BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5564

Length=989
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007026989.1|  Cell division protease ftsH isoform 1              460   3e-152   
emb|CDP06599.1|  unnamed protein product                                459   7e-152   Coffea canephora [robusta coffee]
ref|XP_009772661.1|  PREDICTED: ATP-dependent zinc metalloproteas...    455   2e-150   Nicotiana sylvestris
ref|XP_009598017.1|  PREDICTED: ATP-dependent zinc metalloproteas...    454   1e-149   Nicotiana tomentosiformis
gb|AFX67028.1|  putative AAA-metalloprotease FtsH                       436   1e-149   Solanum tuberosum [potatoes]
gb|KJB16964.1|  hypothetical protein B456_002G257200                    453   1e-149   Gossypium raimondii
gb|KDO51173.1|  hypothetical protein CISIN_1g005738mg                   448   2e-149   Citrus sinensis [apfelsine]
gb|KHG12964.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    452   3e-149   Gossypium arboreum [tree cotton]
ref|XP_006480880.1|  PREDICTED: ATP-dependent zinc metalloproteas...    450   2e-148   
ref|XP_006429118.1|  hypothetical protein CICLE_v10011087mg             450   3e-148   Citrus clementina [clementine]
ref|XP_010262544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    449   5e-148   Nelumbo nucifera [Indian lotus]
ref|XP_012074959.1|  PREDICTED: ATP-dependent zinc metalloproteas...    447   3e-147   Jatropha curcas
ref|XP_002323508.2|  hypothetical protein POPTR_0016s10620g             447   3e-147   
ref|XP_008464106.1|  PREDICTED: ATP-dependent zinc metalloproteas...    447   4e-147   Cucumis melo [Oriental melon]
ref|XP_011007151.1|  PREDICTED: ATP-dependent zinc metalloproteas...    443   5e-147   Populus euphratica
ref|XP_010256889.1|  PREDICTED: ATP-dependent zinc metalloproteas...    446   1e-146   Nelumbo nucifera [Indian lotus]
ref|XP_011007150.1|  PREDICTED: ATP-dependent zinc metalloproteas...    444   4e-146   Populus euphratica
gb|KJB55847.1|  hypothetical protein B456_009G097900                    443   5e-146   Gossypium raimondii
ref|XP_002530989.1|  Mitochondrial respiratory chain complexes as...    444   6e-146   
gb|EYU41737.1|  hypothetical protein MIMGU_mgv1a001461mg                443   7e-146   Erythranthe guttata [common monkey flower]
gb|KJB55846.1|  hypothetical protein B456_009G097900                    443   1e-145   Gossypium raimondii
ref|XP_011094875.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   2e-145   Sesamum indicum [beniseed]
ref|XP_011094876.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   2e-145   Sesamum indicum [beniseed]
ref|XP_009345397.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   2e-145   Pyrus x bretschneideri [bai li]
ref|XP_009338598.1|  PREDICTED: ATP-dependent zinc metalloproteas...    442   3e-145   Pyrus x bretschneideri [bai li]
ref|XP_007208082.1|  hypothetical protein PRUPE_ppa001525mg             441   3e-145   
ref|XP_008369915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    441   6e-145   
ref|XP_004143122.1|  PREDICTED: ATP-dependent zinc metalloproteas...    441   9e-145   Cucumis sativus [cucumbers]
gb|KHG20351.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    440   1e-144   Gossypium arboreum [tree cotton]
ref|XP_010106514.1|  ATP-dependent zinc metalloprotease FTSH 10         439   3e-144   Morus notabilis
ref|XP_008240759.1|  PREDICTED: ATP-dependent zinc metalloproteas...    438   9e-144   Prunus mume [ume]
gb|KDO72822.1|  hypothetical protein CISIN_1g047690mg                   437   2e-143   Citrus sinensis [apfelsine]
ref|XP_008777200.1|  PREDICTED: ATP-dependent zinc metalloproteas...    433   2e-143   
gb|KHN21936.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    436   3e-143   Glycine soja [wild soybean]
ref|XP_003537985.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   4e-143   Glycine max [soybeans]
ref|XP_010931245.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   5e-143   
gb|AAU44017.1|  putative AAA-metalloprotease FtsH (fragment)            424   7e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006341014.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   8e-143   Solanum tuberosum [potatoes]
