BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5564

                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007026989.1|  Cell division protease ftsH isoform 1              460   3e-152   
emb|CDP06599.1|  unnamed protein product                                459   7e-152   Coffea canephora [robusta coffee]
ref|XP_009772661.1|  PREDICTED: ATP-dependent zinc metalloproteas...    455   2e-150   Nicotiana sylvestris
ref|XP_009598017.1|  PREDICTED: ATP-dependent zinc metalloproteas...    454   1e-149   Nicotiana tomentosiformis
gb|AFX67028.1|  putative AAA-metalloprotease FtsH                       436   1e-149   Solanum tuberosum [potatoes]
gb|KJB16964.1|  hypothetical protein B456_002G257200                    453   1e-149   Gossypium raimondii
gb|KDO51173.1|  hypothetical protein CISIN_1g005738mg                   448   2e-149   Citrus sinensis [apfelsine]
gb|KHG12964.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    452   3e-149   Gossypium arboreum [tree cotton]
ref|XP_006480880.1|  PREDICTED: ATP-dependent zinc metalloproteas...    450   2e-148   
ref|XP_006429118.1|  hypothetical protein CICLE_v10011087mg             450   3e-148   Citrus clementina [clementine]
ref|XP_010262544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    449   5e-148   Nelumbo nucifera [Indian lotus]
ref|XP_012074959.1|  PREDICTED: ATP-dependent zinc metalloproteas...    447   3e-147   Jatropha curcas
ref|XP_002323508.2|  hypothetical protein POPTR_0016s10620g             447   3e-147   
ref|XP_008464106.1|  PREDICTED: ATP-dependent zinc metalloproteas...    447   4e-147   Cucumis melo [Oriental melon]
ref|XP_011007151.1|  PREDICTED: ATP-dependent zinc metalloproteas...    443   5e-147   Populus euphratica
ref|XP_010256889.1|  PREDICTED: ATP-dependent zinc metalloproteas...    446   1e-146   Nelumbo nucifera [Indian lotus]
ref|XP_011007150.1|  PREDICTED: ATP-dependent zinc metalloproteas...    444   4e-146   Populus euphratica
gb|KJB55847.1|  hypothetical protein B456_009G097900                    443   5e-146   Gossypium raimondii
ref|XP_002530989.1|  Mitochondrial respiratory chain complexes as...    444   6e-146   
gb|EYU41737.1|  hypothetical protein MIMGU_mgv1a001461mg                443   7e-146   Erythranthe guttata [common monkey flower]
gb|KJB55846.1|  hypothetical protein B456_009G097900                    443   1e-145   Gossypium raimondii
ref|XP_011094875.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   2e-145   Sesamum indicum [beniseed]
ref|XP_011094876.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   2e-145   Sesamum indicum [beniseed]
ref|XP_009345397.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   2e-145   Pyrus x bretschneideri [bai li]
ref|XP_009338598.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   3e-145   Pyrus x bretschneideri [bai li]
ref|XP_007208082.1|  hypothetical protein PRUPE_ppa001525mg             441   3e-145   
ref|XP_008369915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    441   6e-145   
ref|XP_004143122.1|  PREDICTED: ATP-dependent zinc metalloproteas...    441   9e-145   Cucumis sativus [cucumbers]
gb|KHG20351.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    440   1e-144   Gossypium arboreum [tree cotton]
ref|XP_010106514.1|  ATP-dependent zinc metalloprotease FTSH 10         439   3e-144   Morus notabilis
ref|XP_008240759.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   9e-144   Prunus mume [ume]
gb|KDO72822.1|  hypothetical protein CISIN_1g047690mg                   437   2e-143   Citrus sinensis [apfelsine]
ref|XP_008777200.1|  PREDICTED: ATP-dependent zinc metalloproteas...    433   2e-143   
gb|KHN21936.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    436   3e-143   Glycine soja [wild soybean]
ref|XP_003537985.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   4e-143   Glycine max [soybeans]
ref|XP_010931245.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   5e-143   
gb|AAU44017.1|  putative AAA-metalloprotease FtsH (fragment)            424   7e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006341014.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   8e-143   Solanum tuberosum [potatoes]
ref|XP_006488359.1|  PREDICTED: ATP-dependent zinc metalloproteas...    435   1e-142   Citrus sinensis [apfelsine]
ref|XP_008448079.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   1e-142   Cucumis melo [Oriental melon]
ref|XP_008448063.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   1e-142   Cucumis melo [Oriental melon]
ref|XP_010043512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-142   
ref|XP_006349501.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-142   Solanum tuberosum [potatoes]
ref|XP_006349500.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-142   Solanum tuberosum [potatoes]
ref|XP_006424865.1|  hypothetical protein CICLE_v10027837mg             435   1e-142   Citrus clementina [clementine]
ref|XP_006349498.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   2e-142   Solanum tuberosum [potatoes]
ref|XP_006349497.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   2e-142   Solanum tuberosum [potatoes]
ref|XP_006349499.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   2e-142   Solanum tuberosum [potatoes]
ref|XP_011653641.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   3e-142   Cucumis sativus [cucumbers]
ref|XP_004142062.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   3e-142   Cucumis sativus [cucumbers]
ref|XP_004249560.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   4e-142   Solanum lycopersicum
ref|XP_009600786.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   4e-142   Nicotiana tomentosiformis
ref|XP_010312354.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   4e-142   Solanum lycopersicum
ref|XP_002283273.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   5e-142   Vitis vinifera
ref|XP_008777193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    433   9e-142   Phoenix dactylifera
ref|XP_004246405.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   1e-141   Solanum lycopersicum
ref|XP_007016370.1|  FTSH protease 10                                   432   1e-141   
ref|XP_010931244.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   3e-141   Elaeis guineensis
ref|XP_004294648.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   3e-141   Fragaria vesca subsp. vesca
gb|ACN36802.1|  unknown                                                 418   3e-141   Zea mays [maize]
ref|XP_010931243.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   3e-141   Elaeis guineensis
ref|XP_004961860.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   4e-141   Setaria italica
gb|KCW85528.1|  hypothetical protein EUGRSUZ_B02325                     431   6e-141   Eucalyptus grandis [rose gum]
ref|XP_009804923.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   6e-141   Nicotiana sylvestris
ref|XP_009384843.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   7e-141   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010043511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   7e-141   Eucalyptus grandis [rose gum]
ref|XP_009375915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    430   8e-141   Pyrus x bretschneideri [bai li]
ref|XP_006592192.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   1e-140   
ref|XP_009384842.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    430   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009140963.1|  PREDICTED: ATP-dependent zinc metalloproteas...    428   4e-140   Brassica rapa
ref|XP_008359096.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   5e-140   
ref|XP_008384940.1|  PREDICTED: ATP-dependent zinc metalloproteas...    428   5e-140   
ref|XP_006293791.1|  hypothetical protein CARUB_v10022773mg             424   6e-140   
ref|XP_009364366.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   1e-139   Pyrus x bretschneideri [bai li]
ref|XP_006592191.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   1e-139   Glycine max [soybeans]
gb|KHN32138.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    426   1e-139   Glycine soja [wild soybean]
ref|XP_010685724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   2e-139   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY31753.1|  BnaA04g16890D                                          426   2e-139   Brassica napus [oilseed rape]
dbj|BAE98430.1|  AAA-type like ATPase                                   410   2e-139   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77230.1|  BnaC04g40250D                                          426   2e-139   
ref|XP_007207144.1|  hypothetical protein PRUPE_ppa001491mg             427   2e-139   Prunus persica
ref|XP_006417796.1|  hypothetical protein EUTSA_v10006814mg             427   2e-139   Eutrema salsugineum [saltwater cress]
gb|KFK43073.1|  hypothetical protein AALP_AA1G075200                    426   3e-139   Arabis alpina [alpine rockcress]
ref|XP_008222305.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   3e-139   Prunus mume [ume]
ref|XP_003539663.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   3e-139   Glycine max [soybeans]
ref|XP_008356937.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   3e-139   Malus domestica [apple tree]
ref|XP_011089809.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   3e-139   Sesamum indicum [beniseed]
gb|KFK32242.1|  hypothetical protein AALP_AA6G216200                    426   4e-139   Arabis alpina [alpine rockcress]
ref|XP_004302718.2|  PREDICTED: ATP-dependent zinc metalloproteas...    426   4e-139   Fragaria vesca subsp. vesca
ref|XP_010937593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    426   4e-139   
ref|XP_010043509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   8e-139   Eucalyptus grandis [rose gum]
ref|XP_003539662.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   1e-138   Glycine max [soybeans]
ref|XP_002439915.1|  hypothetical protein SORBIDRAFT_09g022490          425   1e-138   Sorghum bicolor [broomcorn]
ref|XP_010475511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   1e-138   Camelina sativa [gold-of-pleasure]
gb|KHN32140.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    424   1e-138   Glycine soja [wild soybean]
ref|NP_001055745.1|  Os05g0458400                                       424   2e-138   
ref|XP_010475512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   2e-138   Camelina sativa [gold-of-pleasure]
gb|EEE63976.1|  hypothetical protein OsJ_18802                          424   2e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387530.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521866.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   2e-138   Tarenaya hassleriana [spider flower]
gb|EEC79350.1|  hypothetical protein OsI_20217                          424   2e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_010487541.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   3e-138   Camelina sativa [gold-of-pleasure]
ref|XP_003568313.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   3e-138   Brachypodium distachyon [annual false brome]
ref|XP_010920548.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   5e-138   Elaeis guineensis
ref|XP_009781386.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   6e-138   Nicotiana sylvestris
ref|XP_010469994.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   6e-138   Camelina sativa [gold-of-pleasure]
ref|XP_010487557.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   7e-138   
ref|XP_002881027.1|  hypothetical protein ARALYDRAFT_344684             422   8e-138   
ref|XP_010414442.1|  PREDICTED: ATP-dependent zinc metalloproteas...    422   2e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010521865.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   Tarenaya hassleriana [spider flower]
gb|AFW82207.1|  hypothetical protein ZEAMMB73_958383                    421   3e-137   
ref|XP_012066998.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   Jatropha curcas
ref|XP_010510537.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   Camelina sativa [gold-of-pleasure]
ref|XP_012066999.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   
emb|CDY39531.1|  BnaC04g15300D                                          421   4e-137   Brassica napus [oilseed rape]
ref|NP_850129.1|  FTSH protease 3                                       421   4e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611240.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   4e-137   Nicotiana tomentosiformis
gb|AAC33234.1|  putative AAA-type ATPase                                420   5e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125053.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   5e-137   Brassica rapa
ref|XP_006655377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   6e-137   
ref|XP_002313426.1|  FtsH protease family protein                       419   6e-137   
ref|XP_006306790.1|  hypothetical protein CARUB_v10008328mg             420   8e-137   Capsella rubella
gb|AAL36270.1|  putative AAA-type ATPase                                420   9e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47876.1|  BnaA07g14210D                                          420   9e-137   Brassica napus [oilseed rape]
emb|CDP09082.1|  unnamed protein product                                419   1e-136   Coffea canephora [robusta coffee]
ref|XP_010542637.1|  PREDICTED: ATP-dependent zinc metalloproteas...    419   2e-136   Tarenaya hassleriana [spider flower]
ref|XP_006409951.1|  hypothetical protein EUTSA_v10016261mg             419   2e-136   Eutrema salsugineum [saltwater cress]
ref|XP_009118433.1|  PREDICTED: ATP-dependent zinc metalloproteas...    418   3e-136   Brassica rapa
ref|XP_007133225.1|  hypothetical protein PHAVU_011G162000g             418   4e-136   Phaseolus vulgaris [French bean]
ref|NP_172231.2|  FTSH protease 10                                      418   4e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032280.1|  PREDICTED: ATP-dependent zinc metalloproteas...    417   2e-135   Populus euphratica
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH                      416   2e-135   Pisum sativum [garden pea]
ref|XP_002889652.1|  FTSH10                                             416   3e-135   Arabidopsis lyrata subsp. lyrata
ref|XP_008784613.1|  PREDICTED: ATP-dependent zinc metalloproteas...    414   1e-134   Phoenix dactylifera
ref|NP_001044774.1|  Os01g0842600                                       414   2e-134   
gb|EAY76461.1|  hypothetical protein OsI_04395                          414   2e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_006845226.1|  PREDICTED: ATP-dependent zinc metalloproteas...    413   6e-134   Amborella trichopoda
dbj|BAJ98147.1|  predicted protein                                      412   1e-133   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006644995.1|  PREDICTED: ATP-dependent zinc metalloproteas...    411   1e-133   Oryza brachyantha
gb|KJB16965.1|  hypothetical protein B456_002G257200                    410   2e-133   Gossypium raimondii
ref|XP_004970544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    410   6e-133   Setaria italica
gb|EMT04659.1|  Cell division protease ftsH-like protein, mitocho...    406   7e-133   
gb|EMS50561.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    407   1e-132   Triticum urartu
ref|XP_008799731.1|  PREDICTED: ATP-dependent zinc metalloproteas...    408   3e-132   Phoenix dactylifera
ref|XP_007132051.1|  hypothetical protein PHAVU_011G062800g             406   2e-131   Phaseolus vulgaris [French bean]
ref|XP_003606687.1|  Cell division protease ftsH-like protein           405   3e-131   Medicago truncatula
gb|EYU38460.1|  hypothetical protein MIMGU_mgv1a001496mg                405   4e-131   Erythranthe guttata [common monkey flower]
gb|AAF79577.1|AC022464_35  F22G5.10                                     406   4e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002458748.1|  hypothetical protein SORBIDRAFT_03g039540          404   8e-131   Sorghum bicolor [broomcorn]
gb|KCW85527.1|  hypothetical protein EUGRSUZ_B02324                     402   7e-130   Eucalyptus grandis [rose gum]
