGRGNWGTPTDDGFAVQESE---AVANVEEKNPTP  221

Query  718  EKQHGQEDAGDA--KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            EKQ  QED  DA  +K++ ++EPE KEPEDKEMTL+EYEK+ EEKRKA+LA +PEERKV 
Sbjct  222  EKQPEQEDGVDAGKEKENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKPEERKVD  281

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGET  377
            +DKEF+SM  L+ KK +D++F+KLGS+K+  +++   +     KK+ SINEFLKPAEGE 
Sbjct  282  VDKEFKSMQQLSLKKGNDDIFIKLGSDKDSNRRKDSAEKDERVKKSLSINEFLKPAEGEK  341

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFET---PSIEDVGQFPTLGSK  242
            YY PGGRGRGRG G   G  GG   SS      PSIED GQFPTLG K
Sbjct  342  YYSPGGRGRGRGRGDRGGYRGGYTGSSANVALAPSIEDPGQFPTLGGK  389



>gb|KCW77830.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=370

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 157/231 (68%), Gaps = 10/231 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +N E  +GE PRRA++RRSGTGRG+E KR+G+GRGNWG+PTDEIAPE EE     V + 
Sbjct  144  YNNEEAGEGERPRRAFDRRSGTGRGNETKRDGAGRGNWGAPTDEIAPETEE----PVTEV  199

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
              T   EKQ   ED  DA K+ PL+EPE KEPEDKEMTL+EYEK+ EE RK++LA + EE
Sbjct  200  EKTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEE  259

Query  556  RKVCLDKEFESMALLANKKND-DEVFVKLGSekedkkkeagek--vkktKSINEFLKPAE  386
            RKV LDK+ +SM  L+NKK D +++F+KLGSEK+ +K+ A ++   KK+ SINEFLKPAE
Sbjct  260  RKVELDKDLKSMQQLSNKKKDNNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAE  319

Query  385  GE---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            GE        G        G   GG GG        PSIED GQFP+LG K
Sbjct  320  GERYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  370



>ref|XP_011032359.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Populus euphratica]
Length=360

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 153/224 (68%), Gaps = 10/224 (4%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN-GVVNDGV  734
            N E  +GE PRR YE  SGTGRG+E+KREGSGRGNWG+PTDE+A   EE  N G  N G 
Sbjct  146  NEEVGEGERPRRNYEHWSGTGRGNEMKREGSGRGNWGTPTDELALVTEEAANEGEKNWG-  204

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 + +  ++ A D KK++P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EER
Sbjct  205  -----DDKPVEDAAADGKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEER  259

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETy  374
            KV   KEF+SM  L+NKK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  
Sbjct  260  KVDA-KEFQSMQQLSNKKENNDVFIKLGS-DKDKRKEAYEKAKKSVSINEFLKPAEGE-R  316

Query  373  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            Y   G          RG    +  SS   PSIED GQFPTLG K
Sbjct  317  YYGAGSRSRGRGRGARGFGNRDGMSSVPAPSIEDPGQFPTLGGK  360



>ref|XP_003529036.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 148/227 (65%), Gaps = 9/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE  +   PRRA+E  SGTGRG+E KR+GSGRGNWG+  D+IA   EE    VV + 
Sbjct  149  FTNGEVGEEGRPRRAFEHHSGTGRGNEFKRDGSGRGNWGTQNDDIAVVTEE----VVYET  204

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                A EK  G+EDA +  KD P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E 
Sbjct  205  EKNFADEKPAGEEDAPEGNKDCPANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEV  264

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEG  383
            RKV + KEF SM  L+NKK +DE+F+KLGS+K+ +K    ++ K  KS+N  EFLKPAEG
Sbjct  265  RKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLKPAEG  323

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E      G          RGGY GN  S+   PSIED GQFPTL  K
Sbjct  324  ER--YYSGGRGRGRGRGSRGGYSGNAYSNVPAPSIEDPGQFPTLSGK  368



>ref|XP_011465242.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=384

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 158/230 (69%), Gaps = 15/230 (7%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E+A+GE PRR ++RRSGTGRG + KR+G+GRGNWG+PTDEIA E E P   V  D    D
Sbjct  161  EDAEGERPRRTFDRRSGTGRG-DFKRDGAGRGNWGTPTDEIASEVE-PGTEVEKD---VD  215

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            A EK  G+ +A DA K++  DEP+ KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV 
Sbjct  216  A-EKPLGENEAADANKENAEDEPKEKEPEEKEMTLEEYEKVLEEKRKALAALKTEERKVD  274

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyy  371
            LDKE +SM  L++KK +DE+F+KLGSEK+ +K+ A ++ +  K  SINEFLKPAEGE+  
Sbjct  275  LDKELKSMQQLSSKKTNDEIFIKLGSEKDKRKEAAEKEERAKKVVSINEFLKPAEGESQR  334

Query  370  r-------pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                     GGRG   G+     G   +N ++   PSI D   FP+LG K
Sbjct  335  HYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPSIADTALFPSLGGK  384



>gb|ERN15257.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
Length=403

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 160/226 (71%), Gaps = 13/226 (6%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAF  719
            D E PRR +ERRSGTGRG+E KREG+GRGNWG+PTD+  A +  E    V N        
Sbjct  165  DSERPRRQFERRSGTGRGNETKREGAGRGNWGTPTDDGFAVQESE---AVANVEEKNPTP  221

Query  718  EKQHGQEDAGDA--KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            EKQ  QED  DA  +K++ ++EPE KEPEDKEMTL+EYEK+ EEKRKA+LA +PEERKV 
Sbjct  222  EKQPEQEDGVDAGKEKENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKPEERKVD  281

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGET  377
            +DKEF+SM  L+ KK +D++F+KLGS+K+  +++   +     KK+ SINEFLKPAEGE 
Sbjct  282  VDKEFKSMQQLSLKKGNDDIFIKLGSDKDSNRRKDSAEKDERVKKSLSINEFLKPAEGEK  341

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFET---PSIEDVGQFPTLG  248
            YY PGGRGRGRG G   G  GG   SS      PSIED GQFPTLG
Sbjct  342  YYSPGGRGRGRGRGDRGGYRGGYTGSSANVALAPSIEDPGQFPTLG  387



>gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=369

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 161/230 (70%), Gaps = 9/230 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +N E  +GE PRRA++RRSGTGRG+E KR+G+GRGNWG+PTDEIAPE EEP+  V  + 
Sbjct  144  YNNEEAGEGERPRRAFDRRSGTGRGNEFKRDGAGRGNWGTPTDEIAPEPEEPVVEVEKN-  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V +   EKQ   E+A DA K++PL+EPE KEPEDKEMTL+EYEK+ EEKRKA+L  + EE
Sbjct  203  VGS---EKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEE  259

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEG  383
            RKV +DKE +SM  L++KK + ++F+KLGSEK+ +K+ A ++   KK+ SINEFLKPAEG
Sbjct  260  RKVEVDKELKSMQQLSSKKENHDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEG  319

Query  382  E---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E        G        G   GG GG        PSIED GQFP+LG K
Sbjct  320  ERYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  369



>ref|XP_011081282.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Sesamum indicum]
Length=343

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 146/225 (65%), Gaps = 30/225 (13%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE A+G+ PRRA++RRSGTGRG                      E EEP     N+G
Sbjct  149  YNNGEAAEGDRPRRAFDRRSGTGRG----------------------ETEEP----TNEG  182

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G++D  DA KDS  +E E KEPE+KEMTL+EYEK+LEEKRKA+LA + EE
Sbjct  183  VKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKSEE  242

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKKNDDEVF+KLGS  +DK+KEA EK KK+ SINEFLKPAEG+ 
Sbjct  243  RKVGLDKELESMQLLSNKKNDDEVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPAEGD-  300

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              +    G          G  G N  + E P+IEDVGQFP+L +K
Sbjct  301  --KYYRAGGRGRGRGRGRGGFGGNNYNVEAPAIEDVGQFPSLVAK  343



>gb|KFK31390.1| hypothetical protein AALP_AA6G105700 [Arabis alpina]
Length=353

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/230 (49%), Positives = 148/230 (64%), Gaps = 16/230 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ D + PRR +ERRSGTGRG+++KREG GRGNWG+  D+I P  EEP+  V    
Sbjct  132  FANGESGDVDRPRRHFERRSGTGRGNDLKREGGGRGNWGTTEDDIPPATEEPMTEVEKSP  191

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G+++  DAKK++P      +E E+K+MTL+EYEK+ EEK+KA+  ++ EE
Sbjct  192  VTA---EKQEGEDETTDAKKETP-----AEEEEEKQMTLEEYEKIQEEKKKAMQGAKVEE  243

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV   K FESM  L+NKK+++E+F+KLGSEK     E  EK +K+ SINEFLKPA+GE+
Sbjct  244  RKVDT-KVFESMQQLSNKKSNEEIFIKLGSEKRKDATEKEEKARKSLSINEFLKPADGES  302

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFE-------TPSIEDVGQFPTLG  248
            Y   GG     G   GRGG      +           P+I D  QFPTLG
Sbjct  303  YNPRGGYRGRGGGRGGRGGQRDGRGNGGGNQRFGGAAPAIGDNAQFPTLG  352



>ref|XP_009776248.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=363

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 147/229 (64%), Gaps = 11/229 (5%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            SN E  +G+ PRR +ERRSGTGRG EIKREG+GRGNWG+  DE+    +E    V N+G 
Sbjct  141  SNEEFPEGDRPRRIFERRSGTGRGGEIKREGAGRGNWGTQADEVTQITDE----VANEGE  196

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 EK     +AGD KK++P  E E KEPE+KEMTL+EYEK+LEEKR+A+ A + EER
Sbjct  197  KNLNVEKPSADGEAGDDKKENPAAEAEDKEPENKEMTLEEYEKVLEEKRQALQALKTEER  256

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSe-kedkkkeagekvkktKSINEFLKPAEGE-  380
            KV + KEFESM  L+ K +DD +F+KLG + K  +  E  EK KK  SINEFLKPAEGE 
Sbjct  257  KVDI-KEFESMQQLSKKSSDD-IFIKLGPKDKRRESAEKEEKAKKAVSINEFLKPAEGER  314

Query  379  ---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                  R  G       G G G  G N TS+ E P IED G FPTLG K
Sbjct  315  YYAPGGRGRGGRGRGSRGYGGGYGGANTTSNVEAPLIEDPGHFPTLGGK  363



>ref|XP_008375773.1| PREDICTED: LOW QUALITY PROTEIN: plasminogen activator inhibitor 
1 RNA-binding protein-like [Malus domestica]
Length=373

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 153/227 (67%), Gaps = 7/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
              NGE  DGE  RR YERRSGTGRGSE+KREGSGRGNWG+  DE++   EE    V N  
Sbjct  152  FGNGEVGDGER-RRVYERRSGTGRGSEVKREGSGRGNWGAQADELSEVTEE----VANVT  206

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   + DA D  KD+P  EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E
Sbjct  207  EKNLGDEKLVEEGDAADGNKDTPXKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTE  266

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGE  380
             +    KEFES   L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE
Sbjct  267  ERKVDAKEFESFQQLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGE  326

Query  379  TyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  242
              Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  327  RSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  373



>gb|KJB24892.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=333

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 116/150 (77%), Gaps = 6/150 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE+ADGE PRR YERRSGTGRG+E+KREGSGRGNWG+ TDE+A      +  V N+G
Sbjct  142  FSNGEDADGEQPRRLYERRSGTGRGNELKREGSGRGNWGTQTDELA-----QVTEVTNEG  196

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+EDA +A K+S  +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EE
Sbjct  197  ERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEE  256

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGS  467
            RKV   KEFESM  L+NKKN+DEVF+KLGS
Sbjct  257  RKVDA-KEFESMQQLSNKKNNDEVFIKLGS  285



>ref|XP_006375155.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 ref|XP_006375156.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52952.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52953.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
Length=373

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 160/235 (68%), Gaps = 19/235 (8%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN-GVVNDGV  734
            N E  +GE PRR  ER SGTGRG+E+KREGSGRGNWG+PTDE+A   EE  N G  N G 
Sbjct  146  NEEVGEGERPRRTNERWSGTGRGNEMKREGSGRGNWGTPTDELALVTEEAANEGEKNLG-  204

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 + +  +E A D KK++P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EER
Sbjct  205  -----DDKPVEEAAADRKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEER  259

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGE  380
            KV   KEF+SM  L+NKK +++VF+KLGS+K+ +K+     EK KK+ SINEFLKPAEGE
Sbjct  260  KVDT-KEFQSMQQLSNKKENNDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKPAEGE  318

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSF---------ETPSIEDVGQFPTLGSK  242
             YY  G RGRGRG G+   G     +S F           PSIED GQFPTLG K
Sbjct  319  RYYGSGSRGRGRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>ref|XP_002301233.2| transcription factor family protein [Populus trichocarpa]
 gb|ABK94212.1| unknown [Populus trichocarpa]
 gb|EEE80506.2| transcription factor family protein [Populus trichocarpa]
Length=359

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 154/224 (69%), Gaps = 8/224 (4%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            +NGE+ +GE PRR YERRSGTG G+E+KREG+GRGNWG+ TDE+A   EE    V N+G 
Sbjct  144  ANGEDGEGERPRRIYERRSGTGHGNEMKREGAGRGNWGTQTDELAEITEE----VGNEGD  199

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 EK    E A D  K++  +EP  KEPE+KEMTL+EYEK+LEEKRKA+LA + EER
Sbjct  200  KNLGDEKPV-TEAAADGNKENLDNEPGEKEPEEKEMTLEEYEKVLEEKRKALLALKTEER  258

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETy  374
            KV   +EF+SM  +++KK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  
Sbjct  259  KVDT-REFQSMQQISSKKENNDVFIKLGS-DKDKRKEASEKAKKSVSINEFLKPAEGE-R  315

Query  373  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            Y   G          RG    +  S+   PSIED GQFPTLG K
Sbjct  316  YHGSGGRGRGRGRGARGFGNRDGISNVPAPSIEDPGQFPTLGGK  359



>gb|ABK94354.1| unknown [Populus trichocarpa]
Length=373

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 160/235 (68%), Gaps = 19/235 (8%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN-GVVNDGV  734
            N E  +GE PRR  ER SGTGRG+E+KREGSGRGNWG+PTDE+A   EE  N G  N G 
Sbjct  146  NEEVGEGERPRRTNERWSGTGRGNEMKREGSGRGNWGTPTDELALVTEEAANEGEKNLG-  204

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 + +  +E A D KK++P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EER
Sbjct  205  -----DDKPVEEAAADRKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEER  259

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGE  380
            KV   KEF+SM  L+NKK +++VF+KLGS+K+ +K+     EK KK+ SINEFLKPAEGE
Sbjct  260  KVDT-KEFQSMQQLSNKKENNDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKPAEGE  318

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSF---------ETPSIEDVGQFPTLGSK  242
             YY  G RGRGRG G+   G     +S F           PSIED GQFPTLG K
Sbjct  319  RYYGSGSRGRGRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>ref|XP_010053521.1| PREDICTED: vasodilator-stimulated phosphoprotein-like [Eucalyptus 
grandis]
Length=368

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 158/226 (70%), Gaps = 9/226 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  +GE PRR +ERRSGTGRG+E KR+G+GRGNWG+PTDEIAPE EEP+  V  + V + 
Sbjct  147  EAGEGERPRRTFERRSGTGRGNEFKRDGAGRGNWGTPTDEIAPEPEEPVVEVEKN-VGS-  204

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
              EKQ   E+A DA K++PL+EPE KEPEDKEMTL+EYEK+ EEKRKA+L  + EERKV 
Sbjct  205  --EKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVE  262

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEGE---  380
            +DKE +SM  L++KK + ++F+KLGSEK+ +K+ A ++   KK+ SINEFLKPAEGE   
Sbjct  263  VDKELKSMQQLSSKKENHDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYY  322

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                 G        G   GG GG        PSIED GQFP+LG K
Sbjct  323  NPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  368



>ref|XP_008465866.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=358

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 161/234 (69%), Gaps = 9/234 (4%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RRGG SNGE  +GE PRR YERRSGTGRG+E KR+G+GR NWG+P DE AP+ EEP  
Sbjct  131  GPRRGGFSNGEAEEGERPRRVYERRSGTGRGNEFKRDGAGRRNWGAPGDENAPDVEEP--  188

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKK-DSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              V +     A E+Q G++   D  K +  + EPE KEPEDKEMTL EYEKL EE RK  
Sbjct  189  --VAENEKNVAPEQQLGEDGVDDNNKAEEAVKEPEEKEPEDKEMTLKEYEKLREESRK--  244

Query  577  LASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS--INE  404
            L ++ E RK  +D+E E+M  L++KK +DE+F KLG++K+ +K  A ++ +  KS  I E
Sbjct  245  LLAKTEVRKAEVDEELENMQQLSSKKTNDEIFAKLGTDKDKRKDVADKEERAKKSVTITE  304

Query  403  FLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            FLKPAEGE YY PGGRGRGRG GS  G   G+N  +   PSIED GQFP+L +K
Sbjct  305  FLKPAEGERYYNPGGRGRGRGRGSRGGFNNGSNRMNVAAPSIEDPGQFPSLSAK  358



>ref|XP_011032341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
 ref|XP_011032350.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
Length=370

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 160/233 (69%), Gaps = 18/233 (8%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN-GVVNDGV  734
            N E  +GE PRR YE  SGTGRG+E+KREGSGRGNWG+PTDE+A   EE  N G  N G 
Sbjct  146  NEEVGEGERPRRNYEHWSGTGRGNEMKREGSGRGNWGTPTDELALVTEEAANEGEKNWG-  204

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 + +  ++ A D KK++P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EER
Sbjct  205  -----DDKPVEDAAADGKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEER  259

Query  553  KVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETy  374
            KV   KEF+SM  L+NKK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE Y
Sbjct  260  KVDA-KEFQSMQQLSNKKENNDVFIKLGS-DKDKRKEAYEKAKKSVSINEFLKPAEGERY  317

Query  373  yrpggrgrgrghgsgrggygGNNTSSF---------ETPSIEDVGQFPTLGSK  242
            Y  G R RGRG G+   G     +S F           PSIED GQFPTLG K
Sbjct  318  YGAGSRSRGRGRGARGFGNRDGMSSGFGSRDGMSSVPAPSIEDPGQFPTLGGK  370



>ref|XP_009789579.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=351

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 149/228 (65%), Gaps = 30/228 (13%)
 Frame = -3

Query  916  LSNGENADGE--YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
             SNG+ A+GE   PRR ++RRSGTGRG                      E E P    VN
Sbjct  151  FSNGDAAEGEGERPRRVFDRRSGTGRG----------------------ETEVP----VN  184

Query  742  DGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRP  563
            DG      EK+ GQEDA D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +P
Sbjct  185  DGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKP  244

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEG  383
            EERKV LDKE E+M LL+NKKNDDE+F+KLGS +++K+KEA EK +KTKSINEFLKPA+G
Sbjct  245  EERKVNLDKELETMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTKSINEFLKPADG  303

Query  382  ETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLGSK  242
            E+ Y   G           G  GG   + +F  PSIEDVGQFP+L +K
Sbjct  304  ESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSLVAK  351



>gb|KJB37649.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=307

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG+E KR+GSGRGNWGSPTD IAPE EE    V  + 
Sbjct  139  FNDGESGEGERPRRMYDRRSGTGRGNEFKRDGSGRGNWGSPTDGIAPETEE---NVPENE  195

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
             N  + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EE
Sbjct  196  KNV-SIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEE  254

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGS  467
            RKV   KEFESM  L++KK++D++F+KLGS
Sbjct  255  RKVDT-KEFESMQQLSSKKSNDDIFIKLGS  283



>ref|XP_010053519.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X1 [Eucalyptus grandis]
Length=374

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 157/235 (67%), Gaps = 14/235 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +N E  +GE PRRA++RRSGTGRG+E KR+G+GRGNWG+PTDEIAPE EE     V + 
Sbjct  144  YNNEEAGEGERPRRAFDRRSGTGRGNETKRDGAGRGNWGAPTDEIAPETEE----PVTEV  199

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
              T   EKQ   ED  DA K+ PL+EPE KEPEDKEMTL+EYEK+ EE RK++LA + EE
Sbjct  200  EKTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEE  259

Query  556  RKVCLDKEFESMALLANKKND-DEVFVKLGSeked--kkkeagekvkktKSINEFLKPAE  386
            RKV LDK+ +SM  L+NKK D +++F+KLG EK+   +  E  EK KK+ SINEFLKPAE
Sbjct  260  RKVELDKDLKSMQQLSNKKKDNNDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAE  319

Query  385  GE-------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            GE            G   RG   G G GG GG        PSIED GQFP+LG K
Sbjct  320  GERYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  374



>ref|XP_004148350.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Cucumis sativus]
 gb|KGN60476.1| hypothetical protein Csa_3G914560 [Cucumis sativus]
Length=358

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 160/235 (68%), Gaps = 10/235 (4%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RR G SNGE  +GE PRR YERRSGTGRG+E KREG+GR NWG+P DE AP+ EEP  
Sbjct  130  GPRRAGFSNGEAEEGERPRRVYERRSGTGRGNEFKREGAGRRNWGAPGDENAPDVEEP--  187

Query  754  GVVNDGVNTDAFEKQHGQEDAGD--AKKDSPLdepevkepedkEMTLDEYEKLLEEKRKA  581
              V +     A E+Q G++   D   K +  + EPE KEPEDKEMTL EYEKL EE RK 
Sbjct  188  --VAENEKNVAPEQQLGEDGVVDDNNKTEEAVKEPEEKEPEDKEMTLKEYEKLREESRK-  244

Query  580  ILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS--IN  407
             L ++ E RK  +D+E E+M  L++KK +DE+F KLG++K+ +K  A ++ +  KS  I 
Sbjct  245  -LLAKTEVRKAEVDEELENMQQLSSKKTNDEIFAKLGTDKDKRKDAADKEERAKKSVTIT  303

Query  406  EFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EFLKPAEGE YY PGGRGRGRG GS  G   G+N  +   PSIED GQFP+L +K
Sbjct  304  EFLKPAEGERYYNPGGRGRGRGRGSRGGFNNGSNRMNVAAPSIEDPGQFPSLSAK  358



>ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
 gb|ESW11640.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
Length=365

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 161/229 (70%), Gaps = 10/229 (4%)
 Frame = -3

Query  916  LSNGENADGE--YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
             SNGE  + E   PRRAY+RRSGTGRG+E KREG+GRGNWG+  D+I    EE    VVN
Sbjct  143  FSNGETVESEEGRPRRAYDRRSGTGRGNEFKREGAGRGNWGTQNDDITETTEE----VVN  198

Query  742  DGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRP  563
            +    +  +++   E+  D  KDSP +E E KEPEDKEMTL+EYEK+LEE+RKA  A + 
Sbjct  199  E-TEKNLGDEKPAVEEVADGNKDSPANETEEKEPEDKEMTLEEYEKVLEERRKAFQALKT  257