ref|XP_006488359.1|  PREDICTED: ATP-dependent zinc metalloproteas...    435   1e-142   Citrus sinensis [apfelsine]
ref|XP_008448079.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   1e-142   Cucumis melo [Oriental melon]
ref|XP_008448063.1|  PREDICTED: ATP-dependent zinc metalloproteas...    436   1e-142   Cucumis melo [Oriental melon]
ref|XP_010043512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-142   
ref|XP_006349501.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-142   Solanum tuberosum [potatoes]
ref|XP_006349500.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-142   Solanum tuberosum [potatoes]
ref|XP_006424865.1|  hypothetical protein CICLE_v10027837mg             435   1e-142   Citrus clementina [clementine]
ref|XP_006349498.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   2e-142   Solanum tuberosum [potatoes]
ref|XP_006349497.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   2e-142   Solanum tuberosum [potatoes]
ref|XP_006349499.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   2e-142   Solanum tuberosum [potatoes]
ref|XP_011653641.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   3e-142   Cucumis sativus [cucumbers]
ref|XP_004142062.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   3e-142   Cucumis sativus [cucumbers]
ref|XP_004249560.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   4e-142   Solanum lycopersicum
ref|XP_009600786.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   4e-142   Nicotiana tomentosiformis
ref|XP_010312354.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   4e-142   Solanum lycopersicum
ref|XP_002283273.1|  PREDICTED: ATP-dependent zinc metalloproteas...    434   5e-142   Vitis vinifera
ref|XP_008777193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    433   9e-142   Phoenix dactylifera
ref|XP_004246405.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   1e-141   Solanum lycopersicum
ref|XP_007016370.1|  FTSH protease 10                                   432   1e-141   
ref|XP_010931244.1|  PREDICTED: ATP-dependent zinc metalloproteas...    432   3e-141   Elaeis guineensis
ref|XP_004294648.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   3e-141   Fragaria vesca subsp. vesca
gb|ACN36802.1|  unknown                                                 418   3e-141   Zea mays [maize]
ref|XP_010931243.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   3e-141   Elaeis guineensis
ref|XP_004961860.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   4e-141   Setaria italica
gb|KCW85528.1|  hypothetical protein EUGRSUZ_B02325                     431   6e-141   Eucalyptus grandis [rose gum]
ref|XP_009804923.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   6e-141   Nicotiana sylvestris
ref|XP_009384843.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   7e-141   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010043511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   7e-141   Eucalyptus grandis [rose gum]
ref|XP_009375915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    430   8e-141   Pyrus x bretschneideri [bai li]
ref|XP_006592192.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   1e-140   
ref|XP_009384842.1|  PREDICTED: ATP-dependent zinc metalloproteas...    431   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    430   1e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009140963.1|  PREDICTED: ATP-dependent zinc metalloproteas...    428   4e-140   Brassica rapa
ref|XP_008359096.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   5e-140   
ref|XP_008384940.1|  PREDICTED: ATP-dependent zinc metalloproteas...    428   5e-140   
ref|XP_006293791.1|  hypothetical protein CARUB_v10022773mg             424   6e-140   
ref|XP_009364366.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   1e-139   Pyrus x bretschneideri [bai li]
ref|XP_006592191.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   1e-139   Glycine max [soybeans]