ref|XP_010043510.1|  PREDICTED: ATP-dependent zinc metalloproteas...    401   1e-129   Eucalyptus grandis [rose gum]
gb|EPS71434.1|  hypothetical protein M569_03325                         399   3e-129   Genlisea aurea
ref|NP_001145329.1|  uncharacterized protein LOC100278654               388   2e-128   
ref|XP_008358519.1|  PREDICTED: ATP-dependent zinc metalloproteas...    395   2e-127   
gb|KJB36698.1|  hypothetical protein B456_006G171800                    389   5e-127   Gossypium raimondii
ref|XP_004507174.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   7e-127   Cicer arietinum [garbanzo]
emb|CDM84966.1|  unnamed protein product                                392   1e-126   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001785268.1|  predicted protein                                  389   2e-126   
gb|EMS48627.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    391   1e-125   Triticum urartu
gb|EMT07840.1|  Cell division protease ftsH-like protein, mitocho...    393   6e-125   
emb|CDY09913.1|  BnaC08g45380D                                          384   2e-123   Brassica napus [oilseed rape]
ref|XP_003567261.1|  PREDICTED: ATP-dependent zinc metalloproteas...    372   2e-120   
ref|XP_011623752.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    367   4e-120   
gb|KEH23850.1|  ATP-dependent zinc metalloprotease FTSH protein         373   6e-120   Medicago truncatula
ref|XP_001782950.1|  predicted protein                                  377   1e-119   
ref|XP_001759881.1|  predicted protein                                  367   4e-118   
gb|AES75793.2|  ATP-dependent zinc metalloprotease FTSH protein         363   3e-116   Medicago truncatula
ref|XP_003624038.1|  Cell division protease ftsH-like protein           358   7e-115   
ref|XP_003619575.1|  Cell division protease ftsH-like protein           361   1e-114   
gb|ERN06910.1|  hypothetical protein AMTR_s00005p00257870               338   2e-110   Amborella trichopoda
ref|XP_002981661.1|  hypothetical protein SELMODRAFT_115113             348   4e-110   
ref|XP_002967857.1|  hypothetical protein SELMODRAFT_169256             349   2e-109   
ref|XP_002980658.1|  hypothetical protein SELMODRAFT_233533             318   1e-101   
ref|XP_002984562.1|  hypothetical protein SELMODRAFT_234574             318   1e-101   
ref|XP_005651157.1|  ATP-dependent metallopeptidase Hfl                 324   6e-101   Coccomyxa subellipsoidea C-169
ref|XP_002505472.1|  predicted protein                                  318   7e-99    Micromonas commoda
ref|XP_001422694.1|  predicted protein                                  306   9e-97    Ostreococcus lucimarinus CCE9901
ref|XP_003082962.1|  FtsH protease, putative (ISS)                      308   4e-94    Ostreococcus tauri
gb|ERN06906.1|  hypothetical protein AMTR_s00005p00257390               300   6e-94    Amborella trichopoda
ref|XP_007509883.1|  predicted protein                                  309   1e-93    Bathycoccus prasinos
ref|XP_003631103.1|  Cell division protease ftsH-like protein           296   2e-93    
ref|XP_011400128.1|  ATP-dependent zinc metalloprotease FTSH 10, ...    313   2e-93    Auxenochlorella protothecoides
ref|XP_003059742.1|  predicted protein                                  301   1e-92    Micromonas pusilla CCMP1545
gb|KEH16019.1|  ATP-dependent zinc metalloprotease FTSH protein         288   1e-88    Medicago truncatula
ref|XP_001689949.1|  membrane AAA-metalloprotease                       291   6e-88    Chlamydomonas reinhardtii
gb|KHG19679.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    271   6e-84    Gossypium arboreum [tree cotton]
ref|WP_041883641.1|  peptidase M41                                      278   2e-83    Pedobacter lusitanus
ref|XP_005850885.1|  hypothetical protein CHLNCDRAFT_140544             277   7e-83    Chlorella variabilis
ref|XP_003292084.1|  hypothetical protein DICPUDRAFT_39991              271   1e-82    Dictyostelium purpureum
ref|WP_037443193.1|  peptidase M41                                      276   1e-82    Pedobacter antarcticus
ref|WP_026897433.1|  peptidase M41                                      275   1e-82    Pedobacter oryzae
dbj|GAM28243.1|  hypothetical protein SAMD00019534_114190               278   2e-82    Acytostelium subglobosum LB1
ref|XP_638674.1|  peptidase M41, FtsH domain-containing protein         276   2e-82    Dictyostelium discoideum AX4
ref|WP_013664355.1|  peptidase M41                                      274   5e-82    Sphingobacterium sp. 21
ref|WP_008241678.1|  peptidase M41                                      273   9e-82    Pedobacter sp. BAL39
ref|WP_037533932.1|  peptidase M41                                      273   9e-82    Sphingobacterium thalpophilum
ref|WP_012780210.1|  peptidase M41                                      273   1e-81    Pedobacter heparinus
ref|WP_039053642.1|  peptidase M41                                      271   2e-81    
gb|EQB80316.1|  hypothetical protein L950_08340                         270   3e-81    
ref|WP_014682322.1|  peptidase M41                                      272   3e-81    Solitalea canadensis
dbj|BAF01982.1|  hypothetical protein                                   256   5e-81    Arabidopsis thaliana [mouse-ear cress]
gb|EFA84387.1|  peptidase M41                                           273   5e-81    Heterostelium album PN500
ref|WP_021069372.1|  peptidase M41                                      271   7e-81    Sphingobacterium paucimobilis
ref|WP_010600005.1|  peptidase M41                                      271   8e-81    Pedobacter
gb|AFM03376.1|  membrane protease FtsH catalytic subunit                270   8e-81    Bernardetia litoralis DSM 6794
ref|WP_040539886.1|  peptidase M41                                      271   1e-80    Pedobacter arcticus
gb|ETZ19316.1|  peptidase M41                                           270   1e-80    Pedobacter sp. V48
ref|XP_002741203.1|  PREDICTED: AFG3-like protein 2                     267   1e-80    Saccoglossus kowalevskii
ref|WP_037497088.1|  peptidase M41                                      270   1e-80    Sphingobacterium deserti
ref|WP_037460377.1|  peptidase M41                                      269   2e-80    
ref|WP_009033571.1|  peptidase M41                                      270   2e-80    Indibacter alkaliphilus
ref|WP_039990218.1|  peptidase M41                                      269   2e-80    
ref|WP_028295325.1|  peptidase M41                                      269   3e-80    Olivibacter sitiensis
ref|WP_041264331.1|  peptidase M41                                      268   3e-80    
gb|EFK59817.1|  ATP-dependent metallopeptidase HflB                     269   3e-80    Sphingobacterium spiritivorum ATCC 33861
gb|EEI91234.1|  ATP-dependent metallopeptidase HflB                     269   3e-80    Sphingobacterium spiritivorum ATCC 33300
ref|XP_004362632.1|  peptidase M41                                      275   5e-80    Cavenderia fasciculata
ref|WP_009053651.1|  peptidase M41                                      268   9e-80    Nitritalea halalkaliphila
ref|WP_036676326.1|  peptidase M41                                      268   1e-79    Pedobacter sp. R20-19
ref|WP_038701774.1|  peptidase M41                                      268   1e-79    Sphingobacterium sp. ML3W
ref|WP_033563684.1|  peptidase M41                                      268   1e-79    Sphingobacteriaceae bacterium DW12
ref|WP_026968576.1|  peptidase M41                                      268   1e-79    Algoriphagus terrigena
ref|WP_026902710.1|  peptidase M41                                      268   1e-79    Pedobacter glucosidilyticus
ref|WP_045755148.1|  peptidase M41                                      268   1e-79    Sphingobacterium sp. PM2-P1-29
gb|EIE80123.1|  hypothetical protein RO3G_04828                         266   1e-79    Rhizopus delemar RA 99-880
ref|WP_044224255.1|  peptidase M41                                      267   2e-79    Flammeovirga pacifica
ref|XP_002410299.1|  ATPase, putative                                   258   2e-79    Ixodes scapularis [blacklegged tick]
ref|WP_039450881.1|  peptidase M41                                      266   4e-79    Pedobacter glucosidilyticus
ref|XP_003979383.1|  PREDICTED: AFG3-like protein 2                     256   5e-79    
ref|WP_026951332.1|  peptidase M41                                      266   5e-79    Algoriphagus mannitolivorans
gb|ESA05195.1|  hypothetical protein GLOINDRAFT_66340                   265   6e-79    
ref|XP_001744500.1|  hypothetical protein                               264   7e-79    Monosiga brevicollis MX1
ref|WP_009186129.1|  peptidase M41                                      264   2e-78    Cecembia lonarensis
ref|WP_039137089.1|  ATPase AAA                                         263   3e-78    
gb|EMS32972.1|  Cell division protein FtsH                              264   3e-78    Mariniradius saccharolyticus AK6
dbj|GAO41819.1|  ATP-dependent zinc metalloprotease FtsH                263   3e-78    Flavihumibacter petaseus NBRC 106054
ref|WP_019597947.1|  peptidase M41                                      264   3e-78    Rhodonellum
ref|WP_020892866.1|  Cell division protein FtsH                         263   3e-78    Cyclobacterium qasimii
ref|WP_040480273.1|  peptidase M41                                      263   4e-78    
ref|WP_009578256.1|  Cell division protein FtsH                         263   4e-78    Fulvivirga imtechensis
ref|WP_039133743.1|  ATPase AAA                                         263   4e-78    
ref|WP_017733337.1|  hypothetical protein                               263   4e-78    Nafulsella turpanensis
ref|WP_035465307.1|  ATPase AAA                                         263   4e-78    
ref|WP_014021491.1|  peptidase M41                                      263   4e-78    Cyclobacterium marinum
gb|EXX70583.1|  m-AAA protease subunit YTA12                            266   5e-78    Rhizophagus irregularis DAOM 197198w
ref|WP_014221908.1|  peptidase M41                                      263   6e-78    Niastella koreensis
ref|WP_026999681.1|  peptidase M41                                      262   1e-77    Eisenibacter elegans
emb|CEJ01398.1|  Putative Cell division protease ftsH                   263   1e-77    Rhizopus microsporus
ref|WP_044213238.1|  peptidase M41                                      262   1e-77    Flammeovirga sp. OC4
gb|EGI59447.1|  AFG3-like protein 2                                     261   1e-77    Acromyrmex echinatior
ref|XP_005816528.1|  PREDICTED: AFG3-like protein 1-like                261   2e-77    
ref|WP_026945354.1|  peptidase M41                                      261   3e-77    Algoriphagus marincola
ref|XP_003590119.1|  Cell division protease ftsH-like protein           256   4e-77    
ref|WP_024284970.1|  peptidase M41                                      261   4e-77    Algoriphagus marincola
ref|WP_013453965.1|  peptidase M41                                      261   4e-77    Marivirga tractuosa
ref|WP_028787176.1|  ATPase AAA                                         261   5e-77    Terrimonas ferruginea
dbj|GAN02747.1|  ATP-dependent metallopeptidase Hfl                     261   5e-77    Mucor ambiguus
ref|WP_016195314.1|  Cell division protein FtsH                         261   6e-77    Arcticibacter svalbardensis
emb|CEG68111.1|  Putative Cell division protease ftsH                   261   6e-77    Rhizopus microsporus
emb|CEG68110.1|  Putative YALI0A10615p                                  261   7e-77    Rhizopus microsporus
gb|AHM60443.1|  membrane protease ftsh catalytic subunit                260   8e-77    Flammeovirgaceae bacterium 311
emb|CEI94349.1|  Putative AFG3 family protein                           263   8e-77    Rhizopus microsporus
ref|WP_009195895.1|  ATP-dependent zinc metalloprotease FtsH            260   9e-77    Cesiribacter andamanensis
ref|XP_011064067.1|  PREDICTED: AFG3-like protein 2 isoform X2          261   1e-76    Acromyrmex echinatior
ref|WP_026954726.1|  peptidase M41                                      259   1e-76    Algoriphagus vanfongensis
ref|WP_037327565.1|  ATPase AAA                                         259   1e-76    Asinibacterium sp. OR43
ref|XP_011064066.1|  PREDICTED: AFG3-like protein 2 isoform X1          262   1e-76    Acromyrmex echinatior
ref|WP_035757649.1|  peptidase M41                                      259   2e-76    Hugenholtzia roseola
ref|XP_012054526.1|  PREDICTED: AFG3-like protein 2                     261   3e-76    Atta cephalotes
ref|WP_022829689.1|  peptidase M41                                      259   3e-76    Cytophagales bacterium B6
ref|XP_007568550.1|  PREDICTED: AFG3-like protein 1                     260   3e-76    Poecilia formosa
ref|WP_015266230.1|  ATP-dependent metalloprotease FtsH                 258   3e-76    Echinicola vietnamensis
ref|WP_012927540.1|  peptidase M41                                      258   3e-76    
ref|XP_011407709.1|  PREDICTED: AFG3-like protein 2                     255   3e-76    Amphimedon queenslandica
emb|CDS03562.1|  hypothetical protein LRAMOSA00964                      259   4e-76    Lichtheimia ramosa
ref|XP_008408894.1|  PREDICTED: AFG3-like protein 1 isoform X1          259   4e-76    Poecilia reticulata
ref|WP_002694247.1|  peptidase M41                                      258   5e-76    Microscilla marina
emb|CEI95939.1|  Putative Mitochondrial inner membrane AAA protea...    258   5e-76    Rhizopus microsporus
ref|XP_011642238.1|  PREDICTED: AFG3-like protein 2                     260   5e-76    
gb|KFO11702.1|  AFG3-like 2                                             251   5e-76    
ref|XP_002681483.1|  aaa ATPase family protein                          262   5e-76    
ref|XP_005706412.1|  AAA-type ATPase                                    261   6e-76    
ref|XP_004566226.1|  PREDICTED: AFG3-like protein 1-like                259   6e-76    
ref|WP_037360570.1|  ATPase AAA                                         258   6e-76    
ref|XP_010302509.1|  PREDICTED: AFG3-like protein 2                     251   6e-76    
ref|WP_035076980.1|  peptidase M41                                      258   6e-76    
ref|XP_005946781.1|  PREDICTED: AFG3-like protein 1-like                259   6e-76    
gb|EFN79635.1|  AFG3-like protein 2                                     251   6e-76    
ref|XP_006805466.1|  PREDICTED: AFG3-like protein 1-like                258   6e-76    
ref|WP_013928835.1|  peptidase M41                                      257   7e-76    
ref|XP_005748823.1|  PREDICTED: AFG3-like protein 1-like                259   8e-76    
emb|CEI89004.1|  Putative Matrix AAA protease MAP-1                     257   8e-76    
emb|CEG69908.1|  Putative Mitochondrial inner membrane AAA protea...    258   1e-75    
gb|EPB90189.1|  AFG3 family protein                                     258   1e-75    
ref|XP_010637318.1|  PREDICTED: AFG3-like protein 2 isoform X2          254   1e-75    
ref|XP_004989050.1|  AFG3-like protein 2                                259   2e-75    
ref|WP_037369803.1|  ATPase AAA                                         256   2e-75    
ref|WP_018473204.1|  peptidase M41                                      256   2e-75    
ref|XP_001632616.1|  predicted protein                                  255   2e-75    
ref|WP_037352617.1|  ATPase AAA                                         256   2e-75    
ref|XP_003439591.1|  PREDICTED: AFG3-like protein 1-like                258   2e-75    
ref|XP_010747102.1|  PREDICTED: AFG3-like protein 1 isoform X1          258   2e-75    
ref|XP_011695717.1|  PREDICTED: AFG3-like protein 2                     255   2e-75    
ref|WP_045460063.1|  peptidase M41                                      257   2e-75    
ref|WP_039751710.1|  peptidase M41                                      256   2e-75    
gb|EGW00718.1|  AFG3-like protein 2                                     252   2e-75    
ref|XP_783782.2|  PREDICTED: AFG3-like protein 2 isoform X1             258   2e-75    
ref|WP_008507768.1|  peptidase M41                                      256   2e-75    
ref|XP_010747103.1|  PREDICTED: AFG3-like protein 1 isoform X2          258   2e-75    