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPA  389
            E RKV   KEFE+M  L++KK + ++F+KLGS+K+ +K+     EK KK+ SI EFLKPA
Sbjct  258  EGRKVDA-KEFETMQPLSSKKTNHDIFIKLGSDKDKRKEALEKEEKSKKSVSITEFLKPA  316

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EGETYY PGGRGRGRG    RGGY G  T++   PSIED G FPTLG+K
Sbjct  317  EGETYYNPGGRGRGRGGRGSRGGYRGGATNNAPAPSIEDPGHFPTLGAK  365



>gb|ABD64914.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 150/232 (65%), Gaps = 16/232 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG+  D E PRR Y+RRSGTGR +++KREG GRGNWG+P D+I P  EEP   V    
Sbjct  113  FANGKTGDVERPRRVYDRRSGTGRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSP  172

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ G++   DAKK++P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  173  V----AEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEE  225

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            RKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA 
Sbjct  226  RKVDT-KVFESMQQLSNKKSNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPAN  284

Query  385  GET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  245
            GET      YR  G    R      GG   N  +S   P+I D  QFP+L S
Sbjct  285  GETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLAS  336



>ref|XP_009373211.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=372

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 151/220 (69%), Gaps = 7/220 (3%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            DGE  RR YERRSGTGRGSE+KREGSGRGNWG+  DE++   EE    V N        E
Sbjct  158  DGER-RRVYERRSGTGRGSEVKREGSGRGNWGAQADELSEVTEE----VANVTEKNLGDE  212

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            K   + DA D  KD+P +EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    K
Sbjct  213  KPGEEGDAADGNKDTPANEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAK  272

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpgg  359
            EFES   L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGG
Sbjct  273  EFESFQQLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGG  332

Query  358  rgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  242
            RGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  333  RGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  372



>ref|XP_009607515.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=337

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 155/225 (69%), Gaps = 31/225 (14%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNG+ AD E PRRA+ERRSGTGRG                      E EEP+N    +G
Sbjct  144  FSNGDTAD-ERPRRAFERRSGTGRG----------------------EKEEPLN----EG  176

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   Q DA DA KDSP  EP+ KEPE+KEMTL+EYEKLLE+KRKA+LA +PEE
Sbjct  177  EKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEDKRKALLALKPEE  236

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA EK KKTKSINEFLKPA+G +
Sbjct  237  RKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVEKAKKTKSINEFLKPADGGS  295

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            YYR GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  296  YYRRGGRGRGGRDHGRDGVVGNNSVSA---PSIEDVRQFPSLGAK  337



>gb|KHG30709.1| hypothetical protein F383_14338 [Gossypium arboreum]
Length=353

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 156/245 (64%), Gaps = 31/245 (13%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAP-------  776
            G  RGG ++GE+ +GE PRR           +E KR+GSGRGNWGSPTD IAP       
Sbjct  126  GGHRGGFNDGESGEGERPRRM----------NEFKRDGSGRGNWGSPTDGIAPSYAYISV  175

Query  775  ------EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  614
                  EAEE     V +       EKQ G+EDA DA K++  +E E KEPE+KEMTL+E
Sbjct  176  ILPKIREAEEN----VPENEKNVGIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEE  231

Query  613  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSek-edkkkeag  437
            YEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGSEK + K  +  
Sbjct  232  YEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKE  290

Query  436  ekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  257
            E+VKK+ SINEFLKPAEGE     G           RGGYGGN  SS   PSIED G FP
Sbjct  291  ERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFP  348

Query  256  TLGSK  242
            +LG K
Sbjct  349  SLGGK  353



>emb|CDY43435.1| BnaAnng07070D [Brassica napus]
Length=339

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 117/235 (50%), Positives = 148/235 (63%), Gaps = 20/235 (9%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG+  D E PRR Y+RRSGTGR +++KREG GRGNWG+P D+I P  EEP   V    
Sbjct  112  FANGKTGDVERPRRVYDRRSGTGRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSP  171

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ G++   DAKK++P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  172  VA----EKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEE  224

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            RKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA 
Sbjct  225  RKVDT-KVFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPAN  283

Query  385  GET---------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            GET              G    R      GG   N  +S   P+I D  QFP+LG
Sbjct  284  GETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLG  338



>gb|KJB22277.1| hypothetical protein B456_004G038700 [Gossypium raimondii]
Length=366

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 153/235 (65%), Gaps = 15/235 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  DGE PRR YER SGTGRG++++REG GRGNWG+ T+E+A   EE    V N+G
Sbjct  137  FSNGEIGDGERPRRVYERSSGTGRGNKLEREGFGRGNWGTQTNELARVTEE----VANEG  192

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK     D GDA K+S  +E E KEPE+K MTL+EYEKL+EEKRKA+ A + E 
Sbjct  193  NQNLGDEKLARDGDGGDADKESLTNELEEKEPEEKVMTLEEYEKLMEEKRKALQALKTEG  252

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAE-  386
            RKV   KEFESM  L+NKK++DE+F+KLGS+K+ +K+     E+ KK+ SINEFLKPAE 
Sbjct  253  RKVDA-KEFESMQQLSNKKSNDEIFIKLGSDKDKRKEAYEKEERAKKSLSINEFLKPAER  311

Query  385  -------GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                   G    R  G+ +GRGH S   G G   +S    PSIED   FPTLG K
Sbjct  312  KRYYNPSGRGRGRVQGQDQGRGHSSRGFGGGNARSSMAAAPSIEDRSHFPTLGGK  366



>gb|KJB37650.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=284

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 115/148 (78%), Gaps = 5/148 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG+E KR+GSGRGNWGSPTD IAPE EE     V + 
Sbjct  139  FNDGESGEGERPRRMYDRRSGTGRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPEN  194

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EE
Sbjct  195  EKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEE  254

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKL  473
            RKV   KEFESM  L++KK++D++F+KL
Sbjct  255  RKVDT-KEFESMQQLSSKKSNDDIFIKL  281



>emb|CDY67886.1| BnaCnng56800D [Brassica napus]
Length=361

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 150/232 (65%), Gaps = 16/232 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG+  D E PRR Y+RRSGTGR +++KREG GRGNWG+P D+I P  EEP   V    
Sbjct  138  FANGKTGDVERPRRVYDRRSGTGRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSP  197

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ G++   DAKK++P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  198  VA----EKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEE  250

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            RKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA 
Sbjct  251  RKVDT-KVFESMQQLSNKKSNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPAN  309

Query  385  GET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  245
            GET      YR  G    R      GG   N  +S   P+I D  QFP+L S
Sbjct  310  GETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLAS  361



>ref|XP_008344404.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=367

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 155/227 (68%), Gaps = 7/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
              N E  DGE  RR +ER SGTGRGSE+KREGSGRGNWGS  DE++   EE    V N  
Sbjct  146  FGNAEVGDGER-RRVFERXSGTGRGSEVKREGSGRGNWGSQADELSELTEE----VANVT  200

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   + DA D KKD+P +EPE KEPEDKEMTL+EY+K+LEEKRKA+ A +  E
Sbjct  201  EKHLGDEKPVEEGDAADGKKDTPANEPEEKEPEDKEMTLEEYQKVLEEKRKALQALKTTE  260

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGE  380
             +    KEFES   L+NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE
Sbjct  261  ERKVDAKEFESFQQLSNKKANDEIFIKLGSDKDKKKDSEKEEKSKKSVSINEFLKPAEGE  320

Query  379  TyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  242
             +Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  321  RFYNPGGRGRGRGRGSKGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  367



>ref|XP_004140509.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis sativus]
 gb|KGN46515.1| hypothetical protein Csa_6G106180 [Cucumis sativus]
Length=361

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 152/227 (67%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE A+GE PRRA+ER SGTGRG+E KREGSGRGNWG  TDE A  A E     VN+ 
Sbjct  141  FNDGEGAEGERPRRAFERHSGTGRGNEFKREGSGRGNWGRSTDEFAEVAGE----TVNET  196

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   ++D      ++P  EP+  EPEDKEMTL+EYEKLLE+KRKA+LA + EE
Sbjct  197  EKNVGDEKPIQEDDTSGVNTENPAKEPQETEPEDKEMTLEEYEKLLEDKRKALLALKTEE  256

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEG  383
            RKV   KEF SM  L++KK+++++F+KLGSEK+ +K+ A ++ +  K  SINEFL+PA+G
Sbjct  257  RKVD-PKEFASMQQLSSKKDNNDIFIKLGSEKDKRKEMADKEERTKKSLSINEFLRPADG  315

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  +   G          RGGY G+  S+   PSI D GQFPTLG+K
Sbjct  316  E-RHYAPGGRGRGRGRGSRGGYSGSPMSNVAAPSIGDPGQFPTLGAK  361



>ref|XP_009114287.1| PREDICTED: uncharacterized protein LOC103839539 [Brassica rapa]
Length=343

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 148/235 (63%), Gaps = 20/235 (9%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG+  D E PRR Y+RRSGTGR +++KREG GRGNWG+P D+I P  EEP   V    
Sbjct  116  FANGKTGDVERPRRVYDRRSGTGRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSP  175

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ G++   DAKK++P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  176  V----AEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEE  228

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            RKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K   E  EK KK+ SIN+FLKPA 
Sbjct  229  RKVDT-KAFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINQFLKPAN  287

Query  385  GET---------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            GET              G    R      GG   N  +S   P+I D  QFP+LG
Sbjct  288  GETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLG  342



>ref|XP_004515346.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cicer arietinum]
Length=371

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 153/227 (67%), Gaps = 9/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +   PRR ++R SGTGRGS  KREG+GRGNWG+ +DEIA   EE    V N+ 
Sbjct  147  FSNGEAGEEGRPRRPFDRHSGTGRGSGFKREGAGRGNWGTQSDEIAQVTEE----VANET  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+E+A D  K++P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E 
Sbjct  203  EKNLGEEKPAGEEEAADVSKETPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEG  262

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke-agekvkktKSINEFLKPAEGE  380
            RKV   KEFESM  L+ KK++ E+F KLGS+K+ +K+    EK KK  SINEFLKPA+GE
Sbjct  263  RKVDA-KEFESMKPLSCKKDNVEIFAKLGSDKDKRKEAFDKEKSKKALSINEFLKPADGE  321

Query  379  ---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
                    GGRG   G GS  GG+GGN  S+   PSIED GQFPTLG
Sbjct  322  KFYNPGGRGGRGGRGGRGSRGGGFGGNAYSNVPAPSIEDPGQFPTLG  368



>ref|XP_004306983.1| PREDICTED: circumsporozoite protein-like [Fragaria vesca subsp. 
vesca]
Length=387

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 152/229 (66%), Gaps = 20/229 (9%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  D E  RR YERRSGTGRG+E+KREGSGRGNWGS TDE  PE        V +GV  D
Sbjct  171  EVGDEERLRRNYERRSGTGRGNELKREGSGRGNWGSQTDEF-PE--------VTEGV--D  219

Query  724  AFEKQHGQE------DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRP  563
            A EK  G+E      +A D  K++P +EPE KEPE+KEMTL+EYEK+LEEKRKA+ A + 
Sbjct  220  ATEKNLGEEKLVGEVEAADGSKETPANEPEEKEPEEKEMTLEEYEKVLEEKRKALQALKT  279

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSek--edkkkeagekvkktKSINEFLKPA  389
            EERKV   KEFES+  ++NKK +D+VF+KLGS+K  + +  E  EK KK+ SINEFLKPA
Sbjct  280  EERKVDT-KEFESLQQISNKKGNDDVFIKLGSDKDKKKESAEKEEKAKKSVSINEFLKPA  338

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            EGE +  P   GRGRG G   G       SS   P IED   FPTLG K
Sbjct  339  EGERFSYPSRGGRGRGRGPRGGSSSNYPQSSVRAPPIEDPSHFPTLGGK  387



>ref|XP_006280739.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
 gb|EOA13637.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
Length=346

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 151/225 (67%), Gaps = 10/225 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE  D E PRR YERRSGTGRGS++KREG GRGNWG+  D+IAP  EE    V    
Sbjct  129  FANGEGGD-ERPRRTYERRSGTGRGSDLKREGGGRGNWGTTEDDIAPATEEATTEV----  183

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
              + A EKQ G ED  DA K++   E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  184  EKSPAAEKQGG-EDETDASKEAAAAEQAQKEAEDKEMTLEEYEKILEEKKKALQATKVEE  242

Query  556  RKVCLDKEFESMALLANKKN-DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FESM  L+NKKN ++E+FVKLGS ++DK+K+A EK KK+ SINEFLKPA+GE
Sbjct  243  RKVDT-KVFESMQQLSNKKNTEEEIFVKLGS-EKDKRKDAAEKAKKSLSINEFLKPAKGE  300

Query  379  TyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLG  248
            TY   GG     G G      GGN +      P I D  QFP+LG
Sbjct  301  TYNPRGGNRGRGGRGGREQRGGGNQSHREAAAPVIGDTAQFPSLG  345



>ref|XP_010924482.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1-like 
protein [Elaeis guineensis]
Length=376

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 149/227 (66%), Gaps = 22/227 (10%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD----AFE  716
            PRR YER SGTGRG EIKREG+GRGNWG+ TD+I  +A        ++ VN D    A E
Sbjct  156  PRRMYERHSGTGRGYEIKREGAGRGNWGTATDDIIAQAS-------DENVNADDKLVATE  208

Query  715  KQHGQEDA--GDAKKDSPLde-pevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            KQ  QEDA   +A KD  +    E KEPEDKEMTL+EYEK+ EEKRKA+LA + EERKV 
Sbjct  209  KQQEQEDAPSSEANKDKDVQTNEEEKEPEDKEMTLEEYEKIREEKRKALLALKIEERKVE  268

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGE-  380
            +D+E +SM  L++KK +++VF+KLGS+K+  KK+         KK+ SIN+FLKPAEGE 
Sbjct  269  IDRELQSMQQLSSKKGNEDVFIKLGSDKDMGKKKDVADRDERGKKSVSINQFLKPAEGER  328

Query  379  ---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
                  R  GRGRG       G  GG+ ++    PSIED GQFPTLG
Sbjct  329  YYSATGRGRGRGRGGRGPFRGGFGGGDTSAPAAAPSIEDPGQFPTLG  375



>ref|XP_006398418.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
 gb|ESQ39871.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
Length=359

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ D E PRR YERRSGTGRG+++KREG GRGNWG+  D+I P  EEP   V    
Sbjct  131  YANGESGDVERPRRPYERRSGTGRGNDLKREGGGRGNWGTTEDDIPPATEEPTTEVEKSP  190

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G++D  DAKKD+P DE E KE EDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  191  V----AEKQSGEDDTTDAKKDAPADEQEEKEAEDKEMTLEEYEKILEEKKKALQATKVEE  246

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV   K FESM  L+NKK+++E+F+KLGSEK+ +  E  EK KK+ SINEFLKPA+GET
Sbjct  247  RKVDT-KVFESMQQLSNKKSNEEIFIKLGSEKDKRTTEKEEKAKKSLSINEFLKPADGET  305



>ref|XP_010481348.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=349

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 149/228 (65%), Gaps = 13/228 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE  D E PRR YERRSGTGRG+++KREG GRGNWG+  D+IAP  EEP   V    
Sbjct  129  FANGEGGDVERPRRTYERRSGTGRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSP  188

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G+++  DA K++  +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  189  V----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEE  242

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FESM  L+NKK  ++E+FVKLGS  +DK+K+A EK KK+ SINEFLKPA+G 
Sbjct  243  RKVDT-KVFESMQQLSNKKTTEEEIFVKLGS-DKDKRKDAAEKTKKSLSINEFLKPADGA  300

Query  379  TyyrpggrgrgrghgsgrggygG----NNTSSFETPSIEDVGQFPTLG  248
                 GGRG   G G      G     N       P+I D  QFP+LG
Sbjct  301  RGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010481347.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=349

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 150/228 (66%), Gaps = 13/228 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE  D E PRR YERRSGTGRG+++KREG GRGNWG+  D+IAP  EEP   V    
Sbjct  129  FANGEGGDVERPRRTYERRSGTGRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSP  188

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G+++  DA K++  +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  189  V----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEE  242

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAE--  386
            RKV   K FESM  L+NKK  ++E+FVKLGS  +DK+K+A EK KK+ SINEFLKPA+  
Sbjct  243  RKVDT-KVFESMQQLSNKKTTEEEIFVKLGS-DKDKRKDAAEKTKKSLSINEFLKPADGA  300

Query  385  --GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
              G    R G  GRG     G G  G N       P+I D  QFP+LG
Sbjct  301  RGGYRGGRGGRGGRGGRDQRGGGNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010494951.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 156/249 (63%), Gaps = 26/249 (10%)
 Frame = -3

Query  940  SNGDRRGGL-------------SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWG  800
            ++G RRGG+             +NGE  D E PRR YERRSGTGRG+++KREG GRGNWG
Sbjct  108  ADGARRGGIVGGFRGRGARRGFANGEGGDVERPRRTYERRSGTGRGTDLKREGGGRGNWG  167

Query  799  SPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTL  620
            +  D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKEMTL
Sbjct  168  TTEDDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTL  221

Query  619  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkke  443
            +EYEK+LEEK+KA+ A++ EERKV   K F+SM  L+NKK  ++E+FVKLGS  +DK+K+
Sbjct  222  EEYEKILEEKKKALQATKVEERKVDT-KVFDSMQQLSNKKTTEEEIFVKLGS-DKDKRKD  279

Query  442  agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG----NNTSSFETPSIE  275
              EK KK+ SINEFLKPA+G      GGRG   G G      G     N       P+I 
Sbjct  280  TAEKTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIG  339

Query  274  DVGQFPTLG  248
            D  QFP+LG
Sbjct  340  DTAQFPSLG  348



>gb|AFK43517.1| unknown [Lotus japonicus]
Length=370

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 151/229 (66%), Gaps = 10/229 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +   PRRA+ER SGTGRGS  KREG+GRGNWG+ +DEIA   +E    V N+ 
Sbjct  148  FSNGEADEEGRPRRAFERHSGTGRGSGFKREGAGRGNWGTQSDEIAQVTDE----VANE-  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
               +  +++   ED  D  K+S  +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E 
Sbjct  203  TEKNLSDEKPAVEDVADGNKESSANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEG  262

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV + KEFESM  L+ KK+++++F KLGS+K+ +K+     EK KK+ SINEFLKPAEG
Sbjct  263  RKVDI-KEFESMQPLSCKKDNNDIFAKLGSDKDKRKEAFEKEEKAKKSVSINEFLKPAEG  321

Query  382  ET--yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            ET      G        G G G + GN TS+   PSIED G FPTLG K
Sbjct  322  ETYYPSGRGRGRGRGSRGGGGGSFRGNATSNAPAPSIEDPGHFPTLGGK  370



>ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46389.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 152/228 (67%), Gaps = 11/228 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            LSN E  +GE PRRA+ERRSGTGRGS+ KR+GSGRGNWG+P +E+A E E     V    
Sbjct  139  LSN-EGGEGERPRRAFERRSGTGRGSDFKRDGSGRGNWGTPGEELAAETE----AVAGVD  193

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
               D  EK    + A DA K++ +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    E
Sbjct  194  TEKDVGEKLAVDDVAADANKENTV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLATSE  251

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV   K FESM  L+NKK++DE+F+KLGS+K+ +K E  EK KK  SINEFLKPAEGE 
Sbjct  252  RKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDEKEEKAKKAVSINEFLKPAEGEN  310

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  242
            YYR GGRG     G GRGG     +  +     P+I D  QFP+LG K
Sbjct  311  YYRGGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  358



>ref|XP_010104826.1| hypothetical protein L484_024026 [Morus notabilis]
 gb|EXC02062.1| hypothetical protein L484_024026 [Morus notabilis]
Length=463

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 168/249 (67%), Gaps = 34/249 (14%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGS--------------------------EIKREGSGRG  809
            NGE  +GE PRR YERRSGTGRG+                          E+KREGSGRG
Sbjct  147  NGEAVEGERPRRIYERRSGTGRGASPRGVPHCKAIKIHGMGGEAYTSSINELKREGSGRG  206

Query  808  NWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkE  629
            NWG+PTDEIAPE EEP+        N DA  ++ G E+A DA K+ P  E E KEPEDKE
Sbjct  207  NWGTPTDEIAPEVEEPVVENEK---NVDA--EKLGDEEASDANKEKPEKEAEEKEPEDKE  261

Query  628  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe--ked  455
            MTL+EYEK+LEEKRKA+LA + EERKV   KEFESM  L++KK +DE+F+KLGSE  K  
Sbjct  262  MTLEEYEKVLEEKRKALLALKTEERKVD-SKEFESMQQLSSKKGNDEIFIKLGSEKDKRK  320

Query  454  kkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIE  275
            +  E  EK KK+ SINEFLKPAEGE YY PGGRGRGRG GS  G  GG ++S+   PSIE
Sbjct  321  EAAEKEEKAKKSLSINEFLKPAEGERYYTPGGRGRGRGRGSRGGYGGGYSSSNVAAPSIE  380

Query  274  DVGQFPTLG  248
            D GQFPTLG
Sbjct  381  DPGQFPTLG  389



>ref|XP_010918620.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Elaeis guineensis]
Length=369

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 148/228 (65%), Gaps = 23/228 (10%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD----AFE  716
            PRR YERRSGTGRG E+KREG+GR NWG+ TD++       I    ++ VN D    A E
Sbjct  148  PRRMYERRSGTGRGYEMKREGAGRANWGTATDDV-------IAQATDENVNADDKIPASE  200

Query  715  KQHGQEDA----GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
            KQ  Q++A     + +KD   +E E KEP+DKEMTL+EYEK+ EEKRKA+LA + EERKV
Sbjct  201  KQPEQDNAPSSEANKEKDVQANEAEEKEPDDKEMTLEEYEKIREEKRKALLAMKTEERKV  260

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGE  380
             +DKE +SM  L+ KK +D+VF+KLGS+    K+    +  E+ KK  SINEFLKPAEGE
Sbjct  261  EIDKELQSMQQLSLKKGNDDVFIKLGSDKDMGKKKDVADRDERAKKPVSINEFLKPAEGE  320

Query  379  ---TyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLG  248
               +    G        G  RGG+GG  TS+  T PSIED GQFPTLG
Sbjct  321  RYYSPVGRGRGRGRGDRGPFRGGFGGRGTSTPATAPSIEDPGQFPTLG  368



>ref|XP_010441486.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 149/228 (65%), Gaps = 13/228 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE  D E P+R YERRSGTGRG+++KREG GRGNWG+  D+IAP  EEP   V    
Sbjct  129  FANGEGGDVERPKRTYERRSGTGRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSP  188

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EKQ G+++  DA K++  +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  189  V----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEE  242

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FESM  L+NKK  ++E+FVKLGS  +DK+K+A EK KK+ SINEFLKPA+G 
Sbjct  243  RKVDT-KVFESMQQLSNKKTTEEEIFVKLGS-DKDKRKDAAEKTKKSLSINEFLKPADGA  300