gb|KHN32138.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    426   1e-139   Glycine soja [wild soybean]
ref|XP_010685724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   2e-139   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY31753.1|  BnaA04g16890D                                          426   2e-139   Brassica napus [oilseed rape]
dbj|BAE98430.1|  AAA-type like ATPase                                   410   2e-139   Arabidopsis thaliana [mouse-ear cress]
emb|CDX77230.1|  BnaC04g40250D                                          426   2e-139   
ref|XP_007207144.1|  hypothetical protein PRUPE_ppa001491mg             427   2e-139   Prunus persica
ref|XP_006417796.1|  hypothetical protein EUTSA_v10006814mg             427   2e-139   Eutrema salsugineum [saltwater cress]
gb|KFK43073.1|  hypothetical protein AALP_AA1G075200                    426   3e-139   Arabis alpina [alpine rockcress]
ref|XP_008222305.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   3e-139   Prunus mume [ume]
ref|XP_003539663.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   3e-139   Glycine max [soybeans]
ref|XP_008356937.1|  PREDICTED: ATP-dependent zinc metalloproteas...    426   3e-139   Malus domestica [apple tree]
ref|XP_011089809.1|  PREDICTED: ATP-dependent zinc metalloproteas...    427   3e-139   Sesamum indicum [beniseed]
gb|KFK32242.1|  hypothetical protein AALP_AA6G216200                    426   4e-139   Arabis alpina [alpine rockcress]
ref|XP_004302718.2|  PREDICTED: ATP-dependent zinc metalloproteas...    426   4e-139   Fragaria vesca subsp. vesca
ref|XP_010937593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    426   4e-139   
ref|XP_010043509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   8e-139   Eucalyptus grandis [rose gum]
ref|XP_003539662.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   1e-138   Glycine max [soybeans]
ref|XP_002439915.1|  hypothetical protein SORBIDRAFT_09g022490          425   1e-138   Sorghum bicolor [broomcorn]
ref|XP_010475511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    425   1e-138   Camelina sativa [gold-of-pleasure]
gb|KHN32140.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    424   1e-138   Glycine soja [wild soybean]
ref|NP_001055745.1|  Os05g0458400                                       424   2e-138   
ref|XP_010475512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   2e-138   Camelina sativa [gold-of-pleasure]
gb|EEE63976.1|  hypothetical protein OsJ_18802                          424   2e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387530.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010521866.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   2e-138   Tarenaya hassleriana [spider flower]
gb|EEC79350.1|  hypothetical protein OsI_20217                          424   2e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_010487541.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   3e-138   Camelina sativa [gold-of-pleasure]
ref|XP_003568313.1|  PREDICTED: ATP-dependent zinc metalloproteas...    424   3e-138   Brachypodium distachyon [annual false brome]
ref|XP_010920548.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   5e-138   Elaeis guineensis
ref|XP_009781386.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   6e-138   Nicotiana sylvestris
ref|XP_010469994.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   6e-138   Camelina sativa [gold-of-pleasure]
ref|XP_010487557.1|  PREDICTED: ATP-dependent zinc metalloproteas...    423   7e-138   
ref|XP_002881027.1|  hypothetical protein ARALYDRAFT_344684             422   8e-138   
ref|XP_010414442.1|  PREDICTED: ATP-dependent zinc metalloproteas...    422   2e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010521865.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   Tarenaya hassleriana [spider flower]
gb|AFW82207.1|  hypothetical protein ZEAMMB73_958383                    421   3e-137   
ref|XP_012066998.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   Jatropha curcas
ref|XP_010510537.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   Camelina sativa [gold-of-pleasure]