ref|XP_006807100.1|  PREDICTED: AFG3-like protein 2-like                254   2e-75    
ref|XP_010290553.1|  PREDICTED: AFG3-like protein 2                     250   3e-75    
gb|KFQ80092.1|  AFG3-like 2                                             250   3e-75    
ref|WP_013408509.1|  peptidase M41                                      255   3e-75    
ref|WP_015027481.1|  peptidase M41                                      255   3e-75    
ref|XP_006675531.1|  hypothetical protein BATDEDRAFT_22321              257   4e-75    
ref|WP_037326393.1|  peptidase M41                                      254   4e-75    
ref|XP_004853318.1|  PREDICTED: AFG3-like protein 2 isoform X2          253   5e-75    
ref|XP_003737319.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    254   5e-75    
ref|WP_033411345.1|  ATPase AAA                                         254   6e-75    
ref|WP_020601428.1|  peptidase M41                                      254   1e-74    
emb|CDS12867.1|  hypothetical protein LRAMOSA05051                      256   1e-74    
gb|KFH71888.1|  AFG3 family protein                                     256   1e-74    
ref|XP_005946480.1|  PREDICTED: AFG3-like protein 2-like isoform X3     256   1e-74    
ref|XP_010223803.1|  PREDICTED: AFG3-like protein 2                     256   1e-74    
gb|KFQ87123.1|  AFG3-like 2                                             251   2e-74    
ref|WP_028981524.1|  peptidase M41                                      254   2e-74    
gb|ERL87558.1|  hypothetical protein D910_04949                         249   2e-74    
gb|KFP46134.1|  AFG3-like 2                                             251   2e-74    
ref|XP_010081449.1|  PREDICTED: AFG3-like protein 2                     251   2e-74    
gb|EIE90722.1|  hypothetical protein RO3G_15433                         256   2e-74    
gb|KGL73505.1|  AFG3-like 2                                             255   2e-74    
ref|WP_018619339.1|  peptidase M41                                      253   2e-74    
ref|XP_008049841.1|  PREDICTED: AFG3-like protein 2                     252   2e-74    
ref|WP_044003108.1|  peptidase M41                                      254   2e-74    
ref|WP_026994259.1|  peptidase M41                                      254   2e-74    
ref|XP_005282733.1|  PREDICTED: AFG3-like protein 2 isoform X1          256   2e-74    
ref|WP_014770837.1|  peptidase M41                                      253   3e-74    
ref|XP_005946478.1|  PREDICTED: AFG3-like protein 2-like isoform X1     256   3e-74    
ref|XP_008162617.1|  PREDICTED: AFG3-like protein 2 isoform X2          255   3e-74    
ref|XP_004656566.1|  PREDICTED: AFG3-like protein 2                     255   3e-74    
ref|XP_005946479.1|  PREDICTED: AFG3-like protein 2-like isoform X2     256   3e-74    
ref|XP_006641297.1|  PREDICTED: AFG3-like protein 1-like                255   3e-74    
ref|XP_011484595.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    255   3e-74    
ref|XP_011160232.1|  PREDICTED: AFG3-like protein 2 isoform X2          255   3e-74    
gb|EFX85159.1|  hypothetical protein DAPPUDRAFT_194014                  253   3e-74    
ref|XP_011254538.1|  PREDICTED: AFG3-like protein 2 isoform X2          255   3e-74    
ref|WP_044282937.1|  peptidase M41                                      252   4e-74    
ref|WP_035557847.1|  peptidase M41                                      253   4e-74    
ref|NP_001072759.1|  AFG3-like AAA ATPase 2                             255   4e-74    
ref|XP_011160223.1|  PREDICTED: AFG3-like protein 2 isoform X1          255   4e-74    
ref|XP_003458166.1|  PREDICTED: AFG3-like protein 2 isoform X1          254   5e-74    
ref|XP_004572477.1|  PREDICTED: AFG3-like protein 2-like                254   5e-74    
ref|XP_005476934.1|  PREDICTED: AFG3-like protein 2 isoform X5          254   5e-74    
ref|XP_005752595.1|  PREDICTED: AFG3-like protein 2-like                254   6e-74    
ref|XP_011254537.1|  PREDICTED: AFG3-like protein 2 isoform X1          255   6e-74    
ref|XP_005476933.1|  PREDICTED: AFG3-like protein 2 isoform X4          255   6e-74    
ref|XP_006612551.1|  PREDICTED: AFG3-like protein 2-like                254   7e-74    
ref|WP_012788140.1|  peptidase M41                                      252   7e-74    
ref|XP_003383809.1|  PREDICTED: AFG3-like protein 2                     253   7e-74    
ref|XP_010637317.1|  PREDICTED: AFG3-like protein 2 isoform X1          253   7e-74    
gb|ACE05676.1|  hypothetical protein Aasi_0232                          252   8e-74    
ref|XP_011862983.1|  PREDICTED: AFG3-like protein 2                     254   8e-74    
ref|XP_005476931.1|  PREDICTED: AFG3-like protein 2 isoform X2          254   8e-74    
ref|XP_005476932.1|  PREDICTED: AFG3-like protein 2 isoform X3          254   8e-74    
ref|XP_008286028.1|  PREDICTED: AFG3-like protein 1                     254   9e-74    
ref|XP_003693602.1|  PREDICTED: AFG3-like protein 2-like                254   1e-73    
ref|WP_025762249.1|  peptidase M41                                      252   1e-73    
ref|NP_001104667.1|  AFG3-like protein 2                                254   1e-73    
gb|EPZ30859.1|  ATPase, AAA-type domain-containing protein              250   1e-73    
ref|XP_624548.2|  PREDICTED: AFG3-like protein 2-like                   254   1e-73    
ref|WP_020528790.1|  hypothetical protein                               252   1e-73    
gb|KHJ47643.1|  ATP-dependent metallopeptidase HflB                     253   1e-73    
ref|XP_005074768.1|  PREDICTED: AFG3-like protein 2                     251   1e-73    
ref|XP_011245300.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   1e-73    
ref|WP_020595437.1|  peptidase M41                                      251   1e-73    
ref|XP_001956786.1|  GF24400                                            254   1e-73    
ref|WP_008202404.1|  peptidase M41                                      251   1e-73    
ref|XP_006117557.1|  PREDICTED: AFG3-like protein 2 isoform X2          254   1e-73    
ref|XP_006117556.1|  PREDICTED: AFG3-like protein 2 isoform X1          254   1e-73    
dbj|GAN09644.1|  ATP-dependent metallopeptidase Hfl                     253   1e-73    
ref|XP_008299957.1|  PREDICTED: AFG3-like protein 2                     253   1e-73    
ref|XP_009960252.1|  PREDICTED: AFG3-like protein 2                     253   1e-73    
ref|WP_034257071.1|  peptidase M41                                      251   2e-73    
ref|XP_004069425.1|  PREDICTED: AFG3-like protein 1                     253   2e-73    
gb|EFB23538.1|  hypothetical protein PANDA_019250                       253   2e-73    
ref|XP_002030868.1|  GM24348                                            253   2e-73    
ref|XP_003924961.2|  PREDICTED: AFG3-like protein 2 isoform X2          251   2e-73    
gb|EDM14729.1|  AFG3(ATPase family gene 3)-like 2 (yeast)               252   2e-73    
gb|KFO26923.1|  AFG3-like protein 2                                     253   2e-73    
ref|WP_010856866.1|  Cell division protein FtsH                         251   2e-73    
ref|XP_007062432.1|  PREDICTED: AFG3-like protein 2                     253   2e-73    
gb|EDL09647.1|  mCG127904                                               252   2e-73    
ref|XP_007643641.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   2e-73    
ref|NP_730250.1|  CG6512, isoform B                                     251   2e-73    
ref|XP_007109863.1|  PREDICTED: AFG3-like protein 2                     251   2e-73    
ref|XP_011235404.1|  PREDICTED: AFG3-like protein 2                     253   2e-73    
emb|CDS28120.1|  afg3 protein 2                                         252   2e-73    
emb|CDS05549.1|  hypothetical protein LRAMOSA08077                      251   3e-73    
ref|XP_005866972.1|  PREDICTED: AFG3-like protein 2 isoform X3          252   3e-73    
emb|CCH00875.1|  ATP-dependent metalloprotease FtsH                     251   3e-73    
ref|XP_005703090.1|  AAA-type ATPase                                    254   3e-73    
gb|EHJ64116.1|  hypothetical protein KGM_08960                          246   3e-73    
ref|XP_008309809.1|  PREDICTED: AFG3-like protein 1                     252   3e-73    
ref|XP_008977688.1|  PREDICTED: AFG3-like protein 2 isoform X2          252   3e-73    
ref|XP_006763325.1|  PREDICTED: AFG3-like protein 2 isoform X2          252   3e-73    
ref|XP_010374004.1|  PREDICTED: AFG3-like protein 2                     251   3e-73    
ref|XP_005073264.1|  PREDICTED: AFG3-like protein 1-like                245   3e-73    
ref|WP_045690242.1|  peptidase M41                                      251   3e-73    
ref|XP_011502504.1|  PREDICTED: AFG3-like protein 2                     252   4e-73    
ref|WP_028522492.1|  peptidase M41                                      250   4e-73    
gb|ELK30619.1|  AFG3-like protein 2                                     253   4e-73    
ref|XP_005866971.1|  PREDICTED: AFG3-like protein 2 isoform X2          252   4e-73    
ref|XP_005999264.1|  PREDICTED: AFG3-like protein 1-like                251   4e-73    
ref|XP_010333888.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   4e-73    
gb|KFO81406.1|  AFG3-like 2                                             252   4e-73    
ref|XP_005866970.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   4e-73    
ref|XP_011605421.1|  PREDICTED: AFG3-like protein 1 isoform X5          250   4e-73    
emb|CAB48398.1|  paraplegin-like protein                                252   4e-73    
ref|XP_004340807.1|  ATP-dependent metallopeptidase HflB subfamil...    251   4e-73    
ref|XP_006763324.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   5e-73    
gb|EPQ08204.1|  AFG3-like protein 2                                     252   5e-73    
gb|EAX01551.1|  AFG3 ATPase family gene 3-like 2 (yeast), isoform...    251   5e-73    
gb|EPB89883.1|  AFG3 family protein                                     251   5e-73    
dbj|BAE29204.1|  unnamed protein product                                252   5e-73    
ref|NP_001128336.1|  AFG3-like protein 2                                252   5e-73    
emb|CDH48427.1|  atp-dependent metallopeptidase hfl                     251   5e-73    
ref|XP_002757077.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   5e-73    
ref|XP_004684027.1|  PREDICTED: AFG3-like protein 2                     251   5e-73    
ref|XP_008580361.1|  PREDICTED: AFG3-like protein 2                     251   6e-73    
ref|XP_007244085.1|  PREDICTED: AFG3-like protein 1-like                251   6e-73    
gb|EHH29159.1|  AFG3-like protein 2                                     251   6e-73    
ref|NP_081406.1|  AFG3-like protein 2                                   252   6e-73    
gb|AAC27764.1|  RcaA                                                    241   6e-73    
ref|XP_007085973.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_011840938.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_009579883.1|  PREDICTED: AFG3-like protein 2                     249   7e-73    
gb|KFV94066.1|  AFG3-like 2                                             249   7e-73    
gb|KDR07700.1|  AFG3-like protein 2                                     252   7e-73    
ref|XP_007633119.1|  PREDICTED: AFG3-like protein 2 isoform X2          251   7e-73    
ref|XP_008700356.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_011286260.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
gb|EFZ22674.1|  hypothetical protein SINV_06415                         251   7e-73    
gb|KFH68520.1|  AFG3 family protein                                     251   7e-73    
ref|XP_009566314.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_006008879.1|  PREDICTED: AFG3-like protein 2 isoform X2          251   7e-73    
ref|XP_002085240.1|  GD12422                                            252   7e-73    
ref|XP_011792051.1|  PREDICTED: AFG3-like protein 2                     251   8e-73    
ref|XP_006008878.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   8e-73    
gb|EHB14938.1|  AFG3-like protein 2                                     251   8e-73    
ref|XP_004903784.1|  PREDICTED: AFG3-like protein 2                     251   8e-73    
ref|WP_041258971.1|  peptidase M41                                      249   8e-73    
ref|XP_010394721.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
ref|XP_007427904.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
ref|XP_010857368.1|  PREDICTED: AFG3-like protein 2 isoform X3          250   9e-73    
gb|KFQ35154.1|  AFG3-like 2                                             251   9e-73    
ref|XP_008157913.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
gb|KFO93388.1|  AFG3-like 2                                             251   9e-73    
ref|XP_011605418.1|  PREDICTED: AFG3-like protein 1 isoform X3          250   9e-73    
emb|CDH61533.1|  predicted protein                                      250   9e-73    
ref|XP_011300136.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
ref|XP_010017023.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
gb|KFQ53424.1|  AFG3-like 2                                             251   1e-72    
ref|XP_006868771.1|  PREDICTED: AFG3-like protein 2-like                251   1e-72    
ref|NP_730248.2|  CG6512, isoform A                                     251   1e-72    
gb|KFO56363.1|  AFG3-like 2                                             251   1e-72    
ref|XP_006089365.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    251   1e-72    
ref|XP_009887391.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_011605416.1|  PREDICTED: AFG3-like protein 1 isoform X1          251   1e-72    
ref|XP_006269795.1|  PREDICTED: AFG3-like protein 2 isoform X2          251   1e-72    
gb|ELK15046.1|  AFG3-like protein 2                                     251   1e-72    
ref|XP_004470052.1|  PREDICTED: AFG3-like protein 2-like                251   1e-72    
ref|XP_011944140.1|  PREDICTED: AFG3-like protein 2 isoform X3          251   1e-72    
ref|XP_011379633.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
gb|KGL96547.1|  AFG3-like 2                                             250   1e-72    
ref|XP_010182228.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_011735014.1|  PREDICTED: AFG3-like protein 2                     249   1e-72    
ref|XP_005486772.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_010140308.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_006164216.1|  PREDICTED: AFG3-like protein 2                     250   1e-72    
ref|XP_008191461.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|WP_041932557.1|  peptidase M41                                      248   1e-72    
ref|XP_011146865.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_011605417.1|  PREDICTED: AFG3-like protein 1 isoform X2          250   1e-72    
gb|KFV62490.1|  AFG3-like 2                                             250   1e-72    
gb|AAH24282.1|  Similar to AFG3 ATPase family gene 3-like 2 (yeast)     251   1e-72    
gb|EPB86387.1|  AFG3 family protein                                     250   1e-72    
gb|ELR58811.1|  AFG3-like protein 2                                     250   1e-72    
ref|XP_009061516.1|  hypothetical protein LOTGIDRAFT_127065             248   1e-72    
ref|XP_008552422.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_003276764.2|  PREDICTED: AFG3-like protein 2                     251   2e-72    
ref|XP_012150883.1|  PREDICTED: AFG3-like protein 2                     251   2e-72    
ref|XP_010857366.1|  PREDICTED: AFG3-like protein 2 isoform X1          250   2e-72    
ref|XP_006269794.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   2e-72    
ref|XP_002828063.1|  PREDICTED: AFG3-like protein 2                     251   2e-72    
gb|AAH71038.1|  LOC432063 protein                                       250   2e-72    
ref|XP_007463350.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    251   2e-72    
dbj|BAE30959.1|  unnamed protein product                                251   2e-72    
ref|XP_512199.2|  PREDICTED: AFG3-like protein 2                        250   2e-72    
ref|NP_006787.2|  AFG3-like protein 2                                   250   2e-72    