Query  379  TyyrpggrgrgrghgsgrggygG----NNTSSFETPSIEDVGQFPTLG  248
                 GGRG   G G      G     N       P+I D  QFP+LG
Sbjct  301  RGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010531668.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 151/223 (68%), Gaps = 10/223 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E A  E  RR YERRSGTGRGSE KREGSGRGNWG+P +E+  E EE         V   
Sbjct  140  EEAGEERSRRIYERRSGTGRGSEFKREGSGRGNWGTPGEELVAETEETGVETEKKVV---  196

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERK  551
              EK  G ++A DA K++P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LA+   ERK
Sbjct  197  --EKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLATSDSERK  254

Query  550  VCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGET  377
            V L KEFESM  L+NKK +DE+F+KLGS+K+ +K      EK KK  SINEFLKPAEGE 
Sbjct  255  VDL-KEFESMQQLSNKKANDEIFIKLGSDKDKRKDALDKEEKAKKAVSINEFLKPAEGEG  313

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            YY  GGRGRGRG G G  G G     S   P+IED  QFP+LG
Sbjct  314  YYPRGGRGRGRGRGGGSRGGGYGGYQSKAAPAIEDTAQFPSLG  356



>ref|XP_007052330.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
 gb|EOX96487.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
Length=267

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 141/206 (68%), Gaps = 8/206 (4%)
 Frame = -3

Query  853  TGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  674
             G+ +E+KREGSGRGNWG+ TDE+A   EE    VVN+       EK  G+EDAGDA K+
Sbjct  68   AGKKNELKREGSGRGNWGTQTDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKE  123

Query  673  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  494
            SP +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++
Sbjct  124  SPTNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSN  182

Query  493  DEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  320
            DEVF+KLGSEK+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG 
Sbjct  183  DEVFIKLGSEKDKRKEAFDKEERAKKSVSINEFLKPAEGE-RYYNPSGRGRGRGRGSRGF  241

Query  319  ygGNNTSSFETPSIEDVGQFPTLGSK  242
             GG+   +   PSIED GQFPTLG K
Sbjct  242  GGGSAAGNVSAPSIEDPGQFPTLGGK  267



>ref|XP_004150996.1| PREDICTED: cyclin-dependent kinase 13-like [Cucumis sativus]
 gb|KGN46514.1| hypothetical protein Csa_6G105680 [Cucumis sativus]
Length=360

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 159/228 (70%), Gaps = 10/228 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
              NG+ ADGE PR A+ER SGTGRG+E KREGSGRGNWG   +E  PE  E  N     G
Sbjct  140  FYNGDTADGERPRGAFERHSGTGRGNEFKREGSGRGNWGRSAEEF-PEVAEEANESQKLG  198

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   ++D      ++P  E E KEPEDKEMTL+EYEKLL+EKRK++LA + EE
Sbjct  199  D-----EKPVHEDDTAGVNTENPAKESEEKEPEDKEMTLEEYEKLLDEKRKSLLALKTEE  253

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek--vkktKSINEFLKPAEG  383
            RKV   KEF S+  L++KK + ++F+KLGS+K+ +K+ A ++   KK+ SINEFLKPAEG
Sbjct  254  RKVD-PKEFASLQQLSSKKENQDIFIKLGSDKDKRKETADKEERTKKSVSINEFLKPAEG  312

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVGQFPTLGSK  242
            E +Y PGGRGRGRG GS  GGY G++ SS    PSIED GQFPTLG+K
Sbjct  313  EKHYTPGGRGRGRGRGSRGGGYVGSSMSSNVAAPSIEDPGQFPTLGAK  360



>ref|XP_010434652.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=389

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 130/180 (72%), Gaps = 6/180 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ D E PRR +ER SGTG GSE KR+G+GRGNWG+  D+IAP  +E    V  + 
Sbjct  133  FNNGESGDFERPRRNFERHSGTGHGSEFKRDGAGRGNWGTTEDDIAPVTDESTAAVEKNV  192

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EKQ G+ +A DA K++P +E   KEPE+KEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  193  T----VEKQGGEGEATDANKETPAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVEE  248

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  249  RKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVMEREEKTKKSLSINEFLKPANGE  307



>ref|XP_008810382.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Phoenix dactylifera]
Length=373

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 146/226 (65%), Gaps = 18/226 (8%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEA-EEPINGVVNDGVNTDAFEKQH  707
            PRR YERRSGTGRG E+KREGSGRGNWG+ TD++  +A EE +N  V+D +   A EKQ 
Sbjct  151  PRRMYERRSGTGRGYEMKREGSGRGNWGTATDDVIAQATEENVN--VDDKIL--ASEKQP  206

Query  706  GQEDA----GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
              +D      +  KD+  +E E KEPEDKEMTL+EYEK+ EEKRKA+LA + EERKV +D
Sbjct  207  EHDDVPSSEANKDKDAQANEAEEKEPEDKEMTLEEYEKIREEKRKALLALKTEERKVEID  266

Query  538  KEFESMALLANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGE---  380
            +E +SM  L+ KK +D+VF+KLGS+    K+    +  E+ KK  SINEFLKPAEGE   
Sbjct  267  QELQSMQQLSLKKRNDDVFMKLGSDKDTGKKKDVADRDERAKKPVSINEFLKPAEGERYY  326

Query  379  --TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
                   G     RG   G  G G  + +    PSIED GQFPTLG
Sbjct  327  SPVGRGRGRARGDRGQFRGGFGGGRGSGAPATAPSIEDPGQFPTLG  372



>ref|XP_010449710.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=263

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 150/233 (64%), Gaps = 19/233 (8%)
 Frame = -3

Query  925  RGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVV  746
            RG LS     +GE PRR YERRSGTGRG + KR+GSGRGNWG+P +E+A E E       
Sbjct  45   RGVLS----GEGERPRRTYERRSGTGRGGDFKRDGSGRGNWGTPGEELAAETEAVA----  96

Query  745  NDGVNTDAFEKQHGQEDAGDAKKDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILAS  569
              GV+T   EK  G++ A DA  +     E E KEPEDKEMTLDEYEK+LEEK+KA+ + 
Sbjct  97   --GVDT---EKAVGEKPAVDADANKENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSL  151

Query  568  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  389
               ERKV   K FESM  L+NKK +DE+F+KLGS+K+ +K +  EK KK  SINEFLKPA
Sbjct  152  TTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPA  210

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTS----SFETPSIEDVGQFPTLGSK  242
            EGE YYR G  GRGRG      G   N       +   P+IED  QFP+LG K
Sbjct  211  EGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAIEDTAQFPSLGGK  263



>ref|XP_006644341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=370

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 154/223 (69%), Gaps = 6/223 (3%)
 Frame = -3

Query  892  GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFE  716
            G  P RAYERRSGTGRG E KREG+GRGNWG+ TDE +A E+ E +N  V   V  D  +
Sbjct  148  GRAPYRAYERRSGTGRGYETKREGAGRGNWGTVTDESLAQESGEVVNIEVAAAVTEDETK  207

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            ++   +   + +K+   +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DK
Sbjct  208  QEDVPQSEVEKRKEGESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVVVDK  267

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpg  362
            E +SM  L+ KK+ DEVF+KLGS+K+ KK+      + +K+ SINEFLKPAEGE YY PG
Sbjct  268  ELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGERYYSPG  327

Query  361  grgrgrghgsgrggygGNNTSS---FETPSIEDVGQFPTLGSK  242
            GRGRGRG G G  G   +  SS      P+IED  QFP+L  K
Sbjct  328  GRGRGRGRGRGDRGGFRDGYSSRGPVAAPAIEDQAQFPSLAGK  370



>ref|XP_010531670.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Tarenaya 
hassleriana]
Length=359

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 150/218 (69%), Gaps = 10/218 (5%)
 Frame = -3

Query  889  EYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQ  710
            E  RR YERRSGTGRGSE KREGSGRGNWG+P +E+  E EE         V     EK 
Sbjct  145  ERSRRTYERRSGTGRGSEFKREGSGRGNWGTPGEELVAETEETGVETEKKVV-----EKP  199

Query  709  HGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVCLDK  536
             G ++A DA K++P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LAS   ERKV L K
Sbjct  200  AGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVDL-K  258

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpg  362
            EFESM  L+NKK +DE+F+KLGS+K+ +K      EK KK+ SINEFLKPAEGE YY  G
Sbjct  259  EFESMQQLSNKKANDEIFIKLGSDKDKRKDALDKEEKAKKSVSINEFLKPAEGEGYYPRG  318

Query  361  grgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            GRGRGRG G G  G G     +   P+IED  QFP+LG
Sbjct  319  GRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFPSLG  356



>ref|XP_007142624.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
 gb|ESW14618.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
Length=358

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 157/222 (71%), Gaps = 11/222 (5%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            DG+ PRR YERRSGTGRG+E+KREG GRGNWG  TDE+    +E     +N+     +  
Sbjct  144  DGQ-PRRVYERRSGTGRGNELKREGYGRGNWGLQTDELGQATDE-----INETAKNFSEV  197

Query  715  KQHGQED-AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
            K  G++D A D  K++P +E E KEPEDKEMTL+EYEK+LEE+RKA+ A + EERKV   
Sbjct  198  KPSGEDDVAADGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQALKTEERKVDT-  256

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrp  365
            K FESM  L+NKK++ ++F+KLGSEK+ +K+     EK KK+ SINEFLKP EGE++Y  
Sbjct  257  KVFESMQQLSNKKDNFDIFIKLGSEKDKRKETLEKEEKAKKSVSINEFLKPPEGESFYSA  316

Query  364  ggrgrgrghgsgrggygGN-NTSSFETPSIEDVGQFPTLGSK  242
            GGRGRGRG G G  G  G   T++   PSIED GQFPTLG K
Sbjct  317  GGRGRGRGRGRGARGGFGGYATANVTAPSIEDPGQFPTLGVK  358



>ref|XP_010449600.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 [Camelina 
sativa]
Length=387

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 130/180 (72%), Gaps = 6/180 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ + E PRR +ER SGTG GSE KR+G+GRGNWG+  D+IAP  +E     V   
Sbjct  130  FNNGESGEFERPRRNFERHSGTGHGSEFKRDGAGRGNWGTTEDDIAPVTDE-STAAVEKN  188

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V  D   KQ G+ +A DA K++P +E   KEPE+KEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  189  VTVD---KQGGEGEATDANKETPAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVEE  245

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  246  RKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREEKTKKSLSINEFLKPANGE  304



>gb|AES80534.2| nuclear RNA-binding-like protein [Medicago truncatula]
Length=583

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 155/227 (68%), Gaps = 8/227 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG+  +   PRR +ER SGTGRG++ KREG+GRGNWG+ TDEIA   EE    V+N+G
Sbjct  156  FNNGDAGEEGRPRRTFERHSGTGRGNDFKREGAGRGNWGTETDEIAQVTEE----VMNEG  211

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   + D  +  KDSP +E E KEPEDKEMTL+EYEK+LEEKRKA+   + EE
Sbjct  212  EKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQTLKTEE  271

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   K FE+M  L+ KK++ E+F KLG++K+ +K+     EK KK+ SINEFLKPAEG
Sbjct  272  RKVDT-KAFETMQALSCKKDNTEIFAKLGADKDKRKEAYDKEEKAKKSVSINEFLKPAEG  330

Query  382  ETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLGS  245
            E++Y  GGRGRGRG    RGG    N+ S+   PSIED G FPTL +
Sbjct  331  ESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGHFPTLAT  377



>ref|XP_003624316.1| Transcription factor [Medicago truncatula]
Length=625

 Score =   146 bits (368),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 155/226 (69%), Gaps = 8/226 (4%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG+  +   PRR +ER SGTGRG++ KREG+GRGNWG+ TDEIA   EE    V+N+G
Sbjct  156  FNNGDAGEEGRPRRTFERHSGTGRGNDFKREGAGRGNWGTETDEIAQVTEE----VMNEG  211

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK   + D  +  KDSP +E E KEPEDKEMTL+EYEK+LEEKRKA+   + EE
Sbjct  212  EKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQTLKTEE  271

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV   K FE+M  L+ KK++ E+F KLG++K+ +K+   +  K KK+ SINEFLKPAEG
Sbjct  272  RKVDT-KAFETMQALSCKKDNTEIFAKLGADKDKRKEAYDKEEKAKKSVSINEFLKPAEG  330

Query  382  ETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLG  248
            E++Y  GGRGRGRG    RGG    N+ S+   PSIED G FPTLG
Sbjct  331  ESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGHFPTLG  376



>ref|NP_001078399.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83810.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=265

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 148/220 (67%), Gaps = 9/220 (4%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            DGE PRRA+ERRSGTGRGS+ KR+GSGRGNWG+P +EIA E  E + GV  +    D  E
Sbjct  53   DGERPRRAFERRSGTGRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVETE---KDVGE  108

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            K    + A DA K+  +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K
Sbjct  109  KPAVDDVAADANKEDTV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-K  165

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggr  356
             FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG  YYR G  
Sbjct  166  VFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRGGRG  225

Query  355  grgrghgsgrggygGNNTS--SFETPSIEDVGQFPTLGSK  242
            GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  226  GRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  265



>ref|XP_010449709.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=352

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 148/226 (65%), Gaps = 15/226 (7%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E+ +GE PRR YERRSGTGRG + KR+GSGRGNWG+P +E+A E E         GV+T 
Sbjct  137  ESGEGERPRRTYERRSGTGRGGDFKRDGSGRGNWGTPGEELAAETEAVA------GVDT-  189

Query  724  AFEKQHGQEDAGDAKKDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
              EK  G++ A DA  +     E E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  190  --EKAVGEKPAVDADANKENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKV  247

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyr  368
               K FESM  L+NKK +DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR
Sbjct  248  DT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYR  306

Query  367  pggrgrgrghgsgrggygGNNTS----SFETPSIEDVGQFPTLGSK  242
             G  GRGRG      G   N       +   P+IED  QFP+LG K
Sbjct  307  GGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAIEDTAQFPSLGGK  352



>ref|XP_009772180.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=334

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 157/225 (70%), Gaps = 30/225 (13%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNG+ ADGE PRRA+ERRSGTGRG                      E EEP    VN+G
Sbjct  140  FSNGDAADGERPRRAFERRSGTGRG----------------------EKEEP----VNEG  173

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EKQ  Q DA DA KDSP  EP+ KEPE+KEMTL+EYEKLLEEKRKA+LA +PEE
Sbjct  174  EKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEEKRKALLALKPEE  233

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            RKV LDKE ESM LL+NKK+DDEVF+KLGS ++DK+KEA EK KKTKSINEFLKPA+GE+
Sbjct  234  RKVNLDKELESMQLLSNKKSDDEVFIKLGS-EKDKRKEAVEKAKKTKSINEFLKPADGES  292

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            YY  GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  293  YYGRGGRGRGGRDRGRDGFVGNNSVSA---PSIEDVRQFPSLGAK  334



>ref|XP_002870099.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46358.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 131/178 (74%), Gaps = 6/178 (3%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            SNG++ D E PR+ YER S T  G+E+KR+G+GRGNWG+  D+IAP  EE  + VV+  +
Sbjct  127  SNGDSGDFERPRKNYERHSRTAHGNEVKRDGAGRGNWGTTQDDIAPVTEE-TSAVVDKNL  185

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 EKQ G+ +A DA K++P +    ++PEDKEMTL+EYEK+LEEK+KA+ A++ EER
Sbjct  186  ---TVEKQGGEGEATDANKETPAEVQAEEKPEDKEMTLEEYEKVLEEKKKALQATKVEER  242

Query  553  KVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEG  383
            KV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK +K+ SINEFLKPA+G
Sbjct  243  KVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREEKTRKSLSINEFLKPADG  299



>ref|XP_010439990.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Camelina 
sativa]
Length=390

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 129/180 (72%), Gaps = 6/180 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ D E PRR +ER SGTG GSE KR+G+GRGNWG+  D+IAP  +E    V  + 
Sbjct  133  FNNGESGDFERPRRNFERHSGTGHGSEFKRDGAGRGNWGTTEDDIAPVTDESTAAVEKNV  192

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EKQ G+ +A  A K++P +E   KEPE+KEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  193  T----VEKQSGEGEATIANKETPAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVEE  248

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  249  RKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREEKTKKSLSINEFLKPANGE  307



>ref|XP_004961407.1| PREDICTED: RNA-binding protein FUS-like [Setaria italica]
Length=374

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 151/236 (64%), Gaps = 25/236 (11%)
 Frame = -3

Query  895  DGEY-------PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            DGE+       PRR YER SGTGRG E+KREG+GRGNWG+ TDEI       I+    +G
Sbjct  146  DGEFGDDSERPPRRTYERHSGTGRGYEMKREGAGRGNWGTTTDEI-------ISQETEEG  198

Query  736  VNTD----AFEKQHGQEDAGDAK--KDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
            +  D      EKQ   EDA  A+  KDS     E ++ EDKEMTL+E+EK+ EEKRKA+L
Sbjct  199  LKLDEKAPVPEKQGALEDAPQAEENKDSKDANAEEEKEEDKEMTLEEFEKIREEKRKALL  258

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek----vkktKSIN  407
            A + EERKV +DK+ +SM  L+NKK +DE+FVKLGS+K+  KK+   +     KK+ SIN
Sbjct  259  ALKTEERKVEVDKDLQSMQPLSNKKENDEIFVKLGSDKDALKKKENAERDERAKKSVSIN  318

Query  406  EFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  242
            EFLKPAEGE +Y   GRGRGRG   G  G  G    +    P+I+D  QFP+LG K
Sbjct  319  EFLKPAEGERFYGGRGRGRGRGDRGGFRGGYGGGYRAPPAAPAIQDQSQFPSLGGK  374



>ref|XP_008798813.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Phoenix dactylifera]
Length=373

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 153/228 (67%), Gaps = 10/228 (4%)
 Frame = -3

Query  910  NGENADGEYP-RRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDG  737
            +GE  +GE+P RR ++R SGTGRGS IKREGSGRGNWG+PTD+    + EE IN V    
Sbjct  147  DGEPEEGEWPARRQFDRHSGTGRGSGIKREGSGRGNWGTPTDQGQVKKPEEFINSV---N  203

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPE  560
            +     EK  G+ED     K++   E + KEPEDKEMTLDEYEKLLEEKRKA+ A  + E
Sbjct  204  MYAKFEEKPVGEEDGVAVDKENAPGETKEKEPEDKEMTLDEYEKLLEEKRKALQALQKIE  263

Query  559  ERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS----INEFLKP  392
            ERKV +DKEFE M  L+ KKN+D+VF+KLGSE+E  ++      + +      IN FL+P
Sbjct  264  ERKVDVDKEFEFMQQLSAKKNNDDVFIKLGSERESARRRDAADREDSARRPAIINTFLRP  323

Query  391  AEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            AE E +Y PGGRGRGRG    RGG+G   T +   PSIED G FPTLG
Sbjct  324  AEEERHYNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHFPTLG  371



>ref|XP_009605755.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=363

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 158/237 (67%), Gaps = 11/237 (5%)
 Frame = -3

Query  937  NGDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI  758
            +G RRGG SNGE  +G+ PRR +ERRSGTGRG EIKREG+GRGNWG+  DE+    +E  
Sbjct  133  HGGRRGGFSNGEFPEGDRPRRVFERRSGTGRGGEIKREGAGRGNWGTQADEVTQMTDE--  190

Query  757  NGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              V N+G      EK   + +AGD KK++P  E E KEPE+KEMTL+EYEKLLEEKR+A+
Sbjct  191  --VANEGEKNLNVEKLSTEGEAGDDKKENPAAEAEDKEPENKEMTLEEYEKLLEEKRQAL  248

Query  577  LASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe-kedkkkeagekvkktKSINEF  401
             A + EERKV   KEFESM  L+ K +DD +F+KL  + K  +  E  EK KK  SINEF
Sbjct  249  QALKTEERKVDT-KEFESMQQLSKKSSDD-IFIKLAPKDKRRESAEKEEKAKKAVSINEF  306

Query  400  LKPAEGETyyrpggrgrgrghgsgrggyg----GNNTSSFETPSIEDVGQFPTLGSK  242
            LKPAEGE YY PGGRGRG      RG        N TS+ E P IED G FPTLG K
Sbjct  307  LKPAEGERYYAPGGRGRGGRGRGSRGYGEDYGGVNTTSNVEAPPIEDPGHFPTLGGK  363



>emb|CAA66481.1| transcription factor [Vicia faba var. minor]
Length=370

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 162/236 (69%), Gaps = 10/236 (4%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RRGG SNGE  +   PRRA+ER SGTGRGSE KR+G+GRGNWG+  DE+    +E   
Sbjct  140  GGRRGGFSNGEGGEEGRPRRAFERHSGTGRGSEFKRDGAGRGNWGTEADEVTQVTDE---  196

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
             VVN+       EK   + D  +  KD+P +E E KEPEDKEMTL+EYEKLLEEKRKA+ 
Sbjct  197  -VVNEAEKNFGDEKPAAENDVAEGNKDTPANEAEEKEPEDKEMTLEEYEKLLEEKRKALQ  255

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEF  401
            A + EERKV   KEFE+M  L+ KK++ E+F KLGS+K+ +K+     EK KK+ SINEF
Sbjct  256  ALKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEF  314

Query  400  LKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            LKPAEGE        GGRGRGRG   G GG+ GN+TS+   PSIED G FPTLG+K
Sbjct  315  LKPAEGEGYYNQGGRGGRGRGRGTRGGFGGFRGNSTSNVPAPSIEDPGHFPTLGAK  370



>ref|XP_006414296.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
 gb|ESQ55749.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
Length=359

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 151/227 (67%), Gaps = 11/227 (5%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNT  728
            E+ +GE PRR +ERRSGTGRG + KREGSGRGNWG+P +E+ A E EE    V       
Sbjct  138  EDGEGERPRRTHERRSGTGRGGDFKREGSGRGNWGTPGEEVFAGETEE----VAGAETEK  193

Query  727  DAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
            +A EK  G + A DA K++  +  E KEPE+KEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  194  NAVEKPAGDDVAADANKENTAEAEEEKEPENKEMTLDEYEKILEEKKKALQSQTTSERKV  253

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyr  368
               K FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR
Sbjct  254  DT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYR  312

Query  367  pggrgrgrghgsgrggygGNNTS-----SFETPSIEDVGQFPTLGSK  242
             GGRG     G GRG  G ++       S   P I D  QFP+LG K
Sbjct  313  GGGRGGRERGGRGRGRGGASSGGFGGHRSEAAPVIGDTAQFPSLGGK  359



>ref|XP_009395730.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like [Musa 
acuminata subsp. malaccensis]
Length=381

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 145/227 (64%), Gaps = 17/227 (7%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YERRSGTGRG E+KR G+GRGNWGS TDE I  E EE    ++N G  T A EKQ 
Sbjct  159  PRRFYERRSGTGRGYEMKRNGAGRGNWGSATDESILQENEE----IINVGDKTVATEKQV  214