ref|XP_012066999.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   3e-137   
emb|CDY39531.1|  BnaC04g15300D                                          421   4e-137   Brassica napus [oilseed rape]
ref|NP_850129.1|  FTSH protease 3                                       421   4e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611240.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   4e-137   Nicotiana tomentosiformis
gb|AAC33234.1|  putative AAA-type ATPase                                420   5e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125053.1|  PREDICTED: ATP-dependent zinc metalloproteas...    421   5e-137   Brassica rapa
ref|XP_006655377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    420   6e-137   
ref|XP_002313426.1|  FtsH protease family protein                       419   6e-137   
ref|XP_006306790.1|  hypothetical protein CARUB_v10008328mg             420   8e-137   Capsella rubella
gb|AAL36270.1|  putative AAA-type ATPase                                420   9e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47876.1|  BnaA07g14210D                                          420   9e-137   Brassica napus [oilseed rape]
emb|CDP09082.1|  unnamed protein product                                419   1e-136   Coffea canephora [robusta coffee]
ref|XP_010542637.1|  PREDICTED: ATP-dependent zinc metalloproteas...    419   2e-136   Tarenaya hassleriana [spider flower]
ref|XP_006409951.1|  hypothetical protein EUTSA_v10016261mg             419   2e-136   Eutrema salsugineum [saltwater cress]
ref|XP_009118433.1|  PREDICTED: ATP-dependent zinc metalloproteas...    418   3e-136   Brassica rapa
ref|XP_007133225.1|  hypothetical protein PHAVU_011G162000g             418   4e-136   Phaseolus vulgaris [French bean]
ref|NP_172231.2|  FTSH protease 10                                      418   4e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032280.1|  PREDICTED: ATP-dependent zinc metalloproteas...    417   2e-135   Populus euphratica
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH                      416   2e-135   Pisum sativum [garden pea]
ref|XP_002889652.1|  FTSH10                                             416   3e-135   Arabidopsis lyrata subsp. lyrata
ref|XP_008784613.1|  PREDICTED: ATP-dependent zinc metalloproteas...    414   1e-134   Phoenix dactylifera
ref|NP_001044774.1|  Os01g0842600                                       414   2e-134   
gb|EAY76461.1|  hypothetical protein OsI_04395                          414   2e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_006845226.1|  PREDICTED: ATP-dependent zinc metalloproteas...    413   6e-134   Amborella trichopoda
dbj|BAJ98147.1|  predicted protein                                      412   1e-133   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006644995.1|  PREDICTED: ATP-dependent zinc metalloproteas...    411   1e-133   Oryza brachyantha
gb|KJB16965.1|  hypothetical protein B456_002G257200                    410   2e-133   Gossypium raimondii
ref|XP_004970544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    410   6e-133   Setaria italica
gb|EMT04659.1|  Cell division protease ftsH-like protein, mitocho...    406   7e-133   
gb|EMS50561.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    407   1e-132   Triticum urartu
ref|XP_008799731.1|  PREDICTED: ATP-dependent zinc metalloproteas...    408   3e-132   Phoenix dactylifera
ref|XP_007132051.1|  hypothetical protein PHAVU_011G062800g             406   2e-131   Phaseolus vulgaris [French bean]
ref|XP_003606687.1|  Cell division protease ftsH-like protein           405   3e-131   Medicago truncatula
gb|EYU38460.1|  hypothetical protein MIMGU_mgv1a001496mg                405   4e-131   Erythranthe guttata [common monkey flower]
gb|AAF79577.1|AC022464_35  F22G5.10                                     406   4e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002458748.1|  hypothetical protein SORBIDRAFT_03g039540          404   8e-131   Sorghum bicolor [broomcorn]
gb|KCW85527.1|  hypothetical protein EUGRSUZ_B02324                     402   7e-130   Eucalyptus grandis [rose gum]