>ref|XP_007026989.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY07491.1| Cell division protease ftsH isoform 1 [Theobroma cacao]

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 236/252 (94%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S+PL+PEVVP
Sbjct  805  DGSAPLEPEVVP  816

>emb|CDP06599.1| unnamed protein product [Coffea canephora]

 Score =   459 bits (1181),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S PL P+VVP
Sbjct  811  DSSPPLDPDVVP  822

>ref|XP_009772661.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/253 (87%), Positives = 238/253 (94%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
Sbjct  808  KGSSPVEPEVVPV  820

>ref|XP_009598017.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 239/254 (94%), Gaps = 2/254 (1%)
 Frame = -2





Query  247  D-DSSPLQPEVVPV  209
            +  SSP++PEVVPV
Sbjct  808  NGSSSPVEPEVVPV  821

>gb|AFX67028.1| putative AAA-metalloprotease FtsH, partial [Solanum tuberosum]

 Score =   436 bits (1121),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 227/243 (93%), Gaps = 1/243 (0%)
 Frame = -2





Query  247  DDS  239
            + S
Sbjct  306  NGS  308

>gb|KJB16964.1| hypothetical protein B456_002G257200 [Gossypium raimondii]

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            + S+PL+PEVVP
Sbjct  805  NGSTPLEPEVVP  816

>gb|KDO51173.1| hypothetical protein CISIN_1g005738mg [Citrus sinensis]

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 237/253 (94%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DD-SSPLQPEVVP  212
            D+ SSPL+PEVVP
Sbjct  667  DNSSSPLEPEVVP  679

>gb|KHG12964.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            + S+PL+PEVVP
Sbjct  805  NGSTPLEPEVVP  816

>ref|XP_006480880.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480881.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Citrus sinensis]

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 2/254 (1%)
 Frame = -2





Query  247  DD-SSPLQPEVVPV  209
            D+ SSPL+PEVVP 
Sbjct  805  DNSSSPLEPEVVPT  818

>ref|XP_006429118.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
 gb|ESR42358.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]

 Score =   450 bits (1157),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 2/254 (1%)
 Frame = -2





Query  247  DD-SSPLQPEVVPV  209
            D+ SSPL+PEVVP 
Sbjct  805  DNSSSPLEPEVVPT  818

>ref|XP_010262544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]

 Score =   449 bits (1155),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 233/253 (92%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SSPL+P+VVP 
Sbjct  809  DRSSPLEPDVVPT  821

>ref|XP_012074959.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Jatropha curcas]
 gb|KDP35648.1| hypothetical protein JCGZ_09086 [Jatropha curcas]

 Score =   447 bits (1151),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S+PL P+VVP
Sbjct  816  DGSAPLDPQVVP  827

>ref|XP_002323508.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
 gb|EEF05269.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 235/252 (93%), Gaps = 4/252 (2%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSP++P+VVP
Sbjct  802  DGSSPIEPQVVP  813

>ref|XP_008464106.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis melo]

 Score =   447 bits (1149),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 235/252 (93%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+VVP
Sbjct  806  DGSSPLEPQVVP  817

>ref|XP_011007151.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Populus euphratica]

 Score =   443 bits (1139),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 234/252 (93%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSP++P+VVP
Sbjct  697  DGSSPMEPQVVP  708

>ref|XP_010256889.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 233/254 (92%), Gaps = 5/254 (2%)
 Frame = -2





Query  253  KDDDSSPLQPEVVP  212
             DD SSPL+PEVVP
Sbjct  806  GDDGSSPLEPEVVP  819

>ref|XP_011007150.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Populus euphratica]

 Score =   444 bits (1142),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 234/252 (93%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSP++P+VVP
Sbjct  803  DGSSPMEPQVVP  814

>gb|KJB55847.1| hypothetical protein B456_009G097900 [Gossypium raimondii]

 Score =   443 bits (1139),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDSS-PLQPEVVP  212
            D S+ PL P+VVP
Sbjct  772  DGSAPPLVPQVVP  784

>ref|XP_002530989.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
 gb|EEF31401.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]

 Score =   444 bits (1142),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S+ L+P+V P
Sbjct  821  DGSTTLEPQVAP  832

>gb|EYU41737.1| hypothetical protein MIMGU_mgv1a001461mg [Erythranthe guttata]

 Score =   443 bits (1140),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 214/257 (83%), Positives = 231/257 (90%), Gaps = 5/257 (2%)
 Frame = -2





Query  250  ---DDDSSPLQPEVVPV  209
               DD   PL PEVVPV

>gb|KJB55846.1| hypothetical protein B456_009G097900 [Gossypium raimondii]

 Score =   443 bits (1139),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDSS-PLQPEVVP  212
            D S+ PL P+VVP
Sbjct  803  DGSAPPLVPQVVP  815

>ref|XP_011094875.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Sesamum indicum]

 Score =   442 bits (1138),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SS L+P VVP 
Sbjct  805  DRSSSLEPHVVPT  817

>ref|XP_011094876.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Sesamum indicum]

 Score =   442 bits (1138),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SS L+P VVP 
Sbjct  803  DRSSSLEPHVVPT  815

>ref|XP_009345397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 233/251 (93%), Gaps = 5/251 (2%)
 Frame = -2





Query  247  DDSSPLQPEVV  215
              S P+QP+VV
Sbjct  802  GRSPPIQPDVV  812

>ref|XP_009338598.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009338599.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]

 Score =   442 bits (1137),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 233/251 (93%), Gaps = 5/251 (2%)
 Frame = -2





Query  247  DDSSPLQPEVV  215
              S P+QP+VV
Sbjct  802  GRSPPIQPDVV  812

>ref|XP_007208082.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
 gb|EMJ09281.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]

 Score =   441 bits (1135),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S P+QP+VVP
Sbjct  796  GRSPPIQPDVVP  807

>ref|XP_008369915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]

 Score =   441 bits (1134),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 232/251 (92%), Gaps = 5/251 (2%)
 Frame = -2





Query  247  DDSSPLQPEVV  215
              S P+QP+VV
Sbjct  802  GRSPPIQPDVV  812

>ref|XP_004143122.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis sativus]
 gb|KGN47136.1| hypothetical protein Csa_6G190270 [Cucumis sativus]

 Score =   441 bits (1133),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            + SSPL+P+VVP
Sbjct  806  NGSSPLEPQVVP  817

>gb|KHG20351.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]

 Score =   440 bits (1132),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDSS-PLQPEVVP  212
            D S+ PL P+VVP
Sbjct  803  DGSAPPLVPQVVP  815

>ref|XP_010106514.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
 gb|EXC10690.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]

 Score =   439 bits (1130),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL P+VVP
Sbjct  805  DGSSPLDPQVVP  816

>ref|XP_008240759.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Prunus mume]

 Score =   438 bits (1126),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S P+QP+VVP
Sbjct  804  GRSPPIQPDVVP  815

>gb|KDO72822.1| hypothetical protein CISIN_1g047690mg [Citrus sinensis]

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V P
Sbjct  799  DGSSPLEPQVAP  810

>ref|XP_008777200.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Phoenix dactylifera]

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DD-SSPLQPEVVP  212
            DD SS L  EVVP
Sbjct  666  DDGSSSLDGEVVP  678

>gb|KHN21936.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 

 Score =   436 bits (1122),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  798  GGSSPLEPQVVP  809

>ref|XP_003537985.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  798  GGSSPLEPQVVP  809

>ref|XP_010931245.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Elaeis guineensis]

 Score =   432 bits (1110),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D  S L  EVVP
Sbjct  666  DGPSSLDGEVVP  677

>gb|AAU44017.1| putative AAA-metalloprotease FtsH (fragment) [Oryza sativa Japonica 

 Score =   424 bits (1091),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  463  DDGTPSLGEVVP  474

>ref|XP_006341014.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum tuberosum]

 Score =   436 bits (1120),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 227/243 (93%), Gaps = 1/243 (0%)
 Frame = -2





Query  247  DDS  239
            + S
Sbjct  805  NGS  807

>ref|XP_006488359.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Citrus sinensis]

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V P
Sbjct  798  DGSSPLEPQVAP  809

>ref|XP_008448079.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Cucumis melo]

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  811  SSSPPLEPDIVP  822

>ref|XP_008448063.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
 ref|XP_008448071.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  812  SSSPPLEPDIVP  823

>ref|XP_010043512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010043513.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 232/253 (92%), Gaps = 3/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  670  DESPRPLDPQVVP  682

>ref|XP_006349501.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Solanum tuberosum]

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SSP++P++VPV
Sbjct  658  DRSSPVEPKIVPV  670

>ref|XP_006349500.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SSP++P++VPV
Sbjct  658  DRSSPVEPKIVPV  670

>ref|XP_006424865.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
 ref|XP_006488358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Citrus sinensis]
 gb|ESR38105.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V P
Sbjct  799  DGSSPLEPQVAP  810

>ref|XP_006349498.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 233/254 (92%), Gaps = 6/254 (2%)
 Frame = -2





Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  802  DGSSSPVEPEIVPV  815

>ref|XP_006349497.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 233/254 (92%), Gaps = 6/254 (2%)
 Frame = -2





Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  803  DGSSSPVEPEIVPV  816

>ref|XP_006349499.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SSP++P++VPV
Sbjct  658  DRSSPVEPKIVPV  670

>ref|XP_011653641.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Cucumis sativus]

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  812  SSSPPLEPDIVP  823

>ref|XP_004142062.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Cucumis sativus]
 gb|KGN54261.1| hypothetical protein Csa_4G296150 [Cucumis sativus]

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  811  SSSPPLEPDIVP  822

>ref|XP_004249560.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum lycopersicum]

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 234/254 (92%), Gaps = 6/254 (2%)
 Frame = -2





Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  799  DGSSSPVEPEIVPV  812

>ref|XP_009600786.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009600787.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]

 Score =   431 bits (1107),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 233/253 (92%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            + SS  + EVVP+
Sbjct  658  NQSSSEESEVVPI  670

>ref|XP_010312354.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Solanum lycopersicum]

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 234/254 (92%), Gaps = 6/254 (2%)
 Frame = -2





Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  800  DGSSSPVEPEIVPV  813

>ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Vitis vinifera]
 emb|CBI16104.3| unnamed protein product [Vitis vinifera]

 Score =   434 bits (1115),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 228/252 (90%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            + + PL+PEVVP
Sbjct  808  NGAPPLEPEVVP  819

>ref|XP_008777193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Phoenix dactylifera]

 Score =   433 bits (1113),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 230/254 (91%), Gaps = 1/254 (0%)
 Frame = -2





Query  247  DD-SSPLQPEVVPV  209
            DD SS L  EVVP 
Sbjct  809  DDGSSSLDGEVVPT  822

>ref|XP_004246405.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum lycopersicum]

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/243 (86%), Positives = 226/243 (93%), Gaps = 1/243 (0%)
 Frame = -2