Query  706  GQED--AGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
              E+  + D  K++         ++ EDKEMTL+EYEK+ EEKRKA+ A + EERKV +D
Sbjct  215  EPEEVPSSDVNKENKEGAANDAEEKEEDKEMTLEEYEKVREEKRKALAAMKSEERKVEMD  274

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAEGE--T  377
            K+ +SM  L+ KK +D++FVKLGS+K+  KK+       + KK  SINEFLKPAEGE   
Sbjct  275  KDLQSMKQLSLKKENDDIFVKLGSDKDTGKKKENTDRDERNKKPMSINEFLKPAEGERYY  334

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  242
                 GRGRGRG      G      S+F T  PSIED GQFPTLG K
Sbjct  335  NSGGRGRGRGRGGRGQFRGGFMGGVSTFTTDAPSIEDPGQFPTLGGK  381



>ref|NP_193416.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF14243.1|AF110227_1 nuclear RNA binding protein [Arabidopsis thaliana]
 emb|CAB10456.1| nuclear antigen homolog [Arabidopsis thaliana]
 emb|CAB80954.1| nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAL36252.1| putative nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAM20150.1| putative nuclear antigen-like protein [Arabidopsis thaliana]
 gb|AAM83242.1| AT4g16830/dl4440w [Arabidopsis thaliana]
 gb|AAN18128.1| At4g16830/dl4440w [Arabidopsis thaliana]
 gb|AEE83809.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=355

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 149/223 (67%), Gaps = 9/223 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  DGE PRRA+ERRSGTGRGS+ KR+GSGRGNWG+P +EIA E  E + GV  +    D
Sbjct  140  EGGDGERPRRAFERRSGTGRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVETE---KD  195

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
              EK    + A DA K+  +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV 
Sbjct  196  VGEKPAVDDVAADANKEDTV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVD  253

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrp  365
              K FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG  YYR 
Sbjct  254  T-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRG  312

Query  364  ggrgrgrghgsgrggygGNNTS--SFETPSIEDVGQFPTLGSK  242
            G  GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  313  GRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  355



>emb|CDY40563.1| BnaC02g33290D [Brassica napus]
Length=330

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 153/226 (68%), Gaps = 13/226 (6%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            +NG   DG    R +ERRSGTGRG+++KREG GRGNWG+P D+I P  EE    V    V
Sbjct  113  ANGRAGDG----RVFERRSGTGRGNDLKREGGGRGNWGTPEDDIPPPTEEATTEVEKSPV  168

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 EK+ G++D  DAKKD+P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EER
Sbjct  169  ----AEKEGGEDDTTDAKKDTPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEER  224

Query  553  KVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEG  383
            KV   K FESM  L++KK N++E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA+G
Sbjct  225  KVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPADG  283

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVGQFPTLG  248
            E Y   GG  RGRG  +G  G      +     P+I D  QFP+LG
Sbjct  284  ERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQFPSLG  329



>gb|EAY75654.1| hypothetical protein OsI_03559 [Oryza sativa Indica Group]
Length=332

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG E+KR+G+GRGNWG+ TDE +A E EE +    +  +     EKQ 
Sbjct  113  PRRNYERHSGTGRGYEMKRDGAGRGNWGTATDEALAQETEEALKVEESAPIA----EKQG  168

Query  706  GQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
             Q+DA   +KDS       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV +DK+
Sbjct  169  EQDDAPTGEKDSKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVEVDKD  228

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpgg  359
             +SM  L+ KK +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   G
Sbjct  229  LQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRG  288

Query  358  rgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  242
            RGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  289  RGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>ref|XP_010925494.1| PREDICTED: protein argonaute 2-like [Elaeis guineensis]
Length=378

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 167/249 (67%), Gaps = 28/249 (11%)
 Frame = -3

Query  934  GDRRGGLSNGENA--DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEP  761
            G RRGG +N E     G  PRR YERRSGTGRG E+KREG+GRGNWG+ TD++  +A E 
Sbjct  136  GGRRGGYANEEAGVDSGHPPRRVYERRSGTGRGYEMKREGAGRGNWGTSTDDVLAQATE-  194

Query  760  INGVVNDGVNTD----AFEKQHGQEDA--GDAKKDSP---LdepevkepedkEMTLDEYE  608
                  D VNTD    + EKQ  QEDA   +A KD+    ++E E KEPEDKEMTL+EYE
Sbjct  195  ------DNVNTDEKVASPEKQPEQEDAPFAEANKDTKEGEVNEAEEKEPEDKEMTLEEYE  248

Query  607  KLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLG----Sekedkkkea  440
            K+ EEKRKA+LA +PEERKV LDKEFESM  L+ KK DD VFVKLG    S K+    + 
Sbjct  249  KIKEEKRKALLALKPEERKVQLDKEFESMQQLSLKKGDD-VFVKLGTDKDSSKKRDNADR  307

Query  439  gekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN-----NTSSFETPSIE  275
            GE+ +K+ SINEFLKPAEGE YY P GRGRGRG G G     G+      T +   PSIE
Sbjct  308  GERARKSFSINEFLKPAEGERYYSPAGRGRGRGRGRGDRRTFGDGFGRGGTIAAAAPSIE  367

Query  274  DVGQFPTLG  248
            D GQFPTLG
Sbjct  368  DPGQFPTLG  376



>gb|ABD65038.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 151/226 (67%), Gaps = 13/226 (6%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            +NG   DG    R +ERRSGTGRG+++KREG GRGNWG+P D+I P  EE    V    V
Sbjct  119  ANGRAGDG----RVFERRSGTGRGNDLKREGGGRGNWGTPEDDIPPPTEEATTEVEKSPV  174

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
                 EK+ G++D  DAKKD P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EER
Sbjct  175  ----AEKEGGEDDTTDAKKDPPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEER  230

Query  553  KVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEG  383
            KV   K FESM  L++KK N++E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA+G
Sbjct  231  KVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSFSINEFLKPADG  289

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVGQFPTLG  248
            E Y   GG  RGRG  +G  G      +     P+I D  QFP+LG
Sbjct  290  ERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQFPSLG  335



>ref|XP_009128949.1| PREDICTED: suppressor protein STM1-like [Brassica rapa]
Length=337

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 132/182 (73%), Gaps = 12/182 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG   DG    R +ERRSGTGRG+++KREG GRGNWG+P D+I P  EE    V    
Sbjct  112  FANGRAGDG----RVFERRSGTGRGNDLKREGGGRGNWGTPEDDIPPPTEEATTEVEKSP  167

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ G++D  DAKKD+P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  168  VA----EKEGGEDDTTDAKKDAPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEE  223

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            RKV   K FESM  L++KK N++E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA+
Sbjct  224  RKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPAD  282

Query  385  GE  380
            GE
Sbjct  283  GE  284



>ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50247.1| RNA binding protein, putative [Ricinus communis]
Length=295

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE  DGE PRRA+ERRSGTG G+E KREG+GRGNWG+ TDEIA   EE     VN+G
Sbjct  146  FANGEVGDGERPRRAFERRSGTGHGNEFKREGAGRGNWGTNTDEIAQVTEE----AVNEG  201

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G+ +A D KK+SP +EPE K+PEDKEMTL+EYEK+LEEKRKA+ A++ EE
Sbjct  202  EKNMGDEKPVGEGEAVDGKKESPTNEPEEKQPEDKEMTLEEYEKVLEEKRKALQATKAEE  261

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKL  473
            RKV   KEF SM  L++KK  D++F+KL
Sbjct  262  RKVDT-KEFASMQQLSSKKGGDDIFIKL  288



>ref|XP_010531669.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 148/218 (68%), Gaps = 10/218 (5%)
 Frame = -3

Query  889  EYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQ  710
            E  RR YERRSGTGRGSE KREGSGRGNWG+P +E+  E EE         V     EK 
Sbjct  145  ERSRRIYERRSGTGRGSEFKREGSGRGNWGTPGEELVAETEETGVETEKKVV-----EKP  199

Query  709  HGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVCLDK  536
             G ++A DA K++P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LAS   ERKV L K
Sbjct  200  AGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVDL-K  258

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpg  362
            EFESM  L+NKK +DE F+KLGS+K+ +K      EK KK  SINEFLKPA+GE YY  G
Sbjct  259  EFESMQQLSNKKANDEFFIKLGSDKDKRKDALDKEEKAKKAVSINEFLKPADGEGYYPRG  318

Query  361  grgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            GRGRGRG G G  G G     +   P+IED  QFP+LG
Sbjct  319  GRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFPSLG  356



>ref|NP_001078400.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83811.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=345

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 149/223 (67%), Gaps = 9/223 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  DGE PRRA+ERRSGTGRGS+ KR+GSGRGNWG+P +EIA E  E + GV  +    D
Sbjct  130  EGGDGERPRRAFERRSGTGRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVETE---KD  185

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
              EK    + A DA K+  +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV 
Sbjct  186  VGEKPAVDDVAADANKEDTV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVD  243

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrp  365
              K FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG  YYR 
Sbjct  244  T-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRG  302

Query  364  ggrgrgrghgsgrggygGNNTS--SFETPSIEDVGQFPTLGSK  242
            G  GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  303  GRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  345



>gb|KEH17858.1| nuclear RNA-binding-like protein [Medicago truncatula]
Length=373

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 150/236 (64%), Gaps = 14/236 (6%)
 Frame = -3

Query  931  DRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPING  752
            +RRGG SNGE  +G  PRR ++R SGTGRG   KREG+GRGNWG+ +DEIA   +E    
Sbjct  141  ERRGGFSNGEAGEGR-PRRTFDRHSGTGRGGGFKREGAGRGNWGTQSDEIAQVTDE----  195

Query  751  VVNDGVNTDAFEKQHGQED--AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
            V N+     A +K  G+ED  A D  K++P  E E KEPEDKEMTL+EYEK+LEEKRKA+
Sbjct  196  VANETEKNVAEDKPVGEEDAAAADGNKETPAPEAEEKEPEDKEMTLEEYEKVLEEKRKAL  255

Query  577  LASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktK-SINEF  401
                   RKV   KEFES+  L+ KK +DE+F KLGS+K+ +K    ++  +   SINEF
Sbjct  256  NVKTDGGRKVDT-KEFESLKPLSCKKENDEIFAKLGSDKDRRKDAIEKEKARKALSINEF  314

Query  400  LKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            LKPAEGE           G   GRG   G GGYGGN   +   PSIED GQFPTLG
Sbjct  315  LKPAEGEKYYNPGGRGGRGGRGGRGGSRGGGGYGGNAYGNVSAPSIEDPGQFPTLG  370



>ref|XP_003556572.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Glycine max]
Length=332

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 150/225 (67%), Gaps = 10/225 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E A+   PRR +ERR+GTGRG+E KREG+GRGNWG  TDE A   +E     VN+     
Sbjct  114  EAAEDGLPRRPFERRNGTGRGNEFKREGAGRGNWGVQTDEFAQATDE-----VNETSKNF  168

Query  724  AFEKQHGQED-AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
              EK  G++D A    K++P +E E KEPEDKEMTL+EYEK+LEE+RKA+ A + EERKV
Sbjct  169  GDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQALKTEERKV  228

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS--INEFLKPAEGETy  374
               K FESM  L+NKK+ D++F+KLGS+K+ +++   ++ K  KS  INEFLK  EGE+Y
Sbjct  229  DT-KVFESMQQLSNKKDIDDIFIKLGSDKDKRRETLEKEDKSKKSVNINEFLKSPEGESY  287

Query  373  yr-pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            Y   G   R       RGGYGG  T++   PSIED GQFPTLG K
Sbjct  288  YNPGGHGRRHGRGRGARGGYGGYATANIPAPSIEDPGQFPTLGVK  332



>ref|XP_002458112.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
 gb|EES03232.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
Length=366

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 149/222 (67%), Gaps = 14/222 (6%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRRAYER SGTGRG E+KREGSGRGNWG+ TDE +A EA      V  +G      E + 
Sbjct  151  PRRAYERHSGTGRGYEMKREGSGRGNWGTVTDEALAQEA------VETEGTPVAEDENKL  204

Query  706  GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFE  527
             +    +A+K    +  E +EPEDKEMTL+EYEK+LEEKRKA+L  +PEERKV +DKE +
Sbjct  205  EEVPQSEAEKGKEGEPTEAEEPEDKEMTLEEYEKVLEEKRKALLGLKPEERKVEVDKELQ  264

Query  526  SMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyyrpggrg  353
            SM  L+ KK  DE+F+KLGS+K+ KK+     E+ KK+ SINEFLKPAEG+ YY PGGRG
Sbjct  265  SMQQLSVKKGADEIFIKLGSDKDKKKENTERDERAKKSVSINEFLKPAEGQRYYSPGGRG  324

Query  352  rgrghgsgrggygGNNTSSFET-----PSIEDVGQFPTLGSK  242
            RGRG G G  G      S  E      P+I+D  QFP+LG K
Sbjct  325  RGRGRGRGDRGGFRGGYSPREVAAAPAPAIQDQAQFPSLGGK  366



>gb|EPS72575.1| hypothetical protein M569_02184 [Genlisea aurea]
Length=362

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 151/239 (63%), Gaps = 19/239 (8%)
 Frame = -3

Query  934  GDRRGGLS-NGENADG--EYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEE  764
            G RR   S NG+  +G  + PRR YERRSGTGRGSEIKREGSGRGNWGS  DE+AP    
Sbjct  133  GGRRSEFSGNGQVFEGNRDRPRRPYERRSGTGRGSEIKREGSGRGNWGSQNDEVAP----  188

Query  763  PINGVVNDGVNTDAFEKQHGQE-----DAGDAKKDSPLdepevkepedkEMTLDEYEKLL  599
             ++ VV++G      EK  G+E      A D   ++  D  E KE  DKEMTL+EYEK+L
Sbjct  189  VVDRVVDEGDKNQPTEKPSGEEPAAAAAAADGDGETVKDGGEEKEAGDKEMTLEEYEKVL  248

Query  598  EEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvk  425
            EEKRK + + + EERKV   KEFE+M  L+NKK  D +F+KLGSEK+ KK   E  E+ K
Sbjct  249  EEKRKGLQSLKTEERKVDA-KEFEAMQQLSNKKTGDHIFIKLGSEKDRKKEVAEKEERAK  307

Query  424  ktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            K+ SINEFLK  EGE           RG G GRG  GG N    + PSIED G+FP+LG
Sbjct  308  KSVSINEFLKAGEGE----KYYNNPSRGRGRGRGSRGGGNVGGVQAPSIEDPGEFPSLG  362



>ref|XP_002863351.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39610.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 150/234 (64%), Gaps = 17/234 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ D E PRR YER SGTGRG+ +KR+G GRGNWG+  D+I P  EEP   V    
Sbjct  135  FANGESGDVERPRRNYERHSGTGRGNGLKRDGGGRGNWGTTEDDIPPVTEEPTTEVEKSP  194

Query  736  VNTDAFEKQHGQEDAGDAKKD---SPLdepevkepedkEMTLDEYEKLLEEKRKAILASR  566
            V     EKQ G+++  +A K+       + E +E E +EMTL+EYEK+LEEK+KA+ A++
Sbjct  195  V----AEKQGGEDETAEANKEPTAEEKAQKEAEEAEAREMTLEEYEKILEEKKKALQATK  250

Query  565  PEERKVCLDKEFESMALLANKKN-DDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  389
             EERKV   K FESM  L+NKKN D+E+F+KLGS ++DK+K+A EK KK+ SINEFLKPA
Sbjct  251  VEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS-EKDKRKDAAEKTKKSLSINEFLKPA  308

Query  388  EGE-------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            +GE          R G  GRG     G GG   N   +   P+I D  QFP+LG
Sbjct  309  DGERYNGRGGHRGRGGCGGRGGREHRGDGGNQRNVKPAAPAPAIGDTAQFPSLG  362



>gb|AAF14245.1|AF110229_1 nuclear RNA binding protein B [Spinacia oleracea]
Length=240

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 155/233 (67%), Gaps = 6/233 (3%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RRGG +N E  DGE PRR +ERRSGTGRGSE+KREGSGRGNWG+ ++E+AP  EE   
Sbjct  12   GGRRGGFNNEEGRDGERPRRTFERRSGTGRGSEVKREGSGRGNWGAESEEVAPVNEE---  68

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
            GV     N ++ E     EDA    K+   +E E KEPE+KEMTL+EYEKLLEEKRKA+L
Sbjct  69   GVEQTEKNVNS-ENLTAVEDAAVGNKEGQPEEAEEKEPEEKEMTLEEYEKLLEEKRKALL  127

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS-ekedkkkeagekvkktKSINEFL  398
            A + EE KV +DKE ESM  L+ +++D  VF+KLGS + + K+    EKVKK+ SINEFL
Sbjct  128  ALKSEEPKVVVDKELESMQQLSKQQDDSSVFIKLGSDKDKKKEALEKEKVKKSVSINEFL  187

Query  397  KPA-EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            KPA       R  GRG     G   GG GGN T S   P+I D G+FPTLG K
Sbjct  188  KPAEGERFGGRGRGRGGRGSRGGEYGGGGGNRTYSAPAPAIGDPGEFPTLGGK  240



>gb|EAZ13376.1| hypothetical protein OsJ_03294 [Oryza sativa Japonica Group]
Length=332

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG E+KR+G+GRGNWG+ TDE +A E EE +    +  +     EKQ 
Sbjct  113  PRRNYERHSGTGRGYEMKRDGAGRGNWGTATDEALAQETEEALKVEESAPIA----EKQG  168

Query  706  GQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
             Q+DA   +KD+       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV +DK+
Sbjct  169  EQDDAPTGEKDNKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVEVDKD  228

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpgg  359
             +SM  L+ KK +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   G
Sbjct  229  LQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRG  288

Query  358  rgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  242
            RGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  289  RGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>emb|CAC85227.1| salt tolerance protein 1 [Beta vulgaris]
Length=356

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 153/234 (65%), Gaps = 10/234 (4%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RR G +N E  DGE PRR YERRSGTGRGSEIKREG+GRGNWG+ +DE+AP  EE   
Sbjct  130  GGRRDGFNNEEGRDGERPRRTYERRSGTGRGSEIKREGAGRGNWGAESDEVAPVTEE--A  187

Query  754  GVVND-GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
            G  N+  +N    E     EDA D  K+   DE E KEPE+KEMTL+EYEKLLEEKRKA+
Sbjct  188  GEQNEKKLNP---ENLPAVEDAADGIKEGQPDETEEKEPEEKEMTLEEYEKLLEEKRKAL  244

Query  577  LASRPEERKVCLDKEFESMALLANKKND-DEVFVKLGSekedkkkeagekvkktK-SINE  404
             A + EERKV +DK+FESM  L NKK D D VF+KLGS+K+ KK+ A ++  K   SINE
Sbjct  245  SALKAEERKVEVDKDFESMQQLINKKKDEDSVFIKLGSDKDKKKEAAEKEKVKKSVSINE  304

Query  403  FLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            FLKPA  E     G          G G  GGN   S   P+IED G+FPTLG K
Sbjct  305  FLKPA--EGDRYGGRGRGRGRGPRGGGYGGGNRMFSTSAPAIEDPGEFPTLGGK  356



>ref|XP_010692032.1| PREDICTED: uncharacterized protein DDB_G0288133-like [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 153/234 (65%), Gaps = 10/234 (4%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RR G +N E  DGE PRR YERRSGTGRGSEIKREG+GRGNWG+ +DE+AP  EE   
Sbjct  130  GGRRDGFNNEEGRDGERPRRTYERRSGTGRGSEIKREGAGRGNWGAESDEVAPVTEE--A  187

Query  754  GVVND-GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
            G  N+  +N    E     EDA D  K+   DE E KEPE+KEMTL+EYEKLLEEKRKA+
Sbjct  188  GEQNEKKLNP---ENLPAVEDAADGIKEGQPDETEEKEPEEKEMTLEEYEKLLEEKRKAL  244

Query  577  LASRPEERKVCLDKEFESMALLANKKND-DEVFVKLGSekedkkkeagekvkktK-SINE  404
             A + EERKV +DK+FESM  L NKK D D VF+KLGS+K+ KK+ A ++  K   SINE
Sbjct  245  SALKAEERKVEVDKDFESMQQLINKKKDEDSVFIKLGSDKDKKKEAAEKEKVKKSVSINE  304

Query  403  FLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            FLKPA  E     G          G G  GGN   S   P+IED G+FPTLG K
Sbjct  305  FLKPA--EGDRYGGRGRGRGRGPRGGGYGGGNRMFSTAAPAIEDPGEFPTLGGK  356



>gb|ABR25759.1| nuclear antigen [Oryza sativa Indica Group]
Length=243

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 128/174 (74%), Gaps = 3/174 (2%)
 Frame = -3

Query  892  GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFE  716
            G  P RAYERRSGTGRG  +KREG+GRGNWG+ TDE +A E+ E ++  V+  V  +  +
Sbjct  41   GRAPHRAYERRSGTGRGYGMKREGAGRGNWGTVTDEALAQESGEAVSIEVSVTVTEENKQ  100

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            +   Q D  +  K+   +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DK
Sbjct  101  EDVPQSDEVEKHKEGESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKVEERKVVVDK  160

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkk--eagekvkktKSINEFLKPAEGE  380
            E +SM  L+ KK+ DEVF+KLGS+K+ KK+  E  E+ +K+ SINEFLKPAEGE
Sbjct  161  ELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGE  214



>gb|AAM64962.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=360

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 157/248 (63%), Gaps = 25/248 (10%)
 Frame = -3

Query  934  GDRRGGLSNG-ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI  758
            GDRRG  SNG ++ D E PR+ Y+R S T  G+E KR+G+GR NWG+P D+I P  EE  
Sbjct  118  GDRRGSYSNGGDSGDSERPRKNYDRHSRTAYGNEEKRDGAGRANWGTPQDDITPVTEEST  177

Query  757  NGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              VV+  +     EKQ G+ +A DAK ++P  E   ++PEDKEMTL+EYEK+LEEK+KA+
Sbjct  178  -AVVDKNL---TVEKQDGEGEATDAKNETPA-EKAEEKPEDKEMTLEEYEKVLEEKKKAL  232

Query  577  LASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEF  401
             A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK +K+ SINEF
Sbjct  233  QATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKTRKSLSINEF  291

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNN-----------------TSSFETPSIED  272
            LKPA+G++YYRP G  +G   G G       +                  +   TP+I D
Sbjct  292  LKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGAAAQAPTPAIGD  351

Query  271  VGQFPTLG  248
              QFPTLG
Sbjct  352  SAQFPTLG  359



>ref|NP_001044098.1| Os01g0721900 [Oryza sativa Japonica Group]
 dbj|BAB84432.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 dbj|BAF06012.1| Os01g0721900 [Oryza sativa Japonica Group]
Length=380

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 152/221 (69%), Gaps = 11/221 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG E+KR+G+GRGNWG+ TDE +A E EE +    +  +     EKQ 
Sbjct  161  PRRNYERHSGTGRGYEMKRDGAGRGNWGTATDEALAQETEEALKVEESAPIA----EKQG  216