ref|XP_010043510.1|  PREDICTED: ATP-dependent zinc metalloproteas...    401   1e-129   Eucalyptus grandis [rose gum]
gb|EPS71434.1|  hypothetical protein M569_03325                         399   3e-129   Genlisea aurea
ref|NP_001145329.1|  uncharacterized protein LOC100278654               388   2e-128   
ref|XP_008358519.1|  PREDICTED: ATP-dependent zinc metalloproteas...    395   2e-127   
gb|KJB36698.1|  hypothetical protein B456_006G171800                    389   5e-127   Gossypium raimondii
ref|XP_004507174.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   7e-127   Cicer arietinum [garbanzo]
emb|CDM84966.1|  unnamed protein product                                392   1e-126   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001785268.1|  predicted protein                                  389   2e-126   
gb|EMS48627.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    391   1e-125   Triticum urartu
gb|EMT07840.1|  Cell division protease ftsH-like protein, mitocho...    393   6e-125   
emb|CDY09913.1|  BnaC08g45380D                                          384   2e-123   Brassica napus [oilseed rape]
ref|XP_003567261.1|  PREDICTED: ATP-dependent zinc metalloproteas...    372   2e-120   
ref|XP_011623752.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    367   4e-120   
gb|KEH23850.1|  ATP-dependent zinc metalloprotease FTSH protein         373   6e-120   Medicago truncatula
ref|XP_001782950.1|  predicted protein                                  377   1e-119   
ref|XP_001759881.1|  predicted protein                                  367   4e-118   
gb|AES75793.2|  ATP-dependent zinc metalloprotease FTSH protein         363   3e-116   Medicago truncatula
ref|XP_003624038.1|  Cell division protease ftsH-like protein           358   7e-115   
ref|XP_003619575.1|  Cell division protease ftsH-like protein           361   1e-114   
gb|ERN06910.1|  hypothetical protein AMTR_s00005p00257870               338   2e-110   Amborella trichopoda
ref|XP_002981661.1|  hypothetical protein SELMODRAFT_115113             348   4e-110   
ref|XP_002967857.1|  hypothetical protein SELMODRAFT_169256             349   2e-109   
ref|XP_002980658.1|  hypothetical protein SELMODRAFT_233533             318   1e-101   
ref|XP_002984562.1|  hypothetical protein SELMODRAFT_234574             318   1e-101   
ref|XP_005651157.1|  ATP-dependent metallopeptidase Hfl                 324   6e-101   Coccomyxa subellipsoidea C-169
ref|XP_002505472.1|  predicted protein                                  318   7e-99    Micromonas commoda
ref|XP_001422694.1|  predicted protein                                  306   9e-97    Ostreococcus lucimarinus CCE9901
ref|XP_003082962.1|  FtsH protease, putative (ISS)                      308   4e-94    Ostreococcus tauri
gb|ERN06906.1|  hypothetical protein AMTR_s00005p00257390               300   6e-94    Amborella trichopoda
ref|XP_007509883.1|  predicted protein                                  309   1e-93    Bathycoccus prasinos
ref|XP_003631103.1|  Cell division protease ftsH-like protein           296   2e-93    
ref|XP_011400128.1|  ATP-dependent zinc metalloprotease FTSH 10, ...    313   2e-93    Auxenochlorella protothecoides
ref|XP_003059742.1|  predicted protein                                  301   1e-92    Micromonas pusilla CCMP1545
gb|KEH16019.1|  ATP-dependent zinc metalloprotease FTSH protein         288   1e-88    Medicago truncatula
ref|XP_001689949.1|  membrane AAA-metalloprotease                       291   6e-88    Chlamydomonas reinhardtii
gb|KHG19679.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    271   6e-84    Gossypium arboreum [tree cotton]
ref|WP_041883641.1|  peptidase M41                                      278   2e-83    Pedobacter lusitanus
ref|XP_005850885.1|  hypothetical protein CHLNCDRAFT_140544             277   7e-83    Chlorella variabilis
ref|XP_003292084.1|  hypothetical protein DICPUDRAFT_39991              271   1e-82    Dictyostelium purpureum
ref|WP_037443193.1|  peptidase M41                                      276   1e-82    Pedobacter antarcticus