Query  247  DDS  239
            + S
Sbjct  801  NGS  803

>ref|XP_007016370.1| FTSH protease 10 [Theobroma cacao]
 gb|EOY33989.1| FTSH protease 10 [Theobroma cacao]

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S+PL P+VVP
Sbjct  801  DGSAPLDPQVVP  812

>ref|XP_010931244.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Elaeis guineensis]

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D  S L  EVVP
Sbjct  804  DGPSSLDGEVVP  815

>ref|XP_004294648.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Fragaria vesca subsp. vesca]

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  798  DGSSPLEPQVLP  809

>gb|ACN36802.1| unknown [Zea mays]

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 224/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S P+  +VVP
Sbjct  406  DSSPPVG-DVVP  416

>ref|XP_010931243.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Elaeis guineensis]

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D  S L  EVVP
Sbjct  809  DGPSSLDGEVVP  820

>ref|XP_004961860.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Setaria italica]

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD+SP   EVVP
Sbjct  804  DDASPSLGEVVP  815

>gb|KCW85528.1| hypothetical protein EUGRSUZ_B02325 [Eucalyptus grandis]

 Score =   431 bits (1108),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 231/253 (91%), Gaps = 3/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  803  DESPRPLDPQVVP  815

>ref|XP_009804923.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009804924.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]

 Score =   427 bits (1099),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/253 (81%), Positives = 233/253 (92%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            + SS    EVVP+
Sbjct  658  NQSSSEGSEVVPI  670

>ref|XP_009384843.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = -2





Query  247  -DDSSPLQPEVVPV  209
             D SS L  EVVP 
Sbjct  808  GDGSSSLDGEVVPT  821

>ref|XP_010043511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Eucalyptus grandis]

 Score =   431 bits (1109),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 232/253 (92%), Gaps = 3/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  834  DESPRPLDPQVVP  846

>ref|XP_009375915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]

 Score =   430 bits (1106),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811

>ref|XP_006592192.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Glycine max]

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  662  GGSSPLEPQVVP  673

>ref|XP_009384842.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 228/253 (90%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  -DDSSPLQPEVVP  212
             D SS L  EVVP
Sbjct  820  GDGSSSLDGEVVP  832

>ref|XP_009416148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/245 (84%), Positives = 226/245 (92%), Gaps = 5/245 (2%)
 Frame = -2





Query  247  DDSSP  233
            DD  P
Sbjct  804  DDVVP  808

>ref|XP_009140963.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brassica rapa]

 Score =   428 bits (1101),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P+VVP
Sbjct  791  GGSPPLEPQVVP  802

>ref|XP_008359096.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]

 Score =   427 bits (1098),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  765  DGSSPLEPQVLP  776

>ref|XP_008384940.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
 ref|XP_008366266.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]

 Score =   428 bits (1101),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811

>ref|XP_006293791.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
 gb|EOA26689.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]

 Score =   424 bits (1090),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  666  EGAPPPLEPQVVP  678

>ref|XP_009364366.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811

>ref|XP_006592191.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Glycine max]

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  770  GGSSPLEPQVVP  781

>gb|KHN32138.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  759  GGSSPLEPQVVP  770

>ref|XP_010685724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 230/254 (91%), Gaps = 5/254 (2%)
 Frame = -2





Query  253  KDDDSSPLQPEVVP  212
            +D+ S PL P+VVP
Sbjct  805  EDEGSPPLIPDVVP  818

>emb|CDY31753.1| BnaA04g16890D [Brassica napus]

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P+VVP
Sbjct  776  GGSPPLEPQVVP  787

>dbj|BAE98430.1| AAA-type like ATPase [Arabidopsis thaliana]

 Score =   410 bits (1055),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 217/235 (92%), Gaps = 1/235 (0%)
 Frame = -2





>emb|CDX77230.1| BnaC04g40250D [Brassica napus]

 Score =   426 bits (1095),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  777  GGPPPLEPQVVP  788

>ref|XP_007207144.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
 gb|EMJ08343.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  802  DGSSPLEPQVLP  813

>ref|XP_006417796.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
 gb|ESQ36149.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 226/252 (90%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S PL+P+VVP
Sbjct  803  DGSPPLEPQVVP  814

>gb|KFK43073.1| hypothetical protein AALP_AA1G075200 [Arabis alpina]

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 227/252 (90%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D + PL+P+VVP
Sbjct  802  DGAPPLEPQVVP  813

>ref|XP_008222305.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Prunus mume]

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  802  DGSSPLEPQVLP  813

>ref|XP_003539663.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Glycine max]

 Score =   426 bits (1095),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  794  GGSSPLEPQVVP  805

>ref|XP_008356937.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811

>ref|XP_011089809.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Sesamum indicum]

 Score =   427 bits (1097),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SSPL P+VVP 
Sbjct  814  DGSSPLVPDVVPT  826

>gb|KFK32242.1| hypothetical protein AALP_AA6G216200 [Arabis alpina]

 Score =   426 bits (1094),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  790  GAPPPLEPQVVP  801

>ref|XP_004302718.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Fragaria vesca subsp. vesca]

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 221/243 (91%), Gaps = 1/243 (0%)
 Frame = -2





Query  247  DDS  239
Sbjct  800  GQS  802

>ref|XP_010937593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial-like [Elaeis guineensis]

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 229/253 (91%), Gaps = 1/253 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D SS L  EVVP 
Sbjct  808  DRSSSLSGEVVPT  820

>ref|XP_010043509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW85526.1| hypothetical protein EUGRSUZ_B02323 [Eucalyptus grandis]

 Score =   425 bits (1093),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 230/253 (91%), Gaps = 3/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  803  DESPPPLDPQVVP  815

>ref|XP_003539662.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  798  GGSSPLEPQVVP  809

>ref|XP_002439915.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
 gb|EES18345.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/253 (81%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVPV  209
            D S PL  EVVP 
Sbjct  804  DSSPPLG-EVVPT  815

>ref|XP_010475511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Camelina sativa]

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  803  DGVPPLEPQVVP  814

>gb|KHN32140.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 

 Score =   424 bits (1091),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  798  GGSSPLEPQVVP  809

>ref|NP_001055745.1| Os05g0458400 [Oryza sativa Japonica Group]
 sp|Q0DHL4.1|FTSH8_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 8, mitochondrial; 
Short=OsFTSH8; Flags: Precursor [Oryza sativa Japonica 
 dbj|BAF17659.1| Os05g0458400 [Oryza sativa Japonica Group]

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  810  DDGTPSLGEVVP  821

>ref|XP_010475512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Camelina sativa]

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  801  DGVPPLEPQVVP  812

>gb|EEE63976.1| hypothetical protein OsJ_18802 [Oryza sativa Japonica Group]

 Score =   424 bits (1089),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  780  DDGTPSLGEVVP  791

>ref|XP_009387530.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSPL  EVVP
Sbjct  806  DGSSPLNGEVVP  817

>ref|XP_010521866.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Tarenaya hassleriana]

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 223/252 (88%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  667  GGVPPLEPQVVP  678

>gb|EEC79350.1| hypothetical protein OsI_20217 [Oryza sativa Indica Group]

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  817  DDGTPSLGEVVP  828

>ref|XP_010487541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Camelina sativa]

 Score =   424 bits (1090),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  803  DGVPPLEPQVVP  814

>ref|XP_003568313.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Brachypodium distachyon]

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 230/251 (92%), Gaps = 1/251 (0%)
 Frame = -2





Query  247  DDSSPLQPEVV  215
            DD SP+ P+VV
Sbjct  801  DDGSPVLPDVV  811

>ref|XP_010920548.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Elaeis guineensis]

 Score =   423 bits (1088),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD S     VVP
Sbjct  807  DDGSSSLCGVVP  818

>ref|XP_009781386.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]

 Score =   423 bits (1087),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 226/243 (93%), Gaps = 2/243 (1%)
 Frame = -2





Query  247  DDS  239
            + S
Sbjct  797  NGS  799

>ref|XP_010469994.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010469995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X2 [Camelina sativa]

 Score =   423 bits (1087),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/253 (80%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  799  EGAPPPLEPQVVP  811

>ref|XP_010487557.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Camelina sativa]

 Score =   423 bits (1087),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  803  DGVPPLEPQVVP  814

>ref|XP_002881027.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
 gb|EFH57286.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 

 Score =   422 bits (1086),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 223/252 (88%), Gaps = 0/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  806  GVPPPLEPQVIP  817

>ref|XP_010414442.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Camelina sativa]

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  799  EGAPPPLEPQVVP  811

>ref|XP_010521865.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Tarenaya hassleriana]

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 223/252 (88%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  797  GGVPPLEPQVVP  808

>gb|AFW82207.1| hypothetical protein ZEAMMB73_958383 [Zea mays]

 Score =   421 bits (1083),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D S P+  +VVP
Sbjct  804  DSSPPVG-DVVP  814

>ref|XP_012066998.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Jatropha curcas]
 gb|KDP42240.1| hypothetical protein JCGZ_02970 [Jatropha curcas]

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2





>ref|XP_010510537.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Camelina sativa]

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  796  EGAPPPLEPQVVP  808

>ref|XP_012066999.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Jatropha curcas]

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2





>emb|CDY39531.1| BnaC04g15300D [Brassica napus]

 Score =   421 bits (1082),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  810  GAPPPLEPQVVP  821

>ref|NP_850129.1| FTSH protease 3 [Arabidopsis thaliana]
 sp|Q84WU8.1|FTSH3_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=AtFTSH3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22572.1| putative AAA-type ATPase [Arabidopsis thaliana]
 gb|AEC08208.1| FTSH protease 3 [Arabidopsis thaliana]

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 222/252 (88%), Gaps = 0/252 (0%)
 Frame = -2




            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A          D

Query  247  DDSSPLQPEVVP  212
                P +P+VVP
Sbjct  797  GAPPPFEPQVVP  808

>ref|XP_009611240.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 225/244 (92%), Gaps = 2/244 (1%)
 Frame = -2





Query  247  DDSS  236
            + SS
Sbjct  799  NGSS  802

>gb|AAC33234.1| putative AAA-type ATPase [Arabidopsis thaliana]

 Score =   420 bits (1080),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 222/252 (88%), Gaps = 0/252 (0%)
 Frame = -2




            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A          D

Query  247  DDSSPLQPEVVP  212
                P +P+VVP
Sbjct  795  GAPPPFEPQVVP  806

>ref|XP_009125053.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Brassica rapa]

 Score =   421 bits (1081),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  802  GAPPPLEPQVVP  813

>ref|XP_006655377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Oryza brachyantha]

 Score =   420 bits (1079),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 229/252 (91%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  786  DDGTPSLGEVVP  797

>ref|XP_002313426.1| FtsH protease family protein [Populus trichocarpa]
 gb|EEE87381.1| FtsH protease family protein [Populus trichocarpa]

 Score =   419 bits (1078),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 226/252 (90%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSP+  E VP
Sbjct  776  DQSSPI--EAVP  785

>ref|XP_006306790.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
 gb|EOA39688.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]

 Score =   420 bits (1079),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 226/252 (90%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  799  DGVPPLEPQVVP  810

>gb|AAL36270.1| putative AAA-type ATPase [Arabidopsis thaliana]

 Score =   420 bits (1079),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 221/252 (88%), Gaps = 0/252 (0%)
 Frame = -2




            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A          D

Query  247  DDSSPLQPEVVP  212
                P +P+VVP
Sbjct  797  GAPPPFEPQVVP  808

>emb|CDY47876.1| BnaA07g14210D [Brassica napus]

 Score =   420 bits (1080),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  818  GAPPPLEPQVVP  829

>emb|CDP09082.1| unnamed protein product [Coffea canephora]

 Score =   419 bits (1078),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 229/252 (91%), Gaps = 2/252 (1%)
 Frame = -2




            +IAELLLEKEVLHQ+DLV+VLG+RPF+S+E TNYDR+K GF E++  + K   ++++T D

Query  247  DDSSPLQPEVVP  212
            D  SPL+PEVVP
Sbjct  809  DGPSPLEPEVVP  820

>ref|XP_010542637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010542639.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 225/253 (89%), Gaps = 1/253 (0%)
 Frame = -2




            Q+AELLLE+EVLHQ+DLV+VLGERPF+S E TNYDRFK GF E  +  + + + +   +D

Query  247  DDSS-PLQPEVVP  212
               + PL+P+VVP
Sbjct  804  SGGAPPLEPQVVP  816

>ref|XP_006409951.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
 gb|ESQ51404.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  801  GAPPPLEPQVVP  812

>ref|XP_009118433.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Brassica rapa]
 emb|CDY06264.1| BnaA09g49390D [Brassica napus]

 Score =   418 bits (1075),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 223/252 (88%), Gaps = 5/252 (2%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
              S PL+P+VVP
Sbjct  788  GASPPLEPQVVP  799

>ref|XP_007133225.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
 gb|ESW05219.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]

 Score =   418 bits (1075),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 211/253 (83%), Positives = 234/253 (92%), Gaps = 1/253 (0%)
 Frame = -2





Query  250  DDDSSPLQPEVVP  212
Sbjct  798  GGGSSPLEPQVVP  810

>ref|NP_172231.2| FTSH protease 10 [Arabidopsis thaliana]
 sp|Q8VZI8.1|FTSHA_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; 
Short=AtFTSH10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36045.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AAM70517.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AEE28137.1| FTSH protease 10 [Arabidopsis thaliana]

 Score =   418 bits (1075),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  801  DGIPPLEPQVVP  812

>ref|XP_011032280.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
 ref|XP_011042728.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]

 Score =   417 bits (1071),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 3/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SSP+  EVVP
Sbjct  803  DQSSPI--EVVP  812

>gb|AAK77908.1|AF397903_1 AAA-metalloprotease FtsH [Pisum sativum]

 Score =   416 bits (1070),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 226/252 (90%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  798  GGSSPLEPEVVP  809

>ref|XP_002889652.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65911.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]

 Score =   416 bits (1068),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 224/252 (89%), Gaps = 2/252 (1%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  801  GGVPPLEPQVVP  812

>ref|XP_008784613.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]

 Score =   414 bits (1065),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = -2