Query  706  GQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
             Q+DA   +KD+       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV +DK+
Sbjct  217  EQDDAPTGEKDNKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVEVDKD  276

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyyrpgg  359
             +SM  L+ KK +DE+F+KLGS+K+ KK+ A   E+ KK+ SINEFLKPAEGE YY   G
Sbjct  277  LQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRG  336

Query  358  rgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  242
            RGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  337  RGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  377



>gb|AAM61393.1| nuclear antigen homolog [Arabidopsis thaliana]
Length=354

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 145/223 (65%), Gaps = 9/223 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  +GE PRR YERRSGTGRGS+ KR+GSGRGNWG+P +EIA E E     V       D
Sbjct  139  EGGEGERPRRTYERRSGTGRGSDFKRDGSGRGNWGTPGEEIAAETE----AVAGVETQKD  194

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
              EK    + A DA K++ +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV 
Sbjct  195  VGEKPAVDDVAADANKENTV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVD  252

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrp  365
              K FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPA G  YYR 
Sbjct  253  T-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAGGGDYYRG  311

Query  364  ggrgrgrghgsgrggygGNNTS--SFETPSIEDVGQFPTLGSK  242
            G  GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  312  GRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  354



>ref|XP_010434762.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
 ref|XP_010434763.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=347

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 144/224 (64%), Gaps = 13/224 (6%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  +GE PRR YERRSGTGRG + KR+GSGRGNWG+P +E+A E E         GV+T 
Sbjct  134  EGGEGERPRRTYERRSGTGRGGDFKRDGSGRGNWGTPGEELAAETE------AVAGVDT-  186

Query  724  AFEKQHGQEDAGDAKKDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
              EK  G+  A DA  +     E + KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  187  --EKAVGETPAVDADANKENTAEVDEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKV  244

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyr  368
               K FESM  L+NKK +DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR
Sbjct  245  DT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYR  303

Query  367  pggrgrgrghgsgrggygGNN--TSSFETPSIEDVGQFPTLGSK  242
             G  GRGRG           +    +   P+I D  QFP+LG K
Sbjct  304  GGRGGRGRGGRGRGRVSSEEHGGYRNEAAPAIGDTAQFPSLGGK  347



>ref|XP_009145376.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 ref|XP_009145384.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 emb|CDY42945.1| BnaA01g18090D [Brassica napus]
Length=304

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 144/216 (67%), Gaps = 11/216 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQH  707
            PRRA+ERRSGTGRG + KREG+GRGNWG+P +E+ A E EE   GV N+    D  EK  
Sbjct  98   PRRAFERRSGTGRGGDFKREGAGRGNWGTPGEEVLAVETEEVAAGVENE---KDVVEKPA  154

Query  706  GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFE  527
                  DA K++  +  E KEPE KEMTLDEYEK+LEEKRKA+ +    ERKV   K FE
Sbjct  155  DD----DANKENTTEVEEQKEPEVKEMTLDEYEKILEEKRKALQSQNTSERKVDT-KVFE  209

Query  526  SMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgr  350
            SM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GR
Sbjct  210  SMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGR  269

Query  349  grghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            GRG     GG    N S    P+I D  QFP+LG K
Sbjct  270  GRGGRVSSGGGFSGNRSE-AAPAIADTAQFPSLGGK  304



>ref|XP_002440366.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
 gb|EES18796.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
Length=378

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 140/221 (63%), Gaps = 9/221 (4%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRRAYER SGTGRG E+KREGSGRGNWG+ TDE +A +  + +N      V  D  + + 
Sbjct  158  PRRAYERHSGTGRGYEMKREGSGRGNWGTATDEGLAQDTADALNPEETSAVVEDEKKPED  217

Query  706  GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFE  527
              +   +  KD   +E E KEPEDKEMTL+EYEK+LEEKRKA+LA + EERKV +DKE +
Sbjct  218  APQSEVEKDKDGAENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEIDKELQ  277

Query  526  SMALLANKKNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGE-----Tyy  371
            SM  L+ KK+ DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE     +  
Sbjct  278  SMQQLSVKKDADEVFIKLGSDKDLKKKENAEREERAKKSLSINEFLKPAEGERYYNPSSR  337

Query  370  rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
              G        G  RGGY G+       P+IED  QFP L 
Sbjct  338  GRGRGRGRGERGGFRGGYNGSYRGPAAAPAIEDQAQFPALA  378



>gb|ABI18976.1| nuclear-localized RNA binding protein [Capsicum annuum]
Length=360

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 157/232 (68%), Gaps = 6/232 (3%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G R+GG SNGE  +G+ PRR +ERRSGTGRGSEIKREG+GRGNWG+  DE+     E   
Sbjct  134  GGRQGGFSNGEMPEGDRPRRTFERRSGTGRGSEIKREGAGRGNWGTEADEVTQMTGE---  190

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
             V N+G      EK   +E+AGD KK++ + E E KEPEDKEMTL+EYEKLLEEKRKA+ 
Sbjct  191  -VANEGEKNLNVEKPSTEEEAGDDKKENLVAEAEDKEPEDKEMTLEEYEKLLEEKRKALQ  249

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe-kedkkkeagekvkktKSINEFL  398
            A +  E +    K FESM  L+ KK+ DE+FVKLGS+ K+ +  E  EK KK  SINEFL
Sbjct  250  ALKTAEERKVDTKVFESMQQLS-KKSGDEIFVKLGSKDKKRESAEKEEKAKKAVSINEFL  308

Query  397  KPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            KPAEGE YY PGGRGRGRG GS         ++    P IED G FPTLG K
Sbjct  309  KPAEGERYYAPGGRGRGRGRGSRGYSGASTTSNVEAAPPIEDPGHFPTLGGK  360



>ref|XP_008798814.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Phoenix dactylifera]
Length=372

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 152/228 (67%), Gaps = 11/228 (5%)
 Frame = -3

Query  910  NGENADGEYP-RRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDG  737
            +GE  +GE+P RR ++R SGTGRG  IKREGSGRGNWG+PTD+    + EE IN V    
Sbjct  147  DGEPEEGEWPARRQFDRHSGTGRGG-IKREGSGRGNWGTPTDQGQVKKPEEFINSV---N  202

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPE  560
            +     EK  G+ED     K++   E + KEPEDKEMTLDEYEKLLEEKRKA+ A  + E
Sbjct  203  MYAKFEEKPVGEEDGVAVDKENAPGETKEKEPEDKEMTLDEYEKLLEEKRKALQALQKIE  262

Query  559  ERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS----INEFLKP  392
            ERKV +DKEFE M  L+ KKN+D+VF+KLGSE+E  ++      + +      IN FL+P
Sbjct  263  ERKVDVDKEFEFMQQLSAKKNNDDVFIKLGSERESARRRDAADREDSARRPAIINTFLRP  322

Query  391  AEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            AE E +Y PGGRGRGRG    RGG+G   T +   PSIED G FPTLG
Sbjct  323  AEEERHYNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHFPTLG  370



>ref|XP_009101440.1| PREDICTED: suppressor protein STM1 [Brassica rapa]
Length=333

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 145/230 (63%), Gaps = 12/230 (5%)
 Frame = -3

Query  916  LSNGENADGEY-PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVND  740
             +NG   D E  P+R Y+R S TGR +++KREG GRGNWG+  D+I P   EP   V   
Sbjct  108  FANGRTGDVEQRPKRVYDRHSRTGRSNDVKREGGGRGNWGTTEDDIPPPTVEPTTEVEKS  167

Query  739  GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
             V     E   G++D  DAKKDSP  E E KEPEDKEMTL+EYEK+LEEK+KA+ A++ E
Sbjct  168  PV----AENDGGEDDTTDAKKDSPAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVE  223

Query  559  ERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPA  389
            ERKV   K FESM  L+NKK N++E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA
Sbjct  224  ERKVDT-KVFESMQQLSNKKTNNEEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKPA  282

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLG  248
            +GE Y  P G  RGRG   G  G              P+I D  QFP+LG
Sbjct  283  DGERYNNPRGGYRGRGGRGGGRGQRDGGNQRHGGAPAPAIGDSAQFPSLG  332



>ref|XP_009145362.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
 ref|XP_009145369.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
Length=335

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 144/216 (67%), Gaps = 11/216 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQH  707
            PRRA+ERRSGTGRG + KREG+GRGNWG+P +E+ A E EE   GV N+    D  EK  
Sbjct  129  PRRAFERRSGTGRGGDFKREGAGRGNWGTPGEEVLAVETEEVAAGVENE---KDVVEKPA  185

Query  706  GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFE  527
                  DA K++  +  E KEPE KEMTLDEYEK+LEEKRKA+ +    ERKV   K FE
Sbjct  186  DD----DANKENTTEVEEQKEPEVKEMTLDEYEKILEEKRKALQSQNTSERKVDT-KVFE  240

Query  526  SMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgr  350
            SM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GR
Sbjct  241  SMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGR  300

Query  349  grghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            GRG     GG    N S    P+I D  QFP+LG K
Sbjct  301  GRGGRVSSGGGFSGNRSEA-APAIADTAQFPSLGGK  335



>ref|NP_001043502.1| Os01g0603000 [Oryza sativa Japonica Group]
 dbj|BAD52651.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAD53119.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAF05416.1| Os01g0603000 [Oryza sativa Japonica Group]
 gb|EAZ12602.1| hypothetical protein OsJ_02509 [Oryza sativa Japonica Group]
Length=378

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 152/223 (68%), Gaps = 6/223 (3%)
 Frame = -3

Query  892  GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFE  716
            G  P RAYERRSGTGRG  +KREG+GRGNWG+ TDE +A E+ E ++  V+  V  +  +
Sbjct  153  GRAPHRAYERRSGTGRGYGMKREGAGRGNWGTVTDEALAQESGEAVSIEVSVTVTEENKQ  212

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            +   Q D  +  K+   +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DK
Sbjct  213  EDVPQSDEVEKHKEGESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKVEERKVVVDK  272

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpg  362
            E +SM  L+ KK+ DEVF+KLGS+K+ KK+      + +K+ SINEFLKPAEGE YY PG
Sbjct  273  ELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGERYYSPG  332

Query  361  grgrgrghgsgrggygGNNTSS---FETPSIEDVGQFPTLGSK  242
            GRGRGRG G G  G   +  SS      P IED  QFP L  +
Sbjct  333  GRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQFPGLAGR  375



>ref|XP_004969088.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Setaria italica]
Length=371

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 156/234 (67%), Gaps = 13/234 (6%)
 Frame = -3

Query  916  LSNGENAD--GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
             ++GE  D  G  PRRAYER SGTGRG E+KREG+GRGNWG+ TDE    A+E +  V  
Sbjct  142  YTDGEGGDESGRPPRRAYERHSGTGRGYEMKREGAGRGNWGTVTDE----AQETLEAVNT  197

Query  742  DGVNTDAFEKQHGQE-DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR  566
            +G    A ++   +E    + +K    +  E +EPEDKEMTL+EYEK+LEEKRKA+L  +
Sbjct  198  EGTPAVAEDENKLEEVPHSEVEKGKEGEPTEEEEPEDKEMTLEEYEKVLEEKRKALLGLK  257

Query  565  PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKP  392
             E RKV +DKE +SM  L+ KK  DE+F+KLGS+KE KK+ A   E+ KK+ SINEFLKP
Sbjct  258  TEVRKVEVDKELQSMQQLSVKKGSDEIFIKLGSDKEKKKENAERDERAKKSVSINEFLKP  317

Query  391  AEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVGQFPTLGSK  242
            AEGE YY PGGRGRGRG G G  G   +  S  E     P+I+D  QFP+LG K
Sbjct  318  AEGERYYSPGGRGRGRGRGRGDRGGFRSGYSPREPGALAPAIQDQAQFPSLGGK  371



>ref|XP_010919739.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Elaeis guineensis]
Length=376

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 146/229 (64%), Gaps = 12/229 (5%)
 Frame = -3

Query  910  NGENADGEYP-RRAYERRSGTGRGSEIKREGSGRGNWGSPTD-EIAPEAEEPINGVVNDG  737
            +GE  +GE P RR ++R SGTGRGS IKREGSGRGNWG+ TD E   + EE     +N G
Sbjct  150  DGEPEEGERPARRQFDRHSGTGRGSGIKREGSGRGNWGTLTDQEQVKKPEE----FINRG  205

Query  736  VNTDAFEKQH-GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRP  563
                 FE+   G+ED     K++   E E KEPEDKEMTLDEYEKLLEEKRKA+ A  R 
Sbjct  206  NMHAKFEENPVGEEDGVAVDKENAPAEIEEKEPEDKEMTLDEYEKLLEEKRKALQALQRT  265

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS----INEFLK  395
            EERKV +DKEFE M  L+ KKNDD+VF+KLGSE++  ++      +        IN FL+
Sbjct  266  EERKVDVDKEFEFMQQLSAKKNDDDVFIKLGSERDSARRRDTADREDLTRRPAIINTFLR  325

Query  394  PAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            PAE E  + PGGRGRGRG   G  G G     +   PSIED G FPTLG
Sbjct  326  PAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPSIEDPGHFPTLG  374



>ref|XP_009396539.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 151/236 (64%), Gaps = 17/236 (7%)
 Frame = -3

Query  910  NGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVND  740
            NGE  D     PRR Y+RRSGTGRG E+KR G+GRGNWG+ TD+ IA E EE    V+N 
Sbjct  154  NGEAVDDSERPPRRMYDRRSGTGRGYEMKRSGAGRGNWGAATDDDIAQEKEE----VLNA  209

Query  739  GVNTDAFEKQHGQED--AGDAKKDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILAS  569
               T A EKQ  Q++  + +  KD+        ++ EDKEMTL+EYEK+ EEKRKA+LA 
Sbjct  210  DDKTIATEKQAEQDEVPSPEVNKDNEGAPNEGEEKEEDKEMTLEEYEKVREEKRKALLAM  269

Query  568  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEF  401
            + EERKV +D+E +SM  L+ KK +D+VFVKLGS+    K+ +  +  E+ KK+ SINEF
Sbjct  270  KNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGSDKDIGKKKENIDRDERSKKSMSINEF  329

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGSK  242
            LKP EGE      GRGRGRG     G   G   S+F     PSIED GQFPTLG K
Sbjct  330  LKPTEGERNRGGRGRGRGRGGRGQFGSGFGGEGSTFAAAAAPSIEDPGQFPTLGGK  385



>gb|ABD65067.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY52558.1| BnaC08g48170D [Brassica napus]
Length=367

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 127/180 (71%), Gaps = 9/180 (5%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            +NGE+ D E PRR Y+R+SG   G+E KR+G+GRGNWG+  DEI P  EE    V  D  
Sbjct  116  NNGESGDFERPRRNYDRQSGAAHGNEFKRDGAGRGNWGTTEDEIPPVTEESATVVEKD--  173

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
               A EK+    +A DA K++P++    KEPED EMTL+EYEK+LEEKRKA+ A++ EER
Sbjct  174  --LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEYEKVLEEKRKALQATKVEER  228

Query  553  KVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  377
            KV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE+
Sbjct  229  KVDT-KVFEAMQQLSSKKSNNDEVFIKLGTEKDKRPVEREEKTKKSLSINEFLKPANGES  287



>ref|XP_006285507.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
 gb|EOA18405.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
Length=363

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG++A  E PRR +ER SGTG G E KR+G+GRGNWG+  D+IAP  +E  +  V++ 
Sbjct  129  FNNGDSAGFERPRRNFERHSGTGHGCEFKRDGAGRGNWGTAEDDIAPVTDE--SAAVDEK  186

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
              T   EKQ G+ +A DA K+   +E   KEPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  187  NLT--VEKQGGEGEATDANKEISAEEQAEKEPEDKEMTLEEYEKVLEEKKKALQATKVEE  244

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  389
            RKV   K FE+M  LANKK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA
Sbjct  245  RKVDT-KAFEAMQQLANKKSNNDEVFIKLGTEKDKRITEREEKTKKSLSINEFLKPA  300



>ref|XP_006284012.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
 gb|EOA16910.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
Length=354

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 147/224 (66%), Gaps = 13/224 (6%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  +GE PRR +ERRSGTGRGS+ KR+GSGRGNWG+P +E+A E E         GV+T 
Sbjct  141  EGGEGERPRRTFERRSGTGRGSDFKRDGSGRGNWGTPGEELASETEAVA------GVDT-  193

Query  724  AFEKQHGQEDAGDAKKDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
              EK  G++ A DA  +     E E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  194  --EKDVGEKPAVDADANKENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSLTTTERKV  251

Query  547  CLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyr  368
               K FESM  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG+ +YR
Sbjct  252  DT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGQNFYR  310

Query  367  pggrgrgrghgsgrggygGNN--TSSFETPSIEDVGQFPTLGSK  242
             G  GRGRG     G     +    +   P+I D   FP+LG K
Sbjct  311  GGRGGRGRGGRGRGGVSSEEHGGYRNEPAPAIGDTTHFPSLGGK  354



>gb|ACG24258.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=360

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 156/248 (63%), Gaps = 25/248 (10%)
 Frame = -3

Query  934  GDRRGGLSNG-ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI  758
            GDRRG  SNG ++ D E PR+ Y+R S T  G+E KR+G+GR NWG+  D+I P  EE  
Sbjct  118  GDRRGSYSNGGDSGDSERPRKNYDRHSRTAYGNEDKRDGAGRANWGTTQDDITPVTEEST  177

Query  757  NGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              VV+  +     EKQ G+ +A DAK ++P  E   ++PEDKEMTL+EYEK+LEEK+KA+
Sbjct  178  -AVVDKNL---TVEKQDGEGEATDAKNETPA-EKAEEKPEDKEMTLEEYEKVLEEKKKAL  232

Query  577  LASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEF  401
             A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK +K+ SINEF
Sbjct  233  QATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKTRKSLSINEF  291

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNN-----------------TSSFETPSIED  272
            LKPA+G++YYRP G  +G   G G       +                  +   TP+I D
Sbjct  292  LKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGAAAQAPTPAIGD  351

Query  271  VGQFPTLG  248
              QFPTLG
Sbjct  352  SAQFPTLG  359



>ref|NP_193485.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
 emb|CAB10532.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78755.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL09735.1| AT4g17520/dl4795w [Arabidopsis thaliana]
 gb|AAL91151.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65040.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83906.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
Length=360

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 156/248 (63%), Gaps = 25/248 (10%)
 Frame = -3

Query  934  GDRRGGLSNG-ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI  758
            GDRRG  SNG ++ D E PR+ Y+R S T  G+E KR+G+GR NWG+  D+I P  EE  
Sbjct  118  GDRRGSYSNGGDSGDSERPRKNYDRHSRTAYGNEDKRDGAGRANWGTTQDDITPVTEEST  177

Query  757  NGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI  578
              VV+  +     EKQ G+ +A DAK ++P  E   ++PEDKEMTL+EYEK+LEEK+KA+
Sbjct  178  -AVVDKNL---TVEKQDGEGEATDAKNETPA-EKAEEKPEDKEMTLEEYEKVLEEKKKAL  232

Query  577  LASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEF  401
             A++ EERKV   K FE+M  L++KK N+DEVF+KLG+EK+ +  E  EK +K+ SINEF
Sbjct  233  QATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKTRKSLSINEF  291

Query  400  LKPAEGETyyrpggrgrgrghgsgrggygGNN-----------------TSSFETPSIED  272
            LKPA+G++YYRP G  +G   G G       +                  +   TP+I D
Sbjct  292  LKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNLREGGRNQRDGGAAAQAPTPAIGD  351

Query  271  VGQFPTLG  248
              QFPTLG
Sbjct  352  SAQFPTLG  359



>ref|XP_009108277.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Brassica rapa]
Length=273

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 149/232 (64%), Gaps = 16/232 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            L N    +GE PRR +ERRSGTGRG + KREG+GRGNWG+P +E+     E + G     
Sbjct  51   LRNVVAGEGERPRRTFERRSGTGRGGDFKREGAGRGNWGTPGEEVLVVETEEVAGA----  106

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK  G E   DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    E
Sbjct  107  ----EIEKPAGDEVVADAKKENAAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSE  162

Query  556  RKVCLDKEFESMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K FESM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE
Sbjct  163  RKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGE  221

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
             YYR GGRG GRG G G    G  +   F+       P+I D  QFP+LG K
Sbjct  222  NYYRGGGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  273



>ref|XP_004961035.1| PREDICTED: insulin receptor substrate 4-like [Setaria italica]
Length=373

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 142/226 (63%), Gaps = 16/226 (7%)
 Frame = -3

Query  886  YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQH  707
            +PRRAYER SGTGRG E+KREG+GRGNWG+ TDE+   A++ +  V N    T   E + 
Sbjct  151  HPRRAYERHSGTGRGYEMKREGAGRGNWGTVTDEVL--AQDTVEAV-NPEETTAVAEDEK  207

Query  706  GQEDA--GDAKKDSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLD  539
              EDA   + +KD    E E +E E ++  MTL+EYEK+LEEKRKA+LA + EERKV +D
Sbjct  208  KPEDAPQSEVEKDKEGVENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEID  267

Query  538  KEFESMALLANKKNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGE----  380
            KE +SM  L+ KK+ DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE    
Sbjct  268  KELQSMQQLSIKKDADEVFIKLGSDKDLKKKENAERDERAKKSLSINEFLKPAEGERYYN  327

Query  379  --TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
                 R   RGRG   G   G  GG    +   P+IED  QFP L 
Sbjct  328  PSGRGRGRSRGRGERGGFYGGYNGGYRGPAAAAPAIEDQAQFPALA  373



>ref|XP_009410905.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 145/227 (64%), Gaps = 17/227 (7%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YERRSGTGRG E KR G+GRGNWGS TDE +A E EE +N   +D   T A EKQ 
Sbjct  165  PRRIYERRSGTGRGYETKRNGAGRGNWGSATDETVAQEKEETLN--TDD--KTVATEKQV  220

Query  706  GQE--DAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
              +   + +  KD+         ++ EDKEMTL+EYEKL EEKRKA+LA + EERKV +D
Sbjct  221  ELDGVPSSEVNKDNKEGATNETEEKEEDKEMTLEEYEKLREEKRKALLALKNEERKVEID  280

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAEGE--T  377
            +E +SM  L+ KK +D+VFVKLGS+K+  KK+       + KK+  I EFLKPAEGE   
Sbjct  281  EELQSMKQLSVKKGNDDVFVKLGSDKDTGKKKENADRDERSKKSMRITEFLKPAEGERYY  340

Query  376  yyrpggrgrgrghgsgrggygGNNTSSF--ETPSIEDVGQFPTLGSK  242
                 GRGRGRG     GG  G   S+F    PSIED GQFPTLG K
Sbjct  341  SPGGRGRGRGRGGRGQYGGGFGGGVSTFPAAAPSIEDPGQFPTLGGK  387



>gb|KHG04303.1| hypothetical protein F383_01005 [Gossypium arboreum]
Length=364

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 149/233 (64%), Gaps = 13/233 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SN E  DGE PRR YERRSGTGRG+E+KREG GRGNWG+ TDE+A   EE    V N+G
Sbjct  137  FSNRETGDGEGPRRVYERRSGTGRGNELKREGFGRGNWGTQTDELAQVTEE----VANEG  192

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                  EK     D GDA K+S  +E E KEPE+K MTL+EYE+L+EEKRKA+ A + E 
Sbjct  193  KQNLGDEKLARDGDGGDADKESLTNELEEKEPEEKVMTLEEYEELMEEKRKALQALKTEG  252

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAE-  386
            RKV   KEFESM  L+NKK++DE+F+KLGS+K+ +K+     E+ KK+ SINEFLKP E 
Sbjct  253  RKVDA-KEFESMQQLSNKKSNDEIFIKLGSDKDKRKEAYEKEERAKKSLSINEFLKPVER  311

Query  385  ----GETyyrpggrgrgrghgsgrggygGNNTSSF-ETPSIEDVGQFPTLGSK  242
                 ++    G         S RG  GGN  SS    PSIED   FPTLG K
Sbjct  312  KRYYNQSGRGRGRGQDQGRGHSSRGFGGGNARSSMAAAPSIEDRSHFPTLGGK  364



>ref|NP_001148572.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACG32086.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=364

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 146/218 (67%), Gaps = 9/218 (4%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG  704
            PRRAYER SGTGRG  +KREG+GRGNWG+ TDE     E+     VN    T   E +  
Sbjct  150  PRRAYERHSGTGRGYGMKREGAGRGNWGTATDEGL---EQDTVDAVNPEETTAVVEDEKK  206

Query  703  QEDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
             EDA  +   K     +  E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DKE
Sbjct  207  PEDAPQSEVEKDKEGAENEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVEIDKE  266

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeagekv---kktKSINEFLKPAEGETyyrpg  362
             ++M  L+ KK+ DEVF+KLGS+K+ KKKE+ E+    KK+ SINEFLKPAEGE YY P 
Sbjct  267  LQAMQQLSVKKDGDEVFIKLGSDKDLKKKESAEREERGKKSLSINEFLKPAEGERYYNPS  326

Query  361  grgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            GRGRGRG G  RGGY G        P+IED  QFP L 
Sbjct  327  GRGRGRGRGGFRGGYNGGYRGPAAAPAIEDQAQFPALA  364



>gb|EAY74854.1| hypothetical protein OsI_02745 [Oryza sativa Indica Group]
Length=380

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 141/225 (63%), Gaps = 8/225 (4%)
 Frame = -3

Query  892  GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFE  716
            G  P RAYERRSGTGRG  +KREG+GRGNWG+ TDE +A E+ E ++  V+  V  +  +
Sbjct  153  GRAPHRAYERRSGTGRGYGMKREGAGRGNWGTVTDEALAQESGEAVSIEVSVTVTEENKQ  212

Query  715  KQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
            +   Q D  +  K+   +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DK
Sbjct  213  EDVPQSDEVEKHKEGESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKVEERKVVVDK  272

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGE-----T  377
            E +SM  L+ KK+ DEVF+KLGS+K+ KK+     E+ +K+ SINEFLKPAEGE      
Sbjct  273  ELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGERYYSPG  332

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                G          G    G ++      P IED  QFP L  +
Sbjct  333  GRGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQFPGLAGR  377



>ref|NP_001056483.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|AAT38003.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 gb|AAT58811.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18397.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|EEE64880.1| hypothetical protein OsJ_19739 [Oryza sativa Japonica Group]
Length=383

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 153/236 (65%), Gaps = 12/236 (5%)
 Frame = -3

Query  916  LSNGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVV  746
             S+G++ D +Y  PRRAYER SGTGRG E+KREGSGRGNWG+ TDE +A E  E +N   
Sbjct  149  YSDGQSGD-DYGRPRRAYERHSGTGRGYELKREGSGRGNWGTVTDEGLAQEVAEAVNTEE  207

Query  745  NDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR  566
                  D  + +   +   D  K+SP +E E KEPEDKEMTL+EYEK+LEEKRKA+LA +
Sbjct  208  APATAEDEKKPEDVPQSEVDKDKESPENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALK  267

Query  565  PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek---vkktKSINEFLK  395
             EERKV +DKE ++M  L+ KK ++EVF+KLGS+K+ KKKE  EK    KK+ SINEFLK
Sbjct  268  AEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKKEKDEKDERTKKSLSINEFLK  327

Query  394  PAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            PAEGE        R  GRGRG   G   G  G         P IED  QFP+LG K
Sbjct  328  PAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQAQFPSLGGK  383



>gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
 gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
Length=361

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 160/229 (70%), Gaps = 13/229 (6%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGV--VNDG  737
            NGE+ + + PRR +ERRSGTG G+EIKREG GRGNWG+P +EI PE EEP   V  V D 
Sbjct  138  NGESEEVDRPRRPFERRSGTGHGNEIKREGFGRGNWGTPNEEIVPEIEEPTTEVKKVIDS  197

Query  736  VNTDAFEKQHGQEDAGDAKKD-SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
                  EK+ G+++  DA KD SP ++ E +  E+KEMTL+EYEK+LEEKRK +L+ + E
Sbjct  198  ------EKKSGEDETDDANKDSSPKEKEEKEAEEEKEMTLEEYEKVLEEKRKTLLSMKSE  251

Query  559  ERKVCLDKEFESMALLANKKND-DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEG  383
             RKV +DKE ESM LL+NKK D D+VF+KLGS  +DK+KEA EK KK+ SINEFLKP EG
Sbjct  252  ARKVNVDKELESMQLLSNKKIDHDDVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPVEG  310

Query  382  E--TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  +     GRGRGRG     GG GG    S   P+IEDV QFP+LG K
Sbjct  311  EKYSRGGGRGRGRGRGREGFGGGGGGGFGRSERAPAIEDVDQFPSLGGK  359



>gb|AFW81314.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=365

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 146/219 (67%), Gaps = 10/219 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG  704
            PRRAYER SGTGRG  +KREG+GRGNWG+ TDE     E+     VN    T   E +  
Sbjct  150  PRRAYERHSGTGRGYGMKREGAGRGNWGTATDEGL---EQDTVDAVNPEETTAVVEDEKK  206

Query  703  QEDA--GDAKKDSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
             EDA   + +KD    E E +E E ++  MTL+EYEK+LEEKRKA+L+ + EERKV +DK
Sbjct  207  PEDAPQSEVEKDKEGAENEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVEIDK  266

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeagekv---kktKSINEFLKPAEGETyyrp  365
            E ++M  L+ KK+ DEVF+KLGS+K+ KKKE+ E+    KK+ SINEFLKPAEGE YY P
Sbjct  267  ELQAMQQLSVKKDGDEVFIKLGSDKDLKKKESAEREERGKKSLSINEFLKPAEGERYYNP  326

Query  364  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
             GRGRGRG G  RGGY G        P+IED  QFP L 
Sbjct  327  SGRGRGRGRGGFRGGYNGGYRGPAAAPAIEDQAQFPALA  365



>ref|XP_009108330.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
 ref|XP_009108331.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
Length=367

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 127/181 (70%), Gaps = 9/181 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NGE+ D E PRR Y+R+SG   G+E KR+G+GRGNWG+  DE+ P  EE    V  D 
Sbjct  115  YNNGESGDFERPRRNYDRQSGAVHGNEFKRDGAGRGNWGTNEDEVPPVTEESTTVVEKD-  173

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                A EK+    +A DA K++P++    KEPED EMTL+EYEK+LEEKRKA+ +++ EE
Sbjct  174  ---LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEYEKVLEEKRKALQSTKVEE  227

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K F+SM  L++KK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  228  RKVDT-KVFDSMQQLSSKKSNNDEVFIKLGTEKDKRPVEREEKTKKSLSINEFLKPANGE  286

Query  379  T  377
            +
Sbjct  287  S  287



>emb|CDX76567.1| BnaA08g08330D [Brassica napus]
Length=367

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 9/181 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             +NG++ D E PRR Y+R+SG   G+E KR+G+GRGNWG+  DE+ P  EE    V  D 
Sbjct  115  YNNGDSGDFERPRRNYDRQSGAAHGNEFKRDGAGRGNWGTTEDELPPVTEESTTVVEKD-  173

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                A EK+    +A DA K++P++    KEPED EMTL+EYEK+LEEKRKA+ +++ EE
Sbjct  174  ---LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEYEKVLEEKRKALQSTKVEE  227

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K F+SM  L++KK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  228  RKVDT-KVFDSMQQLSSKKSNNDEVFIKLGTEKDKRPVEREEKTKKSLSINEFLKPANGE  286

Query  379  T  377
            +
Sbjct  287  S  287



>ref|XP_006654864.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=379

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 156/242 (64%), Gaps = 22/242 (9%)
 Frame = -3

Query  916  LSNGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVV  746
             ++G+N D +Y  PRRAYER SGTGRG  +KREG+GRGNWG+ TDE +A E  E    VV
Sbjct  143  YTDGQNGD-DYGRPRRAYERHSGTGRGYGMKREGAGRGNWGTVTDEGLAQETVE----VV  197

Query  745  NDGVNTDAFEKQHGQEDAGDAKKDS-----PLdepevkepedkEMTLDEYEKLLEEKRKA  581
            N        E++   EDA  ++ D        +E E KEPED EMTL+EYEK+LEEKRKA
Sbjct  198  NTEETAATAEEEKKPEDAPQSEVDKDKEGLENEEEEEKEPEDTEMTLEEYEKVLEEKRKA  257

Query  580  ILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSe---kedkkkeagekvkktKSI  410
            +LA + EERKV +DKE +SM  L+ KK+++EVF+KLGS+   K+ +  E  E+ KK+ SI
Sbjct  258  LLALKAEERKVEVDKELQSMQQLSVKKDNEEVFIKLGSDKDLKKKEIAERDERAKKSLSI  317

Query  409  NEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS------SFETPSIEDVGQFPTLG  248
            NEFLKPAEGE YY P GRGRGRG G G         +          P+IED  QFP+LG
Sbjct  318  NEFLKPAEGERYYNPSGRGRGRGRGRGEHRGFYGGFNGNGGRRHASAPAIEDQAQFPSLG  377

Query  247  SK  242
             K
Sbjct  378  GK  379



>gb|KJB37652.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=335

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 144/226 (64%), Gaps = 30/226 (13%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ +GE PRR Y+RRSGTGRG                T+E  PE E+ +       
Sbjct  139  FNDGESGEGERPRRMYDRRSGTGRGE---------------TEENVPENEKNV-------  176

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
                + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EE
Sbjct  177  ----SIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEE  232

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGE  380
            RKV   KEFESM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE
Sbjct  233  RKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGE  291

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                 G           RGGYGGN  SS   PSIED G FP+LG K
Sbjct  292  R--YYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  335



>ref|XP_009416461.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=389

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 18/228 (8%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YERRSGTGRG E+KR+G+GRGNWG+  DE +A E +E    V+N        EKQ 
Sbjct  166  PRRLYERRSGTGRGYEMKRDGAGRGNWGTVADETLAQEKDE----VLNFDDKMLVTEKQQ  221

Query  706  GQED--AGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
             QE   A +  K++         ++ EDKEMTL+EYEK+ EEKRKA+LA + EERKV +D
Sbjct  222  EQEKTPATEESKENKEGTTNEAEEKEEDKEMTLEEYEKIREEKRKALLAMKAEERKVEID  281

Query  538  KEFESMALLANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEG----  383
            KE +SM  L+ KK +D +FVKLGS+    K+ +  +  E+ KK+ SINEFLKPAEG    
Sbjct  282  KELQSMQQLSTKKENDPIFVKLGSDKDFGKKKENADRDERSKKSLSINEFLKPAEGGRYY  341

Query  382  -ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
                   G     RG   G  G GG++ ++   PSIED GQFPTLG K
Sbjct  342  SPGGRGRGRGRGDRGPLRGSYGGGGSSFAAAAAPSIEDPGQFPTLGGK  389



>emb|CDX76586.1| BnaA08g08140D [Brassica napus]
Length=342

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 147/223 (66%), Gaps = 16/223 (7%)
 Frame = -3

Query  889  EYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQ  710
            E PRR +ERRSGTGRG + KREG+GRGNWG+P +E+     E + GV          EK 
Sbjct  129  ERPRRTFERRSGTGRGGDFKREGAGRGNWGTPGEEVLVVETEEVAGVET--------EKP  180

Query  709  HGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEF  530
             G E A DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV   K F
Sbjct  181  AGDEVAADAKKENTAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT-KVF  239

Query  529  ESMALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrg  353
            ESM  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR GGRG
Sbjct  240  ESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGGRG  299

Query  352  rgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
             GRG G G    G  +   F+       P+I D  QFP+LG K
Sbjct  300  GGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  342



>ref|XP_011626786.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X2 [Amborella trichopoda]
Length=326

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 109/146 (75%), Gaps = 6/146 (4%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAF  719
            D E PRR +ERRSGTGRG+E KREG+GRGNWG+PTD+  A +  E    V N        
Sbjct  165  DSERPRRQFERRSGTGRGNETKREGAGRGNWGTPTDDGFAVQESE---AVANVEEKNPTP  221

Query  718  EKQHGQEDAGDA--KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
            EKQ  QED  DA  +K++ ++EPE KEPEDKEMTL+EYEK+ EEKRKA+LA +PEERKV 
Sbjct  222  EKQPEQEDGVDAGKEKENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKPEERKVD  281

Query  544  LDKEFESMALLANKKNDDEVFVKLGS  467
            +DKEF+SM  L+ KK +D++F+KLGS
Sbjct  282  VDKEFKSMQQLSLKKGNDDIFIKLGS  307



>gb|EAY99238.1| hypothetical protein OsI_21200 [Oryza sativa Indica Group]
Length=383

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 125/236 (53%), Positives = 153/236 (65%), Gaps = 12/236 (5%)
 Frame = -3

Query  916  LSNGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVV  746
             S+G++ D +Y  PRRAYER SGTGRG E+KREGSGRGNWG+ TDE +A E  E +N   
Sbjct  149  YSDGQSGD-DYGRPRRAYERHSGTGRGYELKREGSGRGNWGTVTDEGLAQEVAEAVNTEE  207

Query  745  NDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR  566
                  D  + +   +   D  K+SP +E E KEPEDKEMTL+EYEK+LEEKRKA+LA +
Sbjct  208  APVTAEDEKKPEDVPQSEVDKDKESPENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALK  267

Query  565  PEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek---vkktKSINEFLK  395
             EERKV +DKE ++M  L+ KK ++EVF+KLGS+K+ KKKE  EK    KK+ SINEFLK
Sbjct  268  AEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKKEKDEKDERTKKSLSINEFLK  327

Query  394  PAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            PAEGE        R  GRGRG   G   G  G         P IED  QFP+LG K
Sbjct  328  PAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQAQFPSLGGK  383



>ref|XP_010919740.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Elaeis guineensis]
Length=375

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 145/229 (63%), Gaps = 13/229 (6%)
 Frame = -3

Query  910  NGENADGEYP-RRAYERRSGTGRGSEIKREGSGRGNWGSPTD-EIAPEAEEPINGVVNDG  737
            +GE  +GE P RR ++R SGTGRG  IKREGSGRGNWG+ TD E   + EE     +N G
Sbjct  150  DGEPEEGERPARRQFDRHSGTGRGG-IKREGSGRGNWGTLTDQEQVKKPEE----FINRG  204

Query  736  VNTDAFEKQH-GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRP  563
                 FE+   G+ED     K++   E E KEPEDKEMTLDEYEKLLEEKRKA+ A  R 
Sbjct  205  NMHAKFEENPVGEEDGVAVDKENAPAEIEEKEPEDKEMTLDEYEKLLEEKRKALQALQRT  264

Query  562  EERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS----INEFLK  395
            EERKV +DKEFE M  L+ KKNDD+VF+KLGSE++  ++      +        IN FL+
Sbjct  265  EERKVDVDKEFEFMQQLSAKKNDDDVFIKLGSERDSARRRDTADREDLTRRPAIINTFLR  324

Query  394  PAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            PAE E  + PGGRGRGRG   G  G G     +   PSIED G FPTLG
Sbjct  325  PAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPSIEDPGHFPTLG  373



>emb|CDY28966.1| BnaA02g25100D [Brassica napus]
Length=340

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 134/182 (74%), Gaps = 12/182 (7%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
            L+NG   DG    R +ERRSGTGRG+++KREG GRGNWG+P D+I P  EEP   V    
Sbjct  115  LANGRAGDG----RVFERRSGTGRGNDLKREGGGRGNWGTPEDDIPPPTEEPTTEVEKSP  170

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            V     EK+ G+++  DAKKD+P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EE
Sbjct  171  V----AEKEGGEDNTTDAKKDAPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEE  226

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAE  386
            RKV   K FESM  L++KK N++E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA+
Sbjct  227  RKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPAD  285

Query  385  GE  380
            GE
Sbjct  286  GE  287



>ref|XP_011101848.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=369

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 161/230 (70%), Gaps = 11/230 (5%)
 Frame = -3

Query  916  LSNGENADGEYPR--RAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
             SNGE  +G+  R  R ++RRSGTGRG+E+KREG+GR NWG+ TDE+A   EE    VVN
Sbjct  146  FSNGEVGEGDRDRLRRPFDRRSGTGRGNEMKREGAGRANWGTHTDELAEVTEE----VVN  201

Query  742  DGVNTDAFEKQHGQED-AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR  566
            +G  +   EK  G ED   D  K++       ++PEDKEMTL+EYEKLLEEKRKA+ A +
Sbjct  202  EGEKSLNVEKPSGDEDPPADGDKEA-ATTEVEEKPEDKEMTLEEYEKLLEEKRKALQALK  260

Query  565  PEERKVCLDKEFESMALLANKKNDDEVFVKLGS--ekedkkkeagekvkktKSINEFLKP  392
             EERKV + KEFE+M  LANKK +D+VF+KLGS  +K+ +  E  E+ KK+ SINEFLKP
Sbjct  261  TEERKVDV-KEFETMQQLANKKANDDVFIKLGSDKDKKKELAEKEERAKKSVSINEFLKP  319

Query  391  AEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            AEGE YY  GGRGRGRG GS  G  GG+   + E P+IED GQFPTLG K
Sbjct  320  AEGEAYYNRGGRGRGRGRGSRGGYTGGSKMGNAEAPAIEDPGQFPTLGGK  369



>ref|XP_006414219.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
 gb|ESQ55672.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
Length=368

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 129/179 (72%), Gaps = 11/179 (6%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            SNG++ D E+PRR   R SGTG+G+E KR+G+GRGNWG+  DEI P  EE    VV   +
Sbjct  124  SNGDSGDFEHPRR--NRHSGTGQGNEFKRDGAGRGNWGTTEDEITPVTEESTT-VVEKNL  180

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEER  554
               A EK  G+++A    KD+P+ E   +EPEDK MTL+EYEK+LEEKR+A+ A++ EER
Sbjct  181  ---AVEKLGGEDEA---NKDTPVKEKAEEEPEDKSMTLEEYEKVLEEKRQALQATKVEER  234

Query  553  KVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            KV   K FE+M  +++KK N+D+VF+KLG+EK+ +  E  EK KK+ SINEFLKPA+GE
Sbjct  235  KVDT-KAFETMQQISSKKSNNDDVFIKLGTEKDKRTTEKEEKTKKSLSINEFLKPADGE  292



>gb|KFK24045.1| hypothetical protein AALP_AAs42697U000600 [Arabis alpina]
Length=393

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 123/181 (68%), Gaps = 13/181 (7%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            +GE+ D E PRR+Y+R SGTG G+E KREG GRGNWG   D++AP  EE           
Sbjct  139  SGESGDFERPRRSYDRHSGTGHGNEDKREGGGRGNWGIIKDDVAPVTEE---------SK  189

Query  730  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEM--TLDEYEKLLEEKRKAILASRPEE  557
            T A EKQ  + +A DAKK+SP  E    EPE + +  TL+EYEK++EEK+KA+  ++ EE
Sbjct  190  TVAVEKQGSKGEAADAKKESPAKEQAKSEPEPEPVEFTLEEYEKIMEEKKKALEVTKVEE  249

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  380
            RKV   K F+SM  L+NK+ N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKP  G+
Sbjct  250  RKVDT-KVFDSMQQLSNKRSNNDEVFIKLGTEKDKRLVEKEEKAKKSLSINEFLKPVNGK  308

Query  379  T  377
            +
Sbjct  309  S  309



>dbj|BAG90611.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 140/222 (63%), Gaps = 12/222 (5%)
 Frame = -3

Query  880  RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ  701
            RR YER SGTGRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   
Sbjct  3    RRPYERHSGTGRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLDE-KAPVTEKQGAP  59

Query  700  EDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEF  530
            E A  A   K +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ 
Sbjct  60   EGAPQADENKDNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDL  119

Query  529  ESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPA--EGETyyr  368
            +SM  L+NKK +DEVF+KLGS+K+  KK+       + KK+ SINEFLKPA  E     R
Sbjct  120  KSMQPLSNKKENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGR  179

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  180  GRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  221



>dbj|BAE71297.1| hypothetical protein [Trifolium pratense]
Length=371

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 151/229 (66%), Gaps = 11/229 (5%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +   PRR ++R SG+GRG   KREG+GRGNWG+ +DEIA   EE    V N+ 
Sbjct  145  FSNGEAGEEGRPRRTFDRHSGSGRGGGFKREGAGRGNWGTQSDEIAQVTEE----VSNEP  200

Query  736  VNTDAFEKQHGQEDA-GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
                A EK  G EDA  +  KD+P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E
Sbjct  201  EKNVAEEKPAGGEDATAEGNKDAPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQALKTE  260

Query  559  ERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke-agekvkktKSINEFLKPAEG  383
             RKV   KEFESM  L+ KK +DE+F KLGS+K+ +K     EK KK  SINEFLKPAEG
Sbjct  261  GRKVDT-KEFESMKPLSCKKENDEIFAKLGSDKDKRKDAFEKEKAKKALSINEFLKPAEG  319

Query  382  E----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
            E       R G  GRG   GS  GGYGGN  S+   PSIED GQFPTLG
Sbjct  320  EKYYNPGGRGGRGGRGGRGGSRGGGYGGNAYSNVPAPSIEDPGQFPTLG  368



>emb|CDY65881.1| BnaAnng21260D [Brassica napus]
Length=333

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 141/224 (63%), Gaps = 19/224 (8%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            D E PRR YER SG   G E+KR+G+GRGNWG+  D+I P         V +G +T   E
Sbjct  120  DLERPRRNYERHSGAAHGHELKRDGAGRGNWGTIEDDIPP---------VTEG-STPVVE  169

Query  715  KQHGQE---DAGDAKKDSPLdepe--vkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
            K    E   +A DA K++P++       EPEDKEMTL+EYEK+LEEKRKA+ A++ EERK
Sbjct  170  KDLAVEKEGEATDANKETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERK  229

Query  550  VCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETy  374
            V   K FE+M  L++KK N+DEVF+KLG++K+ +  E  EK KK+ SINEFLKPA GE Y
Sbjct  230  VDT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRPVEKEEKTKKSLSINEFLKPANGERY  288