>ref|NP_001044774.1| Os01g0842600 [Oryza sativa Japonica Group]
 sp|Q8S2A7.1|FTSH3_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=OsFTSH3; Flags: Precursor [Oryza sativa Japonica 
 dbj|BAB86453.1| putative AAA-metalloprotease FtsH [Oryza sativa Japonica Group]
 dbj|BAF06688.1| Os01g0842600 [Oryza sativa Japonica Group]
 gb|EAZ14117.1| hypothetical protein OsJ_04041 [Oryza sativa Japonica Group]
 dbj|BAG94510.1| unnamed protein product [Oryza sativa Japonica Group]

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -2





>gb|EAY76461.1| hypothetical protein OsI_04395 [Oryza sativa Indica Group]

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -2





>ref|XP_006845226.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Amborella trichopoda]
 gb|ERN06901.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]

 Score =   413 bits (1061),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            DD+  L   VVP
Sbjct  813  DDTPSLDGAVVP  824

>dbj|BAJ98147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03446.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93081.1| predicted protein [Hordeum vulgare subsp. vulgare]

 Score =   412 bits (1058),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 223/251 (89%), Gaps = 1/251 (0%)
 Frame = -2




             IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D+E +  +  ++    D

Query  247  DDSSPLQPEVV  215
            DD S + P VV
Sbjct  798  DDGSAVLPNVV  808

>ref|XP_006644995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Oryza brachyantha]

 Score =   411 bits (1057),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 220/238 (92%), Gaps = 0/238 (0%)
 Frame = -2





>gb|KJB16965.1| hypothetical protein B456_002G257200 [Gossypium raimondii]

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = -2





>ref|XP_004970544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Setaria italica]

 Score =   410 bits (1053),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -2





>gb|EMT04659.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 

 Score =   406 bits (1044),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 224/254 (88%), Gaps = 3/254 (1%)
 Frame = -2




             IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D+E +  + A+     D

Query  247  DD--SSPLQPEVVP  212
            DD  ++ L   VVP
Sbjct  689  DDGPAAALPDVVVP  702

>gb|EMS50561.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/254 (78%), Positives = 226/254 (89%), Gaps = 3/254 (1%)
 Frame = -2




             IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D++++  + A+N    D

Query  247  DD--SSPLQPEVVP  212
            DD  ++ L   VVP
Sbjct  734  DDGPAAALPDVVVP  747

>ref|XP_008799731.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]

 Score =   408 bits (1049),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 223/252 (88%), Gaps = 1/252 (0%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SS L  EVVP
Sbjct  808  DRSSSLSGEVVP  819

>ref|XP_007132051.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
 gb|ESW04045.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]

 Score =   406 bits (1043),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = -2




            Q+A+LLLEKEVLHQEDL  +LGERPFK++EPTNYDRFK+GF E++E  A+ +  +   + 

Query  247  DDSSPLQPEVVP  212
Sbjct  797  GGSSPLEPQVVP  808

>ref|XP_003606687.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES88884.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]

 Score =   405 bits (1041),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 221/252 (88%), Gaps = 4/252 (2%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
Sbjct  795  SGSSPLEPEVVP  806

>gb|EYU38460.1| hypothetical protein MIMGU_mgv1a001496mg [Erythranthe guttata]

 Score =   405 bits (1041),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 218/253 (86%), Gaps = 15/253 (6%)
 Frame = -2




            QIAELLLEKE LHQEDLV+VLG RPF+SSE TNYDR+K GF ++   EA           

Query  247  DDSSPLQPEVVPV  209
                 + PEVVPV
Sbjct  801  -----VLPEVVPV  808

>gb|AAF79577.1|AC022464_35 F22G5.10 [Arabidopsis thaliana]

 Score =   406 bits (1043),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 203/274 (74%), Positives = 225/274 (82%), Gaps = 24/274 (9%)
 Frame = -2


            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E                      QV++G+



             GF E ++   K++   K  +DD   PL+P+VVP

>ref|XP_002458748.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
 gb|EES03868.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]

 Score =   404 bits (1039),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 215/234 (92%), Gaps = 5/234 (2%)
 Frame = -2





>gb|KCW85527.1| hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis]

 Score =   402 bits (1032),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 224/253 (89%), Gaps = 6/253 (2%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  786  DESPPPLDPQVVP  798

>ref|XP_010043510.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]

 Score =   401 bits (1031),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 224/253 (89%), Gaps = 6/253 (2%)
 Frame = -2





Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  800  DESPPPLDPQVVP  812

>gb|EPS71434.1| hypothetical protein M569_03325, partial [Genlisea aurea]

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -2





>ref|NP_001145329.1| uncharacterized protein LOC100278654 [Zea mays]
 gb|ACG46821.1| hypothetical protein [Zea mays]

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 202/214 (94%), Gaps = 1/214 (0%)
 Frame = -2





>ref|XP_008358519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -2





>gb|KJB36698.1| hypothetical protein B456_006G171800 [Gossypium raimondii]

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 217/253 (86%), Gaps = 16/253 (6%)
 Frame = -2




                         QEDL+R+LG+RPFKSSEPTNY+RFK GF E+ + E KDT  E ++  

Query  250  DDDSSPLQPEVVP  212
            DD S+PL+PEVVP
Sbjct  604  DDGSTPLKPEVVP  616

>ref|XP_004507174.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cicer arietinum]

 Score =   394 bits (1011),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 215/252 (85%), Gaps = 11/252 (4%)
 Frame = -2




            QIAELLLEKEVLHQ+DL +VLGERPFK++E +NYDRFK GF ED +              

Query  247  DDSSPLQPEVVP  212
              SSPL PEVVP
Sbjct  788  GSSSPLDPEVVP  799

>emb|CDM84966.1| unnamed protein product [Triticum aestivum]

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -2





>ref|XP_001785268.1| predicted protein [Physcomitrella patens]
 gb|EDQ49920.1| predicted protein [Physcomitrella patens]

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 213/252 (85%), Gaps = 2/252 (1%)
 Frame = -2




             +A  LLEKEVLHQEDLV +LGERPFK++E +NYD+FK GF   +E +AK  +   S  +

Query  247  DDSSPLQPEVVP  212
            D  SP QP   P
Sbjct  666  DGISPEQPSSTP  677

>gb|EMS48627.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 

 Score =   391 bits (1004),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/252 (77%), Positives = 215/252 (85%), Gaps = 9/252 (4%)
 Frame = -2





Query  247  DDSSPLQPEVVP  212
            D SS +  E VP
Sbjct  797  DPSSSVG-EAVP  807

>gb|EMT07840.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 

 Score =   393 bits (1009),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -2





>emb|CDY09913.1| BnaC08g45380D [Brassica napus]

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 208/243 (86%), Gaps = 5/243 (2%)
 Frame = -2




            KEVLHQ+DL +VLGERPFKS E TNYDRFK GF   +ET+ ++        D  S PL+P

Query  223  EVV  215
Sbjct  763  QVV  765

>ref|XP_003567261.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brachypodium distachyon]

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 210/244 (86%), Gaps = 9/244 (4%)
 Frame = -2





Query  223  EVVP  212
            E VP
Sbjct  631  EAVP  634

>ref|XP_011623752.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial [Amborella trichopoda]

 Score =   367 bits (942),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = -2



            YGFS+KVGLLSFP  +  +E +KPYSN+T  IID EVR+WI KAY+ T++LIEE +  V 


>gb|KEH23850.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]

 Score =   373 bits (958),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2





>ref|XP_001782950.1| predicted protein [Physcomitrella patens]
 gb|EDQ52248.1| predicted protein [Physcomitrella patens]

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -2




             +A  LLEKEVLHQEDLV +LGERPFK +E +NYD+FK GF   ++ + K

>ref|XP_001759881.1| predicted protein [Physcomitrella patens]
 gb|EDQ75385.1| predicted protein [Physcomitrella patens]

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = -2





>gb|AES75793.2| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 207/233 (89%), Gaps = 5/233 (2%)
 Frame = -2




            ++AELLLEKEVLHQ++L++VLG R PFKS+E  NYD+ K G     + EAKD 

>ref|XP_003624038.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES80256.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]

 Score =   358 bits (919),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -2





>ref|XP_003619575.1| Cell division protease ftsH-like protein [Medicago truncatula]

 Score =   361 bits (927),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 207/233 (89%), Gaps = 5/233 (2%)
 Frame = -2




            ++AELLLEKEVLHQ++L++VLG R PFKS+E  NYD+ K G     + EAKD 

>gb|ERN06910.1| hypothetical protein AMTR_s00005p00257870 [Amborella trichopoda]

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2



              +E +KPYSN+T  IID EVR+WI KAY+ T++LIEE +  V +IAELLL+KEVLH+ D

            L+++LGERPF SSEPTNYD F  GF ++++

>ref|XP_002981661.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
 gb|EFJ17143.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 

 Score =   348 bits (894),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -2




            ++A+ LL +EVLH  DLV VLG RPFK++E    DR +  F

>ref|XP_002967857.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
 gb|EFJ31204.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -2




            ++A+ LL +EVLH  DLV VLG RPFK++E    DR +  F

>ref|XP_002980658.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
 gb|EFJ18309.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 187/231 (81%), Gaps = 4/231 (2%)
 Frame = -2



            YGFSDKVGL+SF P ++  E+ KP+SN T+ ++D E R  +  AY  T  LI++H++ VA

            +IAELLLEKEVL QEDL+ VLGERPF      NYD ++ GF   K+ EA D

>ref|XP_002984562.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
 gb|EFJ14207.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 187/231 (81%), Gaps = 4/231 (2%)
 Frame = -2



            YGFSDKVGL+SF P ++  E+ KP+SN T+ ++D E R  ++ AY  T  LI++H++ VA

            +IAELLLEKEVL QEDL+ VLGERPF      NYD ++ GF   K  EA D

>ref|XP_005651157.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
 gb|EIE26613.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 

 Score =   324 bits (830),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 189/226 (84%), Gaps = 2/226 (1%)
 Frame = -2



            YG + KVGL+SFP  +  F  SKPYS++TA +ID EVRE +  AYE T++L+ E K+ V 

            ++A  LLEKEV++ EDL  +LGERP++S+E  N D+F+DGF +  E

>ref|XP_002505472.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66730.1| predicted protein [Micromonas sp. RCC299]

 Score =   318 bits (814),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 5/240 (2%)
 Frame = -2



            YG ++KVG+LSFP ++  F+  KPYS  TA +ID EVRE + +AY+ TV L++E KE V 

             +A+ LLE+EVL + DLV++LG+RPFK     N D   +GF   K  E K TAE+ + +D

>ref|XP_001422694.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01011.1| predicted protein [Ostreococcus lucimarinus CCE9901]

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 189/258 (73%), Gaps = 12/258 (5%)
 Frame = -2



            VAVYG ++K+GLLSFP +E +  +  PYS  TA +ID EVR  +  AY+ T+ L++E K 

             V  +A+ LL+KEVL + DLV++LG+RPF S  P N D   +GF           E E  

            DT E    +DD+ SP  P
Sbjct  459  DTDE---PEDDEPSPAFP  473

>ref|XP_003082962.1| FtsH protease, putative (ISS) [Ostreococcus tauri]
 emb|CAL56917.1| Peptidase M41, FtsH extracellular [Ostreococcus tauri]

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -2



            YG ++K+GLLSFP +E +  +  PYS  TA +ID EVR  + KAY+ TV L+EE K  V 

             +A  LL+KEVL + DLV++LGERPF S  P N D   +GF

>gb|ERN06906.1| hypothetical protein AMTR_s00005p00257390 [Amborella trichopoda]

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 184/239 (77%), Gaps = 13/239 (5%)
 Frame = -2


            GFAQY+PNENLLMTKEQLFD+TCMTLGGRASE  +      +  G +N +   + + Y  

            +  +G           S+KVGLLSFP  +  +E ++PYSN+T  IID EVR+W+ KAY+ 


>ref|XP_007509883.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18998.1| predicted protein [Bathycoccus prasinos]

 Score =   309 bits (792),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 190/264 (72%), Gaps = 15/264 (6%)
 Frame = -2



            YG + K+GLLSFP  +N F+   PYS  TA +ID EVRE + KAY  TV L+ E K  V 

             +A  LL+KEVL + DLV+VLGERPFK     N D    GF ++K      + ++D A N

Query  262  KSTKD------DDSSPLQPEVVPV  209
             + +D      D S P+ P  +PV

>ref|XP_003631103.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AET05579.1| peptidase family M41 protein [Medicago truncatula]

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 176/220 (80%), Gaps = 17/220 (8%)
 Frame = -2


            GFAQYVPNEN LMT+                  V++G ISTGAQ+DLEKVTKM YAQVAV


            +IA+LLLEKEVLHQ+DL++VLG +     E  + +   DG

>ref|XP_011400128.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
 gb|KFM27161.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 

 Score =   313 bits (801),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 180/220 (82%), Gaps = 2/220 (1%)
 Frame = -2



             YG +D VGL+SFP  E AF  +KPYS+ TA +ID EVR  +A AY  T+ L+EE +  V 

              +A+ LLE+EVL  E+L  +LGERP++S+E  N D+F+DG

>ref|XP_003059742.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55694.1| predicted protein, partial [Micromonas pusilla CCMP1545]

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -2



            YG ++KVG+LSFP ++  F+  KPYS  TA +ID EVR  +A AY+ T+ LI + +  V 

             +A+ LLEKEVL + DLV VLG RPF      N D   +GF

>gb|KEH16019.1| ATP-dependent zinc metalloprotease FTSH protein, partial [Medicago 

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 170/206 (83%), Gaps = 16/206 (8%)
 Frame = -2

            FE+AIDRVIGGLEKKN  +                + GWFLEH EPLLKVTIVPRGT  L



            A+IAELLLEKEVL+Q+DL++VL + P

>ref|XP_001689949.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP09687.1| membrane AAA-metalloprotease, partial [Chlamydomonas reinhardtii]

 Score =   291 bits (744),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 181/233 (78%), Gaps = 15/233 (6%)
 Frame = -2