Query  373  --yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  248
                 GGRGRG   G      G +  ++   P IED   FPTLG
Sbjct  289  RGADEGGRGRGAEGGGRGPKGGADRKAAAPAPKIEDAAHFPTLG  332



>ref|XP_004492923.1| PREDICTED: intracellular hyaluronan-binding protein 4-like [Cicer 
arietinum]
Length=373

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 148/227 (65%), Gaps = 7/227 (3%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             SNGE  +   PRR +ERRSGTGRGSE KREG+GRGNWG+ TDEIA   +E +N      
Sbjct  152  FSNGEAGEEGRPRRTFERRSGTGRGSEFKREGAGRGNWGTETDEIAQVTDEAVNEAEK--  209

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
              +   EK   + +  +  KD+P +E E KE EDKEMTL+EYEKLLEEKRK + A + E 
Sbjct  210  -KSSGDEKPAVENEVAEGNKDNPANETEEKEAEDKEMTLEEYEKLLEEKRKVLQALKTEA  268

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEG  383
            RKV   KEFESM  L+ KK++ E+F KLGS+K+ +K+     EK KK+ SINEFLKPAEG
Sbjct  269  RKVDT-KEFESMQALSCKKDNTEIFAKLGSDKDKRKEALDKEEKAKKSVSINEFLKPAEG  327

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E  Y   G        + RGG  GN+ S+   PSIED G FPTLG+K
Sbjct  328  EA-YYNPGGHGRGRGRATRGGIRGNSFSNIPAPSIEDPGHFPTLGAK  373



>ref|XP_004969787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A-like [Setaria italica]
Length=375

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 141/221 (64%), Gaps = 11/221 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG E+KR+G+GRGNWG+ TDE+ A E EE +   V +G      EKQ 
Sbjct  159  PRRNYERHSGTGRGYEMKRDGAGRGNWGTATDEVLAQETEEALK--VEEGAPI--AEKQG  214

Query  706  GQEDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
             Q DA  A   K +      E ++ EDKEMTL+E+EK+ EEKRKA+LA + EER+V +DK
Sbjct  215  EQNDAPAADENKDNKDAAADEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERRVEVDK  274

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPA-EGETyyrp  365
            + +S+  L+NKK +DEVF+KLGS+K+ KK+ A   E+ KK+ SINEFLKPA     Y   
Sbjct  275  DLQSLQPLSNKKENDEVFIKLGSDKDKKKESAERDERAKKSVSINEFLKPAEGERYYGGR  334

Query  364  ggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            G        G   G +GG +      P+IED  QFP+LG K
Sbjct  335  GRGRGRGERGGRGGYFGGYHRGPAAAPAIEDQAQFPSLGGK  375



>ref|XP_002440127.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
 gb|EES18557.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
Length=373

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 150/236 (64%), Gaps = 23/236 (10%)
 Frame = -3

Query  895  DGEY-------PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVND  740
            DGE+       PRR YER SGTGRG E+KREGSGRGNWG+ TDE IA E EE +      
Sbjct  143  DGEFGDDSERPPRRPYERHSGTGRGFEMKREGSGRGNWGTTTDEFIARETEEGLKLEEKA  202

Query  739  GVNTDAFEKQHGQEDAGDAK-----KDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
             V     EKQ   ED   A+     KD+     E ++ EDKEMTL+E+EK+ EEKRK++L
Sbjct  203  PVP----EKQGALEDTPQAEENKENKDA-TANEEEEKEEDKEMTLEEFEKIREEKRKSLL  257

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSIN  407
            A + EERKV +D++ +SM  LANKK +DE+FVKLGS+K+  KK+       + KK+ SIN
Sbjct  258  ALKTEERKVEVDRDLQSMQPLANKKGNDEIFVKLGSDKDALKKKENADRDERAKKSVSIN  317

Query  406  EFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  242
            EFLKPAEGE YY   GRGRGRG   G  G  G    +    P+I+D  QFP+LG K
Sbjct  318  EFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYHAPPAAPAIQDQSQFPSLGGK  373



>ref|NP_001056139.1| Os05g0533100 [Oryza sativa Japonica Group]
 dbj|BAF18053.1| Os05g0533100, partial [Oryza sativa Japonica Group]
Length=286

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 140/222 (63%), Gaps = 12/222 (5%)
 Frame = -3

Query  880  RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ  701
            RR YER SGTGRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   
Sbjct  68   RRPYERHSGTGRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLDE-KAPVTEKQGAP  124

Query  700  EDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEF  530
            E A  A   K +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ 
Sbjct  125  EGAPQADENKDNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDL  184

Query  529  ESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPA--EGETyyr  368
            +SM  L+NKK +DEVF+KLGS+K+  KK+       + KK+ SINEFLKPA  E     R
Sbjct  185  KSMQPLSNKKENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGR  244

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  245  GRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  286



>gb|KDO57094.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=342

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 156/227 (69%), Gaps = 31/227 (14%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG                      E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRG----------------------ETEEP----VAETE  177

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  178  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  236

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  237  RKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  296

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  297  ERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  342



>ref|XP_009108276.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Brassica rapa]
Length=342

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 144/221 (65%), Gaps = 16/221 (7%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG  704
            PRR +ERRSGTGRG + KREG+GRGNWG+P +E+     E + G           EK  G
Sbjct  131  PRRTFERRSGTGRGGDFKREGAGRGNWGTPGEEVLVVETEEVAGA--------EIEKPAG  182

Query  703  QEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  524
             E   DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV   K FES
Sbjct  183  DEVVADAKKENAAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT-KVFES  241

Query  523  MALLAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrg  347
            M  L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR GGRG G
Sbjct  242  MQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGGRGGG  301

Query  346  rghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
            RG G G    G  +   F+       P+I D  QFP+LG K
Sbjct  302  RGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  342



>ref|XP_006440206.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 ref|XP_006440207.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53446.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53447.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=342

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 157/227 (69%), Gaps = 31/227 (14%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG                      E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRG----------------------ETEEP----VAETE  177

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  178  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  236

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  237  RKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  296

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  ++S+   P IED GQFP+LG K
Sbjct  297  ERYFNPSGRGRGRGRGSRGGYGGSTSSSAA-APKIEDPGQFPSLGGK  342



>ref|XP_003567795.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brachypodium distachyon]
Length=381

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 137/234 (59%), Gaps = 20/234 (9%)
 Frame = -3

Query  892  GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAP-EAEEPINGVVNDGVNTDAFE  716
            G  P R YERRSGTGRG  +KR+G+GRGNWG+ TDE  P E  EP+N    +       E
Sbjct  151  GGRPHRPYERRSGTGRGFGMKRDGAGRGNWGTVTDEGLPQETVEPVN---TEETAAAVAE  207

Query  715  KQHGQEDAGDA-----KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
             +   EDA        K+ +  +E E +  EDKEMTL+EYEK+LEEKRKA+LA + EERK
Sbjct  208  DEKKPEDAPPTEVEKDKEGAVNEEEEKEAEEDKEMTLEEYEKVLEEKRKALLALKAEERK  267

Query  550  VCLDKEFESMALLANKKNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGE  380
            V +DKE +SM  L+ KK  DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE
Sbjct  268  VEVDKELQSMQQLSVKKVADEVFIKLGSDKELKKKENAEREERAKKSLSINEFLKPAEGE  327

Query  379  TyyrpggrgrgrghgsgrggygGNNTSSFE--------TPSIEDVGQFPTLGSK  242
             Y   G        G G    G N               P+IED  QFPTLG K
Sbjct  328  RYNPGGRGRGRGFRGRGELRGGYNGGGYNGGGGRRQAPAPAIEDQAQFPTLGGK  381



>ref|XP_006477113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Citrus sinensis]
Length=342

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 156/227 (69%), Gaps = 31/227 (14%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            ++GE+ +GE PRR +ERRSGTGRG                      E EEP    V +  
Sbjct  144  NDGESKEGERPRRVFERRSGTGRG----------------------ETEEP----VAETE  177

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEE  557
            NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EE
Sbjct  178  NTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEE  236

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEG  383
            RKV +D+EF+SM  L+NKK++D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEG
Sbjct  237  RKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEG  296

Query  382  ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  297  ERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  342



>emb|CDY35615.1| BnaC01g21370D [Brassica napus]
Length=338

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 138/218 (63%), Gaps = 15/218 (7%)
 Frame = -3

Query  874  AYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED  695
            A+ERRSGTGRG + KREG+GRGNWG+P +E+     E + GV  +    D  EK      
Sbjct  129  AFERRSGTGRGGDFKREGAGRGNWGTPGEEVLAVETEEVAGVETE---KDVVEKPADD--  183

Query  694  AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMAL  515
              DA K++  +  E KEPE KEMTLDEYEK+LEEKRKA+ +    ERKV   K FESM  
Sbjct  184  --DANKENTAEVEEQKEPEVKEMTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQ  240

Query  514  LAN-KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrgh  338
            L+N KK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPA+GE YYR G  GRGRG 
Sbjct  241  LSNKKKSNDEIFIKLGSDKDKRKDDKEEKPKKAVSINEFLKPADGENYYRGGRGGRGRGG  300

Query  337  gsgrggygGNNTSSF------ETPSIEDVGQFPTLGSK  242
               R      ++  +        P+I D  QFP+LG K
Sbjct  301  RESRDRGARASSGGYGGNRSEAAPAIADTAQFPSLGGK  338



>ref|NP_001281195.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACF84633.1| unknown [Zea mays]
 gb|ACR38621.1| unknown [Zea mays]
 tpg|DAA57852.1| TPA: hypothetical protein ZEAMMB73_322547 [Zea mays]
Length=378

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 148/224 (66%), Gaps = 14/224 (6%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTG G E+KR+G+GRGNWG+ TDE IA +AE+         V     EKQ 
Sbjct  159  PRRNYERHSGTGHGYEMKRDGAGRGNWGTATDELIAQDAEDSPKMEEAAPV----AEKQG  214

Query  706  GQEDA--GDAKKDS--PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  539
             Q DA   D  KD+       E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERKV +D
Sbjct  215  EQNDAPAADENKDNKDATANEEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERKVEVD  274

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyyrp  365
            K+ +S+  L+NKK +DEVF+KLGS+K+ KK+ A   E+ KK+ SINEFLKPAEGE YY  
Sbjct  275  KDLQSLQPLSNKKENDEVFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGG  334

Query  364  ggrgrgrghgsgrggygGNNTS---SFETPSIEDVGQFPTLGSK  242
             GRGRGRG   G  G  G   S   +   PSIED  QFP+LG K
Sbjct  335  RGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGGK  378



>gb|EYU40365.1| hypothetical protein MIMGU_mgv1a008102mg [Erythranthe guttata]
Length=385

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 167/242 (69%), Gaps = 17/242 (7%)
 Frame = -3

Query  934  GDRRGGLSNGENADGE--YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEP  761
            G RRGG SNG+  +GE   PRR  +RRSGTGRG+E KREG+GRGNWG+ TDE+A   EE 
Sbjct  149  GGRRGGFSNGDAGEGEGDRPRRPLDRRSGTGRGNEFKREGAGRGNWGTHTDELAEVTEE-  207

Query  760  INGVVNDGVNTDAFEKQHGQEDA---GDAKKDSPLdepevkepedkEMTLDEYEKLLEEK  590
                V +G    + EK  G+ DA   GD +  +   E E KEPEDKEMTL+EYEK+LEEK
Sbjct  208  ---AVIEGEKAPSVEKPSGEVDATADGDKEAAA-ATEVEEKEPEDKEMTLEEYEKVLEEK  263

Query  589  RKAILASRP--EERKVCLDKEFESMALLANKK-NDDEVFVKLGS--ekedkkkeagekvk  425
            RK++LA +   E RKV + KEFESM  L++KK ++D++F+KLGS  +K+ +  E  E+ K
Sbjct  264  RKSLLALKADSEARKVDV-KEFESMQQLSSKKRSNDDIFIKLGSEKDKKKELAEKEERAK  322

Query  424  ktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLG  248
            K+ SINEFLKPAEGE +Y  GGRGRGRG GS  GG  G   + +   P+IED GQFPTLG
Sbjct  323  KSVSINEFLKPAEGERHYSSGGRGRGRGRGSRGGGGYGVGGNENVRAPAIEDPGQFPTLG  382

Query  247  SK  242
             K
Sbjct  383  GK  384



>gb|EEE64473.1| hypothetical protein OsJ_19323 [Oryza sativa Japonica Group]
Length=392

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 140/222 (63%), Gaps = 12/222 (5%)
 Frame = -3

Query  880  RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ  701
            RR YER SGTGRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   
Sbjct  174  RRPYERHSGTGRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAP  230

Query  700  EDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEF  530
            E A  A   K +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ 
Sbjct  231  EGAPQADENKDNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDL  290

Query  529  ESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPA--EGETyyr  368
            +SM  L+NKK +DEVF+KLGS+K+  KK+       + KK+ SINEFLKPA  E     R
Sbjct  291  KSMQPLSNKKENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGR  350

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  351  GRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  392



>gb|ABD65145.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY09622.1| BnaC07g34390D [Brassica napus]
Length=353

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 126/177 (71%), Gaps = 11/177 (6%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG  737
             ++GE+ D E PRR ++R+SGTG G+  KR+G+GRGNWG+  DEI P  EE    VV   
Sbjct  121  FNSGESGDFERPRRNFDRQSGTGHGNGFKRDGAGRGNWGTNEDEIPPVTEESA-AVVEKS  179

Query  736  VNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEE  557
            +   A EK+    +A DA K++P+   E  EPEDKEMTL+EYEK+LEEKRKA+ A++ EE
Sbjct  180  L---AAEKEG---EATDANKETPV--EEKAEPEDKEMTLEEYEKVLEEKRKALQATKIEE  231

Query  556  RKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  389
            RKV   K FE+M  L+NKK N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA
Sbjct  232  RKVDT-KVFETMQQLSNKKSNNDEVFIKLGTEKDKRPVEKEEKTKKSLSINEFLKPA  287



>gb|EEC79581.1| hypothetical protein OsI_20751 [Oryza sativa Indica Group]
Length=381

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 140/222 (63%), Gaps = 12/222 (5%)
 Frame = -3

Query  880  RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ  701
            RR YER SGTGRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   
Sbjct  163  RRPYERHSGTGRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAP  219

Query  700  EDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEF  530
            E A  A   K +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ 
Sbjct  220  EGAPQADENKDNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDL  279

Query  529  ESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPA--EGETyyr  368
            +SM  L+NKK +DEVF+KLGS+K+  KK+       + KK+ SINEFLKPA  E     R
Sbjct  280  KSMQPLSNKKENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGR  339

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  340  GRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  381



>gb|KFK22256.1| hypothetical protein AALP_AAs66747U001100 [Arabis alpina]
Length=374

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 139/220 (63%), Gaps = 16/220 (7%)
 Frame = -3

Query  871  YERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN--DGVNT--DAFEKQHG  704
            +ERRSGTGRGS+ KR+GSGRGNWG+P +E+    ++ + G     DGV T  +  EK  G
Sbjct  161  FERRSGTGRGSDFKRDGSGRGNWGTPGEEV---FDQTLTGETKEGDGVETEKNVVEKPAG  217

Query  703  QEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  524
             + A D+ K++       +E E ++MTLDEYEK+LEEK+KA+ +    ERKV   K FES
Sbjct  218  DDVAADSIKEN--TTEAEEEKEPEQMTLDEYEKILEEKKKALQSETVSERKVDT-KVFES  274

Query  523  MALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgr  344
            M  L+NKK++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE Y+R GGRG   
Sbjct  275  MQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYHRGGGRGGRG  334

Query  343  ghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
              G G  G        F        P+I D  QFP+LG K
Sbjct  335  RGGRGGRGGNSTGGGGFAGYRNEPAPAIADTAQFPSLGGK  374



>gb|AAT47083.1| unknown protein [Oryza sativa Japonica Group]
Length=390

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 140/222 (63%), Gaps = 12/222 (5%)
 Frame = -3

Query  880  RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ  701
            RR YER SGTGRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   
Sbjct  172  RRPYERHSGTGRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAP  228

Query  700  EDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEF  530
            E A  A   K +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ 
Sbjct  229  EGAPQADENKDNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDL  288

Query  529  ESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPA--EGETyyr  368
            +SM  L+NKK +DEVF+KLGS+K+  KK+       + KK+ SINEFLKPA  E     R
Sbjct  289  KSMQPLSNKKENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGR  348

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
              GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  349  GRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  390



>gb|EMS68133.1| hypothetical protein TRIUR3_26332 [Triticum urartu]
Length=785

 Score =   130 bits (326),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 140/236 (59%), Gaps = 21/236 (9%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG  704
            PRR YER SGTGRG EIKREG+GRGNWG+ +DE   +  E     +       A EKQ  
Sbjct  155  PRRNYERHSGTGRGYEIKREGAGRGNWGTTSDEFVAQETE----ALKQDEKAPAPEKQGA  210

Query  703  QEDAGDAKKDSPL----depevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLD  539
             EDA  A ++ P        E ++ ED EMTLDE+EK++EEKRKA+ A  + EERKV +D
Sbjct  211  PEDAPQADENKPTKDGATVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSEERKVEID  270

Query  538  KEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAEGETyy  371
            K+ ++M LL+ KK +DEVF+KLG++KE  KK+       + KK+ SINEFLKPAEGE +Y
Sbjct  271  KDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKPAEGERFY  330

Query  370  rpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGSK*GIKPFLPSS  212
               GRG       G    G            P+I+D  QFPTLG K     FL SS
Sbjct  331  GGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGGK-----FLMSS  381



>ref|XP_008675099.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Zea mays]
 gb|ACG33523.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 tpg|DAA57847.1| TPA: plasminogen activator inhibitor 1 RNA-binding protein [Zea 
mays]
Length=378

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 144/228 (63%), Gaps = 22/228 (10%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEI-------APEAEEPINGVVNDGVNTD  725
            PRR YER SGTG G E+KR+G+GRGNWG+ TDE+       +P+ EE        G   D
Sbjct  159  PRRNYERHSGTGHGYEMKRDGAGRGNWGTATDELIAQDAEDSPKMEEAAPVAEKQGEQID  218

Query  724  AFEKQHGQEDAGDAKKDS--PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
            A         A D  KD+       E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERK
Sbjct  219  A--------PAADENKDNKDATANEEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERK  270

Query  550  VCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGET  377
            V +DK+  S+  L+NKK +DEVF+KLGS+K+ KK+ A   E+ KK+ SINEFLKPAEGE 
Sbjct  271  VEVDKDLRSLQPLSNKKENDEVFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGER  330

Query  376  yyrpggrgrgrghgsgrggygGNNTS---SFETPSIEDVGQFPTLGSK  242
            YY   GRGRGRG   G  G  G   S   +   PSIED  QFP+LG K
Sbjct  331  YYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGGK  378



>ref|NP_001275394.1| nuclear RNA binding protein [Solanum tuberosum]
 emb|CAR64523.1| nuclear RNA binding protein [Solanum tuberosum]
Length=360

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 151/224 (67%), Gaps = 7/224 (3%)
 Frame = -3

Query  910  NGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN  731
            N E  +G+ PRR +ERRSGTGRG+EIKREG+GRGNWG+  DE+     E    V ++G  
Sbjct  143  NEEMPEGDRPRRTFERRSGTGRGNEIKREGAGRGNWGTEADEVTQMTGE----VADEGEK  198

Query  730  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
                EK   +E+AGD KK++P  E E KEPEDKEMTL+EYEKLLEEKRKA+ A + EERK
Sbjct  199  NLNVEKPSTEEEAGDDKKENPAAEAEDKEPEDKEMTLEEYEKLLEEKRKALQALKTEERK  258

Query  550  VCLDKEFESMALLANKKNDDEVFVKLGSe-kedkkkeagekvkktKSINEFLKPAEGETy  374
            V   K FESM  ++ KK  DE+FVKLGS+ K  +  E  EK KK  SINEFLKPAEGE Y
Sbjct  259  VDT-KVFESMQQIS-KKPSDEIFVKLGSKDKRKESAEKEEKAKKAVSINEFLKPAEGERY  316

Query  373  yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            Y PGGRGRGRG GS         ++    P IED G FPTLG K
Sbjct  317  YAPGGRGRGRGRGSRGYSGANTMSNVEAAPPIEDPGHFPTLGGK  360



>gb|EMT09866.1| hypothetical protein F775_32096 [Aegilops tauschii]
Length=339

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 146/228 (64%), Gaps = 18/228 (8%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG  +KR+G+GRGNWGS TDE +A E +E +   + D  N    EKQ 
Sbjct  116  PRRNYERHSGTGRGQGMKRDGAGRGNWGSSTDEGLAQETDEALK--IED--NAPIAEKQG  171

Query  706  GQEDAGDA---KKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCL  542
             Q+DA      KKD      + E +  EDKEMTL+E+EK+ EE+RKA+LA + EERKV +
Sbjct  172  EQDDAPPTTVEKKDHKDGAAKEEEENEEDKEMTLEEFEKIREEQRKALLALKTEERKVEV  231

Query  541  DKEFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyyr  368
            DK+ +S+  L+ KK +DEVF+KLGS+KE KK+     E+ KK+ SINEFLKPAEGE YY 
Sbjct  232  DKDLQSLQPLSTKKANDEVFIKLGSDKEKKKESTERDERAKKSLSINEFLKPAEGERYYG  291

Query  367  pggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
              GRGRGRG G G  G                 PSIED  QFPTLG K
Sbjct  292  GRGRGRGRGEGRGDRGGFRGGFGGGYQHGQAAAPSIEDQSQFPTLGGK  339



>dbj|BAJ96699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 144/246 (59%), Gaps = 34/246 (14%)
 Frame = -3

Query  916  LSNGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVN  743
             S+G+N D E+  P R+YERRSGTGRG  +KR+G+GRGNWG+ TDE  P+          
Sbjct  137  YSDGQNTD-EFGRPHRSYERRSGTGRGFGMKRDGAGRGNWGTATDEGFPQE---------  186

Query  742  DGVNTDAFEKQHGQEDAGDAK--KDSPLdepev------------kepedkEMTLDEYEK  605
               N +A   +     A DAK  +D+PL E E             +  EDKEMTL+EYEK
Sbjct  187  ---NVEAVNTEETPAVAEDAKTPEDAPLPEAEKVKEGAENAEEEKEAEEDKEMTLEEYEK  243

Query  604  LLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvk  425
            +LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS+KE KK  A  + +
Sbjct  244  VLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKDNAEREER  303

Query  424  ktKS--INEFLKPAE---GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  260
              KS  INEFLKPAE          G   RGRG   G    GG        P+IED  QF
Sbjct  304  AKKSLNINEFLKPAEGERYNGGRGRGRGFRGRGEPRGGYNGGGGGRRPAAAPAIEDQSQF  363