            E++T+M Y+QVAVYG ++KVGL+SF  + +AF+  KPYS+ TA +ID EVR +I +AY  

            T+ L+E+H+  +  + + LL KEVL+ +D+ R+LG+RPF S+E  N DRF+ G

>gb|KHG19679.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Gossypium 

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 154/189 (81%), Gaps = 24/189 (13%)
 Frame = -2

            FE+A+DRVIGGLEKKNKVISKLE +TVAYHESGHAVAG                      



Query  427  QIAELLLEK  401
Sbjct  385  QVAELLLEK  393

>ref|WP_041883641.1| peptidase M41 [Pedobacter sp. NL19]
 gb|KIO76076.1| peptidase M41 [Pedobacter sp. NL19]

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 176/246 (72%), Gaps = 2/246 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +

            YG +  +G +SF   +N +  +KPYS KT+ +ID EVR  I + YE T+QL+ E +E + 

            ++AE LLEKE+L Q DL  +LG+RPF +   T YD F +G  + K        E      

Query  247  DDSSPL  230
            D SSPL
Sbjct  684  DPSSPL  689

>ref|XP_005850885.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
 gb|EFN58783.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = -2



              +++KPYS+ TA IID EVR  +  AY+ TVQL+EE K  V  +A+ LL+KEVL  E+L

              +LG RP++S+E  N D+ K

>ref|XP_003292084.1| hypothetical protein DICPUDRAFT_39991 [Dictyostelium purpureum]
 gb|EGC31386.1| hypothetical protein DICPUDRAFT_39991 [Dictyostelium purpureum]

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -2


            G+AQY+P E  L  KEQ+FDM CM LGGR +EQ+  G I+TGAQ+DL+K+TKM Y+Q+++

            YG ++KVG LSFP  +N+ ++++PYS +TA ++D EVR+ +  AY+ T +L+ EHK+ + 

             +A+LLLEKEV+H E++  VLG+RPF+ ++

>ref|WP_037443193.1| peptidase M41 [Sphingobacterium antarcticum]
 gb|KEQ28898.1| peptidase M41 [Sphingobacterium antarcticus 4BY]

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 178/248 (72%), Gaps = 2/248 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +

            YG +  +G +SF   +N +  +KPYS KT+ +ID EVR+ ++  YE T+QL+ + +E + 

            ++AE LLEKE+L Q DL  +LG+RPF++   T YD F +G  + K        E      

Query  247  DDSSPLQP  224
              S+P+ P
Sbjct  684  APSAPVAP  691

>ref|WP_026897433.1| peptidase M41 [Pedobacter oryzae]

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 180/243 (74%), Gaps = 3/243 (1%)
 Frame = -2



            YG +++VG +SF   +  ++ +KPYS KT+ IID EVRE I ++Y+ T  L+ E ++ + 

            ++A  LLEKE+L Q DL  +LG+RPF +   T YD F +G V +   E ++  E++   D

Query  247  DDS  239
Sbjct  684  HNA  686

>dbj|GAM28243.1| hypothetical protein SAMD00019534_114190 [Acytostelium subglobosum 

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = -2



            YG +DKVG LS+P  +++ +++KPYS +TA I+D EVR  + +AY+ T ++++EHKE + 

             +A LLL KEV+H ED+ ++LG RPF   EP

>ref|XP_638674.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL65313.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = -2


            G+AQY+P E  L  +EQ+FDM CM LGGR +EQ+  G I+TGAQ+DLEK+TKM Y+QV++

            YG ++K+G LS+   ++  +++KPYS +TA ++D EVR+ +  AY+ T Q+++EH+E + 

             +A LLLEKEV+H E++  VLG RPF  K+ EP N +

>ref|WP_013664355.1| peptidase M41 [Sphingobacterium sp. 21]
 gb|ADZ77627.1| ATP-dependent metalloprotease FtsH [Sphingobacterium sp. 21]

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 167/220 (76%), Gaps = 3/220 (1%)
 Frame = -2



            YG ++KVG +SF  ++ + +  KPYS KTA +ID EVR+ I+  YE T QL+ E  + + 

             +AE LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|WP_008241678.1| peptidase M41 [Pedobacter sp. BAL39]
 gb|EDM36319.1| cell division protein, ATP-dependent metalloprotease [Pedobacter 
sp. BAL39]

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 168/220 (76%), Gaps = 2/220 (1%)
 Frame = -2



            YG +  +G +SF   +N +  +KPYS KT+ +ID EVR+ I +AYE T QL+ + +E + 

            ++A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|WP_037533932.1| peptidase M41 [Sphingobacterium thalpophilum]

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 167/220 (76%), Gaps = 3/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++T+++YA +A+

            YG +DKVG +SF  +  A    KPYS+KTA +ID EVR  I   Y  T QL+ E +E + 

            +IAE LLEKE+L Q DL  +LG+RPF++   T YD F +G

>ref|WP_012780210.1| peptidase M41 [Pedobacter heparinus]
 gb|ACU02256.1| ATP-dependent metalloprotease FtsH [Pedobacter heparinus DSM 

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 176/248 (71%), Gaps = 2/248 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +

            YG +  +G +SF   +N +  +KPYS KT+ +IDNEVR  I++ Y  T  L+ + +E + 

            ++A+ L+EKE+L Q DL  +LG+RPF +   T YD F +G  + K        +  S   

Query  247  DDSSPLQP  224
            D ++P+ P
Sbjct  684  DPATPITP  691

>ref|WP_039053642.1| peptidase M41, partial [Sphingobacterium sp. T2]

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 168/220 (76%), Gaps = 3/220 (1%)
 Frame = -2



            YG ++KVG +SF  +  + +  KPYS +TA +ID EVR+ IA  Y+ T +L+ E +E + 

            +IAE LLEKE+L Q DL  +LG+RPF  S  T YD F +G

>gb|EQB80316.1| hypothetical protein L950_08340 [Sphingobacterium sp. IITKGP-BTPF85]

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+

            YG +DKVG +SF      F   KPYS+KTA +ID+EVR  I   Y  T QL+ + +E + 

             IAE LLEKE+L Q DL  +LG+RPF +   T YD F

>ref|WP_014682322.1| peptidase M41 [Solitalea canadensis]
 gb|AFD09100.1| ATP-dependent metalloprotease FtsH [Solitalea canadensis DSM 

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +

            YG ++KVG +SF   +N +  SKPYS KT+ +ID+EVR+ I   Y  T  L+ E +  + 

             +A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G

>dbj|BAF01982.1| hypothetical protein [Arabidopsis thaliana]

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = -2



            +VLGERPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP

>gb|EFA84387.1| peptidase M41 [Polysphondylium pallidum PN500]

 Score =   273 bits (699),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = -2



            YG ++KVG LS+P  +++ +++KPYS++TA IID EVR  +  AY  T +++E HKE + 

            ++A LLLEKEV+H ED+ ++LG RPF ++

>ref|WP_021069372.1| peptidase M41 [Sphingobacterium paucimobilis]
 gb|ERJ57782.1| peptidase M41 [Sphingobacterium paucimobilis HER1398]
 gb|ERJ60233.1| peptidase M41 [Sphingobacterium paucimobilis HER1398]

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG + KVG +SF  +    +  KPYS++TA +ID EVR  +A  YE T QL+ + ++ + 

            +IAE LLEKE+L Q DL  +LG+RPF  S  T YD F +G

>ref|WP_010600005.1| peptidase M41 [Pedobacter agri]

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 168/220 (76%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  GKISTGAQNDLE++TK++YA V++

            YG ++ VG +SF   +N +  +KPYS+KT+ +ID EVR+ I   Y  T QL+ + ++ + 

            ++A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G

>gb|AFM03376.1| membrane protease FtsH catalytic subunit [Flexibacter litoralis 
DSM 6794]

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 170/222 (77%), Gaps = 3/222 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CM LGGRA+E ++ GKISTGA +DLE++TKM Y+ V+V

            YG + K+G +SF   + +    KPYS  TA IID EV+E + +AY  T +L+ EHK+ + 

             IA+ LLEKEVL Q DL R++G+RPF   +PTNY++  K+GF

>ref|WP_040539886.1| peptidase M41 [Pedobacter arcticus]

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  GKISTGAQNDLE++TK+ YA V +

            YG S+KVG +SF      +  SKPYS+KTA +ID+EVRE I+  Y+ T  L+ E ++ + 

             +A  LLEKE+L Q DL  +LG+RPF +   T YD F +G

>gb|ETZ19316.1| peptidase M41 [Pedobacter sp. V48]

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 169/220 (77%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +

            YG +  +G +SF   +N +  +KPYS KT+ +ID+EVR  I++ Y+ T QL+ + ++ + 

            ++A+ L+EKE+L Q DL  +LG+RPF +   T YD F +G

>ref|XP_002741203.1| PREDICTED: AFG3-like protein 2, partial [Saccoglossus kowalevskii]

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 171/221 (77%), Gaps = 4/221 (2%)
 Frame = -2


            G+AQY+P E  L +KEQL D  CMTLGGR SE+++ G+I+TGAQ+DL+KVT+  YAQV  

            +G S+KVG +SF  P +    M KPYS +TA +IDNEVR  I  AY+ TV L++ H+E++

             ++A+ LL KEVL +ED+V +LGERPF  +E + Y++F +G

>ref|WP_037497088.1| peptidase M41 [Sphingobacterium sp. ACCC 05744]
 gb|KGE14923.1| ATP-dependent metalloprotease FtsH [Sphingobacterium sp. ACCC 

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG +DKVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T QL+ + ++ + 

            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F

>ref|WP_037460377.1| peptidase M41, partial [Sphingobacterium spiritivorum]

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 

            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|WP_009033571.1| peptidase M41 [Indibacter alkaliphilus]
 gb|EOZ95809.1| Cell division protein FtsH [Indibacter alkaliphilus LW1]

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 189/261 (72%), Gaps = 13/261 (5%)
 Frame = -2


            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE++TKM Y+ V+V

            YG ++K+G +SF  ++++ + M+KPYS KT+  ID+EVR+ I+ AYE T  L+ E ++ +

              +A+ LLEKE+L Q DL +++G+RPF   + T Y+ F           D  ++DK+  A

            +DT       +D +SP + +V

>ref|WP_039990218.1| peptidase M41, partial [Sphingobacterium spiritivorum]

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 

            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|WP_028295325.1| peptidase M41 [Olivibacter sitiensis]

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 175/256 (68%), Gaps = 14/256 (5%)
 Frame = -2



            YG ++KVG +SF  ++ + +  KPYS KTA +ID EVR  I   Y  T  L+ + +E + 

             +AE LLEKE+L Q DL ++LG+RPF     T YD F +G   D   + K  AE      

Query  265  ---NKSTKDDDSSPLQ  227
               N  T D  +SP Q

>ref|WP_041264331.1| peptidase M41, partial [Flexibacter litoralis]

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CM LGGRA+E ++ GKISTGA +DLE++TKM Y+ V+V

            YG + K+G +SF   + +    KPYS  TA IID EV+E + +AY  T +L+ EHK+ + 

             IA+ LLEKEVL Q DL R++G+RPF   +PTNY++

>gb|EFK59817.1| ATP-dependent metallopeptidase HflB [Sphingobacterium spiritivorum 
ATCC 33861]

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 

            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G

>gb|EEI91234.1| ATP-dependent metallopeptidase HflB [Sphingobacterium spiritivorum 
ATCC 33300]

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 

            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|XP_004362632.1| peptidase M41 [Dictyostelium fasciculatum]
 gb|EGG24781.1| peptidase M41 [Dictyostelium fasciculatum]

 Score =   275 bits (703),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -2



             YG +DKVG +S+P  +N+ + +KPYS +TA ++D EVR  +  AYE TVQ++E+H++ + 

             ++A LLLEKEV+H +D+  +LG RPF

>ref|WP_009053651.1| peptidase M41 [Nitritalea halalkaliphila]
 gb|EIM78320.1| ATP-dependent metalloprotease FtsH [Nitritalea halalkaliphila 

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 179/246 (73%), Gaps = 4/246 (2%)
 Frame = -2



            YG +DK+G +SF  ++ + + M KPYS+KTA  ID EVR+ I   YE T  L++E  E +

             ++A+ LL+KE+L Q DL+ ++G+RPF   + T Y+ F     E D++ E K      ST

Query  253  KDDDSS  236
             + D +
Sbjct  670  GNSDET  675

>ref|WP_036676326.1| peptidase M41 [Pedobacter sp. R20-19]

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 166/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA V++

            YG ++ VG +SF   +N +  +KPYS KT+ +ID EVR+ I   Y  T QL+ + +E + 

            ++A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|WP_038701774.1| peptidase M41 [Sphingobacterium sp. ML3W]
 gb|AIM39226.1| peptidase M41 [Sphingobacterium sp. ML3W]

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 164/217 (76%), Gaps = 4/217 (2%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+

            YG +DKVG +SF   + + +  KPYS+KTA +ID+EVR  I   Y  T QL+ + ++ + 

             IAE LLEKE+L Q DL  +LG+RPF +   T YD F

>ref|WP_033563684.1| peptidase M41 [Sphingobacteriaceae bacterium DW12]

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV

            YG + KVG +SF  +    +  KPYS++TA +ID+EVR  ++  Y+ T +L+ E ++ + 

             IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G

>ref|WP_026968576.1| peptidase M41 [Algoriphagus terrigena]

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 181/253 (72%), Gaps = 5/253 (2%)
 Frame = -2


            G+AQY+P E  L   EQL D  CMTLGGRA+EQ++ GKISTGA +DLE++TK+ Y+ V+V

            YG ++K+G +SF     + ++M+KPYS  TA +ID EV   I  AYE T+ L+ EH+EH+

              +A+ LLEKE+L Q DL  ++G+RPF  ++ T Y  F +   E K  E    A  +   

Query  250  DDDSSPLQPEVVP  212
            ++ S PL  + +P
Sbjct  668  EESSDPLTSKPIP  680

>ref|WP_026902710.1| peptidase M41 [Pedobacter glucosidilyticus]

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 163/220 (74%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +

            YG + KVG +SF    N +  SKPYS+KTA +ID EVR  I   Y  T +L+ E +E + 

             +A+ LLEKE+L Q DL  +LG+RPF     T YD F +G

>ref|WP_045755148.1| peptidase M41 [Sphingobacterium sp. PM2-P1-29]
 emb|CDT09988.1| ATP-dependent zinc metalloprotease FtsH [Sphingobacterium sp. 

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 4/217 (2%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+

            YG ++KVG +SF   + + +  KPYS+KTA +ID+EVR  I   Y  T QL+ E ++ + 

             IAE LLEKE+L Q DL  +LG+RPF +   T YD F

>gb|EIE80123.1| hypothetical protein RO3G_04828 [Rhizopus delemar RA 99-880]

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 181/245 (74%), Gaps = 10/245 (4%)
 Frame = -2


            G+AQY+P +  L +++QL D  CMTLGGR SEQ+    I+TGAQ+DL+KVTKM YAQ+  

            YG ++K+G LSF  P NEN+F+  KP+S +T  +IDNE R  +++AY+ T+QL+ E K  

            + ++A+LLL KEVL +ED+  +LG+RPF  +E T YD     +V  K ++     +    

Query  253  KDDDS  239
Sbjct  636  SDDDS  640

>ref|WP_044224255.1| peptidase M41 [Flammeovirga pacifica]

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 178/236 (75%), Gaps = 5/236 (2%)
 Frame = -2


            G+AQY+P E  L T E++ D  CMTLGGRA+E+++ G+ISTGA +DLE+ TKM Y+ V++

            YG +D++G +SF  PN + +  S+PYS   A  ID+EV++ I KAY+ T+ L+ EH + +

              +A+ LLEKEVL+Q DLV+++GERPF   + T Y  F +   E+K E EAK  AE

>ref|XP_002410299.1| ATPase, putative [Ixodes scapularis]
 gb|EEC12875.1| ATPase, putative [Ixodes scapularis]

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 175/245 (71%), Gaps = 7/245 (3%)
 Frame = -2



            +G ++KVG LSF  P      + KPYS +TA +ID+EVR+ + +AY+ T+ L+ EHK  V

             +IA+ LLEKE+L +ED++ +LG+RPF   E + Y+ F +G   F ED        + NK

Query  259  STKDD  245
Sbjct  345  GPEDE  349

>ref|WP_039450881.1| peptidase M41 [Pedobacter glucosidilyticus]
 gb|KHJ38295.1| ATP-dependent zinc metalloprotease FtsH 4 [Pedobacter glucosidilyticus]

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 162/220 (74%), Gaps = 2/220 (1%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMT+GGR +E ++  KISTGAQNDLE++TK+ YA V +

            YG + KVG +SF    N +  SKPYS+KTA +ID EVR  I   Y  T QL+ E +E + 

             +A+ LLEKE+L Q DL  +LG+RPF     T YD F +G

>ref|XP_003979383.1| PREDICTED: AFG3-like protein 2 [Takifugu rubripes]

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2


            G+AQY+P E  L TKEQL D  CMTLGGR SE++  G+I+TGAQ+DL KVT+  YAQ+  

            +G + KVG +SF  P +    + KPYS  TA +ID EVR  I++AY+ T+QL++E K  V

             ++A  LLEKEVL + D+V +LG+RPF  +E + Y+ F +G

>ref|WP_026951332.1| peptidase M41 [Algoriphagus mannitolivorans]

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 184/253 (73%), Gaps = 5/253 (2%)
 Frame = -2


            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE++TK+ Y+ V+V

            YG ++K+G +SF     + ++M+KPYS  TA +ID EV + I  AY+ T+ L+ EH+EH+

              +A+ LLEKE+L Q DL +++G+RPF  ++ T Y  + +   +DK    +  A  +  K

Query  250  DDDSSPLQPEVVP  212
             + S PL  + +P
Sbjct  671  PESSDPLTSDPIP  683

>gb|ESA05195.1| hypothetical protein GLOINDRAFT_66340 [Rhizophagus irregularis 
DAOM 181602]

 Score =   265 bits (677),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 174/242 (72%), Gaps = 6/242 (2%)
 Frame = -2


            G+AQY+P +  L +  QL D  CMTLGGR SEQ+    I+TGA +DL++VTK+ YAQV  

            YG +  VG LSF  PN+N  +  KPYS +TA +ID EVR+ +A AYE TV+L+ + K  V

             ++A+LLL KEVL+++D++ +LG+RPF   E  NY+ +   F   + T    +AE   + 

Query  250  DD  245
Sbjct  645  SN  646

>ref|XP_001744500.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90449.1| predicted protein [Monosiga brevicollis MX1]

 Score =   264 bits (675),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 184/253 (73%), Gaps = 12/253 (5%)
 Frame = -2


            G+AQY+P E  L + +QL D  CM LGGR SEQ+   +I+TGAQ+DL+KVT++ Y+Q+AV

            YG + KVG LSF  P++N     KPYS  TA +ID E R  +  A+  T++L+ E ++ V

             ++A+LLL++EVL ++D+V +LG RPFK  E  +YD+F +D   +D+E +         +

Query  277  DTAENKSTKDDDS  239
            ++A+ +  +D DS
Sbjct  612  ESAQKRHDRDADS  624

>ref|WP_009186129.1| peptidase M41 [Cecembia lonarensis]
 gb|EKB48294.1| ATP-dependent zinc metalloprotease FtsH [Cecembia lonarensis 

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 181/252 (72%), Gaps = 8/252 (3%)
 Frame = -2


            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE++TKM Y+ V++

            YG +DK+G +SF     N + M+KPYS  TA  ID EVR+ I+ AYE T +L+ E +  +

              +++ LLEKE+L Q DL +++G+RPF  ++ T Y+ F    VE+KE   K  +    E+

Query  262  KSTKDDDSSPLQ  227
             S K  D+   Q
Sbjct  669  DSVKGTDAEKAQ  680

>ref|WP_039137089.1| ATPase AAA, partial [Flavihumibacter solisilvae]

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 161/208 (77%), Gaps = 4/208 (2%)
 Frame = -2


            G+AQY P E  L   +QL D  CMTLGGRA+E +  GKISTGAQNDL+++T+M YA V V

            YG +DKVG +SF  P  EN+F  +KPYS +T+ +ID EVR+ I  AY+ T +L+ E ++ 

            V  +AE LL+KEVL Q D+ +++G+RPF

>gb|EMS32972.1| Cell division protein FtsH [Mariniradius saccharolyticus AK6]

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 182/247 (74%), Gaps = 6/247 (2%)
 Frame = -2



            YG +DK+G +SF  ++ + + M+KPYS  TA  ID EVR+ ++ AYE T +L+   +E +

              +A+ LLEKE+L Q DL R++G+RPF  ++ T Y+ F  K   V  KE EA+  AE+  

Query  256  TKDDDSS  236
Sbjct  669  KVPADSS  675

>dbj|GAO41819.1| ATP-dependent zinc metalloprotease FtsH [Flavihumibacter petaseus 
NBRC 106054]

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = -2



             +YG ++KVG +SF  P  EN+F  +KPYS +T+ +ID EVR+ I +AY+ T  L+ E K

            E V  +AE LL+KEVL Q D+ +++G+RPF

>ref|WP_019597947.1| peptidase M41 [Rhodonellum psychrophilum]
 gb|ERM84443.1| peptidase M41 [Rhodonellum psychrophilum GCM71 = DSM 17998]

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 179/248 (72%), Gaps = 3/248 (1%)
 Frame = -2


            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE+VTK+ Y+ V V

            YG +DK+G +SF  ++ N ++M+KPYS  TA  ID EVR+ I++AYE T  L+   K  V

              +A+ LLEKE++ Q DL R++G+RPF  ++ T Y+ +        E   K+ A+++  +

Query  250  DDDSSPLQ  227
            D   + +Q
Sbjct  670  DPAEAEVQ  677

>ref|WP_020892866.1| Cell division protein FtsH [Cyclobacterium qasimii]
 gb|EPR68329.1| Cell division protein FtsH [Cyclobacterium qasimii M12-11B]

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 176/242 (73%), Gaps = 5/242 (2%)
 Frame = -2


            G+AQY+P E  L   EQL D  CM LGGRA+EQ++ GKISTGA +DLE++TKM Y+ V+V

            YG +DK+G +SF     N ++  KPYS  TA  ID EVR+ I  AY  T+ L+++ K+ +

             +IA+ LLEKE+L Q DL +++G+RPF   + T Y++F    V+++ET   +  E     

Query  250  DD  245
Sbjct  667  DD  668

>ref|WP_040480273.1| peptidase M41, partial [Mariniradius saccharolyticus]

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 178/238 (75%), Gaps = 6/238 (3%)
 Frame = -2



            YG +DK+G +SF  ++ + + M+KPYS  TA  ID EVR+ ++ AYE T +L+   +E +

              +A+ LLEKE+L Q DL R++G+RPF  ++ T Y+ F     +  +  AK+ AE K+

>ref|WP_009578256.1| Cell division protein FtsH [Fulvivirga imtechensis]
 gb|ELR73086.1| Cell division protein FtsH [Fulvivirga imtechensis AK7]

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 176/246 (72%), Gaps = 3/246 (1%)
 Frame = -2


            G+AQY+P E  L   EQL D  CM LGGRA+E+++  KISTGA +DLE+VTKM Y+ V+V

            YG + K+G +SF    ++ +  +KPYS  TA  ID EVR+ I  A+E T  L+   ++ +

              +A+ LLEKE++ Q DL R++G+RPF  S PTNY+ + +G  ++KE   +D +++    

Query  250  DDDSSP  233
Sbjct  668  GQSSAP  673

>ref|WP_039133743.1| ATPase AAA, partial [Flavihumibacter sp. ZG627]

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 158/208 (76%), Gaps = 4/208 (2%)
 Frame = -2


            G+AQY P E  L   +QL D  CMTLGGRA+E +  GKISTGAQNDL+++T+M Y+ V V

            YG +DKVG +SF  P  EN+F  +KPYS +T+ IID EVR  I  AYE T QL+ E K  

            V  +AE LL+KEVL Q D+  ++G+RP+

>ref|WP_017733337.1| hypothetical protein [Nafulsella turpanensis]

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 169/224 (75%), Gaps = 3/224 (1%)
 Frame = -2


            G+AQY+P E  L   EQLFD  CMTLGGRA+EQ++ GKISTGA +DLE++TK+ Y+ V++

            YG ++K+G +SF    +N +  +KPYS  T+  ID EVR  + KAY+ T+ L+    + +

              IA+ LLEKE++ Q DLVR++G RPF+    T Y +F +G +E

>ref|WP_035465307.1| ATPase AAA, partial [Bacteroidetes bacterium SCGC AAA027-G08]

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 158/208 (76%), Gaps = 4/208 (2%)
 Frame = -2


            G+AQY P E  L T EQL D  CMTLGGRA+EQ+  G+ISTGA NDL+++TKM Y+ V  

            YG ++K+G +SF  P  EN F+  KP+S +T  IID EVR+ I  AY  T+ L++  KE 

            V ++A+ LL +EVLH+ D+  ++G+RPF

>ref|WP_014021491.1| peptidase M41 [Cyclobacterium marinum]
 gb|AEL27204.1| ATP-dependent metalloprotease FtsH [Cyclobacterium marinum DSM 

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 176/243 (72%), Gaps = 6/243 (2%)
 Frame = -2


            G+AQY+P E  L   EQL D  CM LGGRA+E+++ GKISTGA +DLE++TKM Y+ V+V

            YG +DK+G +SF  ++   ++  KPYS+ TA  ID EVR+ I  AY  T+ L+ E K+ +

              IA+ LLEKE+L Q DL  ++G+RPF   + T Y++F     EDK  EA    +N +T 

Query  250  DDD  242
Sbjct  666  TDD  668

>gb|EXX70583.1| m-AAA protease subunit YTA12 [Rhizophagus irregularis DAOM 197198w]

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 166/218 (76%), Gaps = 3/218 (1%)
 Frame = -2


            G+AQY+P +  L +  QL D  CMTLGGR SEQ+    I+TGA +DL++VTK+ YAQV  

            YG +  VG LSF  PN+N  +  KPYS +TA +ID EVR+ +A AYE TV+L+ + K  V

             ++A+LLL KEVL+++D++ +LG+RPF   E  NY+ +

>ref|WP_014221908.1| peptidase M41 [Niastella koreensis]
 gb|AEW01997.1| membrane protease FtsH catalytic subunit [Niastella koreensis 

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -2


            G+AQY P E  L   +QL D  CMTLGGRASE +  GKISTGAQNDL+++T++ Y+ V V

            YG ++KVG +SF  P  EN+F  +KPYS +T+ IID EVR+ I  AYE T +L+ E +  

            V ++AE LLEKEVL Q D+  ++G+RPF   +  + D

>ref|WP_026999681.1| peptidase M41 [Flexibacter elegans]

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -2


            G+AQY+P E  L T EQL D  CMTLGGRA+E ++ GKISTGA +DLE++TKM Y+ V++

            YG +DK+G +SF  ++ + +  +KPYS+ TA  ID EVR+ I  AYE T  L+ +H+E +

             ++A+ LL KE+L Q DL  ++G+RPF

>emb|CEJ01398.1| Putative Cell division protease ftsH [Rhizopus microsporus]

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 170/217 (78%), Gaps = 3/217 (1%)
 Frame = -2


            G+AQY+P +  L +KEQL D  CMTLGGR SEQ+    I+TGA +DL+KVTK+ YAQ+  

            YG ++KVG LSF  ++N  ++ KPYS +TA +IDNE R  + +AYE T++L+ E K+ + 

            ++A LLL+KEVL +ED+ ++LG+RPF   E T YD +

>ref|WP_044213238.1| peptidase M41 [Flammeovirga sp. OC4]

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = -2


            G+AQY+P E  L T E++ D  CMTLGGRA+E+++ G+ISTGA +DLE+ TKM Y+ V++

            YG +DK+G +SF  PN + F  S+PYS   A  ID+EV++ I  AY+ T+ L+ EH + +

             ++A+ LLEKEVL+Q DLV+++GERPF   + T Y  F D

Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2434567882489