Query  259  PTLGSK  242
            PTLG K
Sbjct  364  PTLGGK  369



>gb|AAF14246.1|AF110230_1 nuclear RNA binding protein C [Spinacia oleracea]
Length=247

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 128/183 (70%), Gaps = 5/183 (3%)
 Frame = -3

Query  934  GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN  755
            G RRGG +N E  DGE PRR +ERRSGTGRGSE+K    G GNWG+ ++E+AP  EE   
Sbjct  23   GGRRGGFNNEEGRDGERPRRTFERRSGTGRGSEVKHRVLGAGNWGAESEEVAPVNEE---  79

Query  754  GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAIL  575
            GV     N ++ E     EDA    K+   +E E KEPE+KEMTL+EYEKLLEEKRKA+L
Sbjct  80   GVEQTEKNVNS-ENLTAVEDAAVGNKEGQPEEAEEKEPEEKEMTLEEYEKLLEEKRKALL  138

Query  574  ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS-ekedkkkeagekvkktKSINEFL  398
            A + EE KV +DKE ESM  L+NKK+DD VF+KLGS + + K+    EKVKK+ SINEFL
Sbjct  139  ALKSEEPKVVVDKELESMQQLSNKKDDDSVFIKLGSDKDKKKEALEKEKVKKSVSINEFL  198

Query  397  KPA  389
            KPA
Sbjct  199  KPA  201



>dbj|BAJ89734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 136/227 (60%), Gaps = 19/227 (8%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG  704
            PRR YER SGTGRG E+KREG+GRGNWG+  + +A E E      +       A EKQ  
Sbjct  155  PRRNYERHSGTGRGYEMKREGAGRGNWGASDEFVAQETE-----ALKQDEKAPAPEKQGA  209

Query  703  QEDA-----GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCL  542
            +EDA       A KD      E ++ ED EMTLDE+EK++EEKRKA+ A  + EERKV +
Sbjct  210  REDAPKADENKASKDG-AAVVEEEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEI  268

Query  541  DKEFESMALLANKKNDDEVFVKLGSekedkkkeagek----vkktKSINEFLKPAEGETy  374
            DK+ ++M LL+ KK +DEVF+KLG++KE  KK+   +     KK+ SINEFLKPAEGE +
Sbjct  269  DKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKPAEGERF  328

Query  373  yrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  242
            Y   GRG       G    G            P+I+D  QFPTLG K
Sbjct  329  YGGRGRGGRGRGDRGGFRGGFGGGGYHNPPPAPAIQDQNQFPTLGGK  375



>emb|CDY33522.1| BnaA06g35510D [Brassica napus]
Length=327

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 145/233 (62%), Gaps = 20/233 (9%)
 Frame = -3

Query  916  LSNGENADGEY-PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVND  740
             +NG+  D E  P+R Y+R S TGR +++KREG+GRGNWG+  D+  P   EP   V   
Sbjct  104  FANGKTGDVEQRPKRVYDRHSRTGRSNDVKREGAGRGNWGTTEDDTPPPTVEPTTEVEKS  163

Query  739  GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
             V  D         D  DAKKDSP  E E KEPEDKEMTL+EYEK+LEEK+KA+ A++ E
Sbjct  164  PVAED---------DTTDAKKDSPAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVE  214

Query  559  ERKVCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPA  389
            ERKV   K FESM  L+NKK ND+E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA
Sbjct  215  ERKVDT-KVFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKPA  273

Query  388  EGETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLG  248
            +GE Y  P G  RGRG   GR    G      +       P+I D  QFP+LG
Sbjct  274  DGERYNNPRGGYRGRGGRGGRRDGRGQRDGGNQRHGGAPAPAIGDSAQFPSLG  326



>emb|CDY38403.1| BnaC01g10120D [Brassica napus]
Length=336

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 140/226 (62%), Gaps = 20/226 (9%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAP--EAEEPINGVVNDGVNTDA  722
            D E PRR +ER SGT  G E+KR+G+GRGNWG+  D+I P  E   P+       V TD 
Sbjct  120  DLERPRRNFERHSGTAHGHELKRDGAGRGNWGTIEDDIPPVTEGSTPV-------VETDL  172

Query  721  FEKQHGQEDAGDAKKDSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKV  548
              ++ G+  A DA  ++P++    KEPE ++  MTL+EYEK+LEEKRKA+ A++ EERKV
Sbjct  173  AVEKEGE--ATDANNETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKV  230

Query  547  CLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyy  371
               K FE+M  L++KK N+DEVF+KLG++K+ +  E  EK KK+ SINEFLKPA GE Y 
Sbjct  231  DT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRPVEKEEKTKKSLSINEFLKPANGERYR  289

Query  370  rpggrgrgrghgsgrg-----gygGNNTSSFETPSIEDVGQFPTLG  248
                 GRGRG             G +  ++   P IED   FPTLG
Sbjct  290  GGYRGGRGRGPRGADEGGRGPKGGADRKAAAPAPKIEDAAHFPTLG  335



>ref|XP_004229741.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=360

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 149/222 (67%), Gaps = 7/222 (3%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  +G+ PRR +ERRSGTGRGSEIKREG+GRGNWG+  DE+     E    V ++G    
Sbjct  145  EMPEGDRPRRTFERRSGTGRGSEIKREGAGRGNWGTEADEVTLMTGE----VADEGEKNL  200

Query  724  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
              EK   +E+AG  KK++P  E   KEPEDKEMTL+EYEKLLEEKRKA+ A + EERKV 
Sbjct  201  NVEKPSTEEEAGVDKKENPAAEAADKEPEDKEMTLEEYEKLLEEKRKALQALKTEERKVD  260

Query  544  LDKEFESMALLANKKNDDEVFVKLGSe-kedkkkeagekvkktKSINEFLKPAEGETyyr  368
              K FESM  ++ KK+ DE+FVKLGS+ K  +  E  EK KK  SINEFLKPAEGE YY 
Sbjct  261  T-KVFESMQQIS-KKSSDEIFVKLGSKDKRKESAEKEEKAKKAVSINEFLKPAEGERYYA  318

Query  367  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            PGGRGRGRG GS         ++    P IED G FPTLG K
Sbjct  319  PGGRGRGRGRGSRGYSEANTMSNVEAAPPIEDPGHFPTLGGK  360



>gb|EMS59053.1| hypothetical protein TRIUR3_33029 [Triticum urartu]
Length=296

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 145/228 (64%), Gaps = 18/228 (8%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG  +KR+G+GRGNWGS TDE +A E +E +   + D  N    EKQ 
Sbjct  73   PRRNYERHSGTGRGQGMKRDGAGRGNWGSSTDEGLAQETDEALK--IED--NAPIAEKQG  128

Query  706  GQEDAGDAKKDSP-----LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCL  542
             Q+DA     ++        + E +  EDKEMTL+E+EK+ EE+RKA+LA + EERKV +
Sbjct  129  EQDDAPPTTVENKDLKDGAAKEEEENEEDKEMTLEEFEKIREEQRKALLALKTEERKVEV  188

Query  541  DKEFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyyr  368
            DK+ +S+  L+ KK +DEVF+KLGS+KE KK+     E+ KK+ SINEFLKPAEGE YY 
Sbjct  189  DKDLQSLQPLSTKKANDEVFIKLGSDKEKKKESTERDERAKKSLSINEFLKPAEGERYYG  248

Query  367  pggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
              GRGRGRG G G  G                 PSIED  QFPTLG K
Sbjct  249  GRGRGRGRGEGRGDRGGFRGGFGGGYQRGQAAAPSIEDRSQFPTLGGK  296



>gb|EMT08444.1| hypothetical protein F775_29168 [Aegilops tauschii]
Length=833

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 115/252 (46%), Positives = 145/252 (58%), Gaps = 33/252 (13%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEA-------EEPINGVVNDGVNTD  725
            PRR YER+SGTGRG EIKREG+GRGNWG+ +DEI  +         E   GVV     T+
Sbjct  155  PRRNYERQSGTGRGYEIKREGAGRGNWGTTSDEIVAQLFIRRVVKWEVTCGVVLVTRETE  214

Query  724  AF---------EKQHGQEDAGDAKKDSPL----depevkepedkEMTLDEYEKLLEEKRK  584
            A          EKQ   EDA  A ++          E ++ ED EMTLDE+EK++EEKRK
Sbjct  215  ALKQDEKAPAPEKQGAPEDAPQADENKATKDGAAVVEEEKEEDNEMTLDEFEKVMEEKRK  274

Query  583  AILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkkt  419
            A+ A  + EERKV +DK+ ++M LL+ KK +DEVF+KLG++KE  KK+       + KK+
Sbjct  275  ALAALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKS  334

Query  418  KSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLG  248
             SINEFLKPAEGE +Y   GRG       G    G            P+I+D  QFPTLG
Sbjct  335  VSINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLG  394

Query  247  SK*GIKPFLPSS  212
             K     FL SS
Sbjct  395  GK-----FLLSS  401



>ref|XP_003569708.1| PREDICTED: RNA-binding protein FUS-like [Brachypodium distachyon]
Length=377

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 140/222 (63%), Gaps = 10/222 (5%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG  +KR+G+GRGNWGS TDE +A E +E +   + D       + +H
Sbjct  158  PRRNYERHSGTGRGFGMKRDGAGRGNWGSSTDEGLAQETDEALK--IEDNAPIAEKQDEH  215

Query  706  GQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  533
                  +  KD+     + E +  EDKEMTL+E+EK+ EEKRKA+LA + EERKV LDK+
Sbjct  216  DDPPTTEENKDNKDVAAKEEEENEEDKEMTLEEFEKIREEKRKALLALKTEERKVELDKD  275

Query  532  FESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyyrpgg  359
             +S+  L+ KK +DE+F+KLGS+K+ KK+ A   E+ KK+ SINEFLKPAEGE YY   G
Sbjct  276  LQSLQPLSTKKANDEIFIKLGSDKDKKKESAERDERAKKSVSINEFLKPAEGERYYGGRG  335

Query  358  rgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  242
            RGRG     G    G            PSI+D  +FPTLG K
Sbjct  336  RGRGGRGDRGGFRGGYGGGGYQRGPAAPSIQDQAEFPTLGGK  377



>emb|CDM84169.1| unnamed protein product [Triticum aestivum]
Length=381

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 145/229 (63%), Gaps = 20/229 (9%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR YER SGTGRG  +KR+G+GRGNWGS TDE +A E +E +   + D  N    EKQ 
Sbjct  158  PRRNYERHSGTGRGQGMKRDGAGRGNWGSSTDEGLAQETDEALK--IED--NAPIAEKQG  213

Query  706  GQEDAGDA------KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
             Q+DA          KD    + E +  EDKEMTL+E+EK+ EE+RKA+LA + EERKV 
Sbjct  214  EQDDAPPTTVENKDHKDG-AAKEEEENEEDKEMTLEEFEKIREEQRKALLALKTEERKVE  272

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeag--ekvkktKSINEFLKPAEGETyy  371
            +DK+ +S+  L+ KK +DEVF+KLGS+KE KK+     E+ KK+ SINEFLKPAEGE YY
Sbjct  273  VDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKESTERDERAKKSLSINEFLKPAEGERYY  332

Query  370  rpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  242
               GRGRGRG G G  G                 PSIED  QFPTLG K
Sbjct  333  GGRGRGRGRGEGRGDRGGFRGGFGGGYQRGQAAAPSIEDQSQFPTLGGK  381



>ref|XP_009130695.1| PREDICTED: intracellular hyaluronan-binding protein 4-like [Brassica 
rapa]
Length=347

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 119/175 (68%), Gaps = 17/175 (10%)
 Frame = -3

Query  895  DGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFE  716
            D E PRR +ER SGT  G E+KR+G+GRGNWG+  D+I P         V +G +T   E
Sbjct  121  DLERPRRNFERHSGTAHGHELKRDGAGRGNWGTIEDDIPP---------VTEG-STPVVE  170

Query  715  KQHGQE---DAGDAKKDSPLdepe--vkepedkEMTLDEYEKLLEEKRKAILASRPEERK  551
            K    E   +A DA K++P++       EPEDKEMTL+EYEK+LEEKRKA+ A++ EERK
Sbjct  171  KDLAVEKEGEASDANKETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERK  230

Query  550  VCLDKEFESMALLANKK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  389
            V   K FE+M  L++KK N+DEVF+KLG++K+ +  E  EK KK+ SINEFLKPA
Sbjct  231  VDT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRPVEKEEKTKKSLSINEFLKPA  284



>ref|XP_002991714.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
 gb|EFJ07285.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
Length=421

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 135/218 (62%), Gaps = 9/218 (4%)
 Frame = -3

Query  889  EYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQ  710
            +YPRR Y+R++ TGR + IKR+G+GRGNWG+P D ++ E    I GV  DG   +A E +
Sbjct  211  DYPRRQYDRKNTTGRSTGIKRDGAGRGNWGTPIDPVSVEEGNAIEGVKLDGAKLEAPEAE  270

Query  709  HGQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDK  536
              + +A    +++P   +E + +E E+KEMTLDEYEK++EEKRKA+ A + EERKV  D 
Sbjct  271  APKSEAA---QETPEVTEEQKEEEKEEKEMTLDEYEKVMEEKRKALTAMKSEERKVVADS  327

Query  535  EFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggr  356
            EF+ M L+ +KK D+++F+KLG++K  KK+   +   K     EF K    E   + GGR
Sbjct  328  EFQKMQLV-DKKADEDIFIKLGADKAKKKEGEKDDKTKKSVPIEFRK---SEAENQYGGR  383

Query  355  grgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            G  RG G GRG       SS   P I D  QFP+LG K
Sbjct  384  GGNRGRGRGRGLNNNTRLSSSSAPEIADFQQFPSLGGK  421



>ref|XP_008459800.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=364

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 152/239 (64%), Gaps = 32/239 (13%)
 Frame = -3

Query  916  LSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEE---------  764
              NG+  DGE PR  +ER SGTGRG+E KREGSGRGNWG  TDE    AEE         
Sbjct  144  FYNGDTDDGERPRGVFERHSGTGRGNEFKREGSGRGNWGRSTDEFPEVAEEANESQKLGD  203

Query  763  --PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEK  590
              P++     GVNT+   K+  +++  D +                 MTL+EYEKLLEEK
Sbjct  204  EKPVHEDGTAGVNTENTAKESEEKEPEDKE-----------------MTLEEYEKLLEEK  246

Query  589  RKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkk--keagekvkktK  416
            RK++LA + EERKV   KEF S+  L++KK + +VF+KLGS+K+ +K   +  E+ KK+ 
Sbjct  247  RKSLLALKTEERKVD-PKEFASLQQLSSKKENQDVFIKLGSDKDKRKEIADKEERTKKSV  305

Query  415  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVGQFPTLGSK  242
            SINEFLKPA+GE +Y PGGRGRGRG GS  GGY  ++ SS    PSIED GQFPTLG+K
Sbjct  306  SINEFLKPADGERHYTPGGRGRGRGRGSRGGGYVSSSMSSNVAAPSIEDPGQFPTLGAK  364



>ref|XP_006655517.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=363

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 105/162 (65%), Gaps = 8/162 (5%)
 Frame = -3

Query  937  NGDRRGGLSN-GENADGE-YPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEE  764
             G RRGG  + G   D E  PRR YER SGTGRG E+KREG+GRGNWG+  DEI   A+E
Sbjct  136  QGGRRGGFRDSGYGDDSERVPRRPYERHSGTGRGYEMKREGAGRGNWGTTADEIL--AQE  193

Query  763  PINGVVNDGVNTDAFEKQHGQEDAGDA---KKDSPLdepevkepedkEMTLDEYEKLLEE  593
                +  D       EKQ   EDA  A   K +      E ++ EDKEMTL+E+EKL EE
Sbjct  194  TGEALKLD-EKAPVSEKQSPLEDAPQADENKDNKDATPKEEEKEEDKEMTLEEFEKLREE  252

Query  592  KRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  467
            KRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  253  KRKALLSLKTEERKVEIDKDLQSMQPLSNKKENDEVFIKLGS  294



>ref|XP_006414295.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
 gb|ESQ55748.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
Length=294

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 102/145 (70%), Gaps = 6/145 (4%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNT  728
            E+ +GE PRR +ERRSGTGRG + KREGSGRGNWG+P +E+ A E EE    V       
Sbjct  138  EDGEGERPRRTHERRSGTGRGGDFKREGSGRGNWGTPGEEVFAGETEE----VAGAETEK  193

Query  727  DAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
            +A EK  G + A DA K++  +  E KEPE+KEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  194  NAVEKPAGDDVAADANKENTAEAEEEKEPENKEMTLDEYEKILEEKKKALQSQTTSERKV  253

Query  547  CLDKEFESMALLANKKNDDEVFVKL  473
               K FESM  L+NKK++DE+F+K+
Sbjct  254  DT-KVFESMQQLSNKKSNDEIFIKV  277



>ref|XP_003568032.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1 
[Brachypodium distachyon]
Length=376

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 142/228 (62%), Gaps = 18/228 (8%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQH  707
            PRR +ER SGTGRG E+KREG+GRGNWG+ +DE +A E  E     +     T   EKQ 
Sbjct  153  PRRNHERHSGTGRGYEMKREGAGRGNWGTTSDEFLAQETGE----TLKLDEKTPIPEKQG  208

Query  706  G--QEDAGDAKKDS----PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  545
                EDA  A++           E ++ EDKEMTL+E+EK+LEEKRKA+LA + EERKV 
Sbjct  209  ALLTEDAPQAEESKVSKEATVNEEEEKEEDKEMTLEEFEKVLEEKRKALLALKSEERKVE  268

Query  544  LDKEFESMALLANKKNDDEVFVKLGSekedkkkeagek----vkktKSINEFLKPAEGET  377
            +DK+ ++M  L+ KK +DEVF+KLGS+K+  KK+   +     KK+ SINEFLKPAEGE 
Sbjct  269  IDKDLQAMQQLSTKKGNDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGER  328

Query  376  yyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  242
            +Y   GRGRGRG   G    G            P+I+D  QFPTLG K
Sbjct  329  FYGGRGRGRGRGGDRGGFRGGAGGGGYRGPPAAPAIQDQNQFPTLGGK  376



>emb|CDY43474.1| BnaC08g10790D [Brassica napus]
Length=420

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 141/218 (65%), Gaps = 15/218 (7%)
 Frame = -3

Query  883  PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG  704
            PRR YERRSGTGRG + KRE +GRGNWG+P +E+     E + G           EK  G
Sbjct  103  PRRTYERRSGTGRGGDFKREEAGRGNWGTPGEEVLVVETEEVAGA--------EIEKSAG  154

Query  703  QEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  524
             E A DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERK    K FES
Sbjct  155  DEVAADAKKENTAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKFD-TKVFES  213

Query  523  MALLANKKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgr  344
            M  L+NKK++DE+F+KL S+K+ +K +  EK KK  SINEFLKPAEGE +YR GGRG GR
Sbjct  214  MQQLSNKKSNDEIFIKLDSDKDKRKDDKEEKAKKAVSINEFLKPAEGENHYRGGGRGGGR  273

Query  343  ghgsgrggygGNNTSSFE------TPSIEDVGQFPTLG  248
            G G G    GG +   F+        +I D  QFP+LG
Sbjct  274  GRGRGGRDRGGVSGGVFDGYRSEAASAIGDTAQFPSLG  311



>ref|XP_012083710.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Jatropha curcas]
 gb|KDP28866.1| hypothetical protein JCGZ_14637 [Jatropha curcas]
Length=384

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 152/238 (64%), Gaps = 19/238 (8%)
 Frame = -3

Query  913  SNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGV  734
            +NGE  DGE PRR +ERRSGTGRG+EIKREGSGRGNWG+  DEI   +EE    V+N+G 
Sbjct  152  TNGEVGDGERPRRPFERRSGTGRGNEIKREGSGRGNWGTQNDEITQASEE----VINEGE  207

Query  733  NTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEE  557
                 EK  G+++AGD  K+S  ++PE K+P++KEMTL+EYEK LEEKR+A+ A  + EE
Sbjct  208  KNLGDEKPVGEDEAGDGNKESSANDPEEKKPQEKEMTLEEYEKKLEEKRRALQALKKAEE  267

Query  556  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS--INEFLKPAEG  383
            RKV   KEFESM  L++KK  D+VF+KLGS+K+ +K+   +  K  KS  INEFLKPAEG
Sbjct  268  RKVDA-KEFESMLQLSSKKGTDDVFIKLGSDKDKRKEAFDKDEKAKKSVTINEFLKPAEG  326

Query  382  E-----------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  242
            E                 G G      +       +  S+   PSIED G+FPTLG K
Sbjct  327  ERYFNPGGRGRGRGRGSRGFGNTDAMSNVVAPSSTDAMSNVVAPSIEDRGEFPTLGGK  384



>ref|XP_006284013.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
 gb|EOA16911.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
Length=287

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 101/145 (70%), Gaps = 11/145 (8%)
 Frame = -3

Query  904  ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD  725
            E  +GE PRR +ERRSGTGRGS+ KR+GSGRGNWG+P +E+A E E         GV+T 
Sbjct  141  EGGEGERPRRTFERRSGTGRGSDFKRDGSGRGNWGTPGEELASETEAVA------GVDT-  193

Query  724  AFEKQHGQEDAGDAKKDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  548
              EK  G++ A DA  +     E E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  194  --EKDVGEKPAVDADANKENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSLTTTERKV  251

Query  547  CLDKEFESMALLANKKNDDEVFVKL  473
               K FESM  L+NKK++DE+F+KL
Sbjct  252  DT-KVFESMQQLSNKKSNDEIFIKL  275



>ref|XP_009406178.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=384

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 149/234 (64%), Gaps = 20/234 (9%)
 Frame = -3

Query  898  ADGEYP-RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDA  722
             D E+P RR+YERRSGTGRG E+KR+G+GRGNWG+  DE   + ++ I   +N   N  A
Sbjct  156  VDSEWPPRRSYERRSGTGRGYEMKRQGAGRGNWGTVADETHIQEKDEI---LNSDDNKLA  212

Query  721  FEKQHGQE------DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  560
             EKQ  QE      +  D K+ +       ++ EDKEMTL+EYEK+ EEKRKA+LA + E
Sbjct  213  TEKQQEQEMSPLSEEIKDNKEGA--INESEEKEEDKEMTLEEYEKIKEEKRKALLAMKSE  270

Query  559  ERKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeag----ekvkktKSINEFLKP  392
            ERKV +DKE +SM  L+ KK +D +FVKLGS+K+  KK+      E+ KK+ SINEFLKP
Sbjct  271  ERKVEIDKELQSMQQLSTKKENDPIFVKLGSDKDSGKKKENIDRDERSKKSLSINEFLKP  330

Query  391  AEG--ETyyrpggrgrgrghgsgrggygGNNTSSF--ETPSIEDVGQFPTLGSK  242
            AEG         GRGRGRG      G  G+  SSF    PSIED GQFPTLG K
Sbjct  331  AEGGRYYGPSGRGRGRGRGDRGPFRGSYGSGVSSFMAAAPSIEDPGQFPTLGGK  384



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2268595584692