ref|WP_026897433.1|  peptidase M41                                      275   1e-82    Pedobacter oryzae
dbj|GAM28243.1|  hypothetical protein SAMD00019534_114190               278   2e-82    Acytostelium subglobosum LB1
ref|XP_638674.1|  peptidase M41, FtsH domain-containing protein         276   2e-82    Dictyostelium discoideum AX4
ref|WP_013664355.1|  peptidase M41                                      274   5e-82    Sphingobacterium sp. 21
ref|WP_008241678.1|  peptidase M41                                      273   9e-82    Pedobacter sp. BAL39
ref|WP_037533932.1|  peptidase M41                                      273   9e-82    Sphingobacterium thalpophilum
ref|WP_012780210.1|  peptidase M41                                      273   1e-81    Pedobacter heparinus
ref|WP_039053642.1|  peptidase M41                                      271   2e-81    
gb|EQB80316.1|  hypothetical protein L950_08340                         270   3e-81    
ref|WP_014682322.1|  peptidase M41                                      272   3e-81    Solitalea canadensis
dbj|BAF01982.1|  hypothetical protein                                   256   5e-81    Arabidopsis thaliana [mouse-ear cress]
gb|EFA84387.1|  peptidase M41                                           273   5e-81    Heterostelium album PN500
ref|WP_021069372.1|  peptidase M41                                      271   7e-81    Sphingobacterium paucimobilis
ref|WP_010600005.1|  peptidase M41                                      271   8e-81    Pedobacter
gb|AFM03376.1|  membrane protease FtsH catalytic subunit                270   8e-81    Bernardetia litoralis DSM 6794
ref|WP_040539886.1|  peptidase M41                                      271   1e-80    Pedobacter arcticus
gb|ETZ19316.1|  peptidase M41                                           270   1e-80    Pedobacter sp. V48
ref|XP_002741203.1|  PREDICTED: AFG3-like protein 2                     267   1e-80    Saccoglossus kowalevskii
ref|WP_037497088.1|  peptidase M41                                      270   1e-80    Sphingobacterium deserti
ref|WP_037460377.1|  peptidase M41                                      269   2e-80    
ref|WP_009033571.1|  peptidase M41                                      270   2e-80    Indibacter alkaliphilus
ref|WP_039990218.1|  peptidase M41                                      269   2e-80    
ref|WP_028295325.1|  peptidase M41                                      269   3e-80    Olivibacter sitiensis
ref|WP_041264331.1|  peptidase M41                                      268   3e-80    
gb|EFK59817.1|  ATP-dependent metallopeptidase HflB                     269   3e-80    Sphingobacterium spiritivorum ATCC 33861
gb|EEI91234.1|  ATP-dependent metallopeptidase HflB                     269   3e-80    Sphingobacterium spiritivorum ATCC 33300
ref|XP_004362632.1|  peptidase M41                                      275   5e-80    Cavenderia fasciculata
ref|WP_009053651.1|  peptidase M41                                      268   9e-80    Nitritalea halalkaliphila
ref|WP_036676326.1|  peptidase M41                                      268   1e-79    Pedobacter sp. R20-19
ref|WP_038701774.1|  peptidase M41                                      268   1e-79    Sphingobacterium sp. ML3W
ref|WP_033563684.1|  peptidase M41                                      268   1e-79    Sphingobacteriaceae bacterium DW12
ref|WP_026968576.1|  peptidase M41                                      268   1e-79    Algoriphagus terrigena
ref|WP_026902710.1|  peptidase M41                                      268   1e-79    Pedobacter glucosidilyticus
ref|WP_045755148.1|  peptidase M41                                      268   1e-79    Sphingobacterium sp. PM2-P1-29
gb|EIE80123.1|  hypothetical protein RO3G_04828                         266   1e-79    Rhizopus delemar RA 99-880
ref|WP_044224255.1|  peptidase M41                                      267   2e-79    Flammeovirga pacifica
ref|XP_002410299.1|  ATPase, putative                                   258   2e-79    
ref|WP_039450881.1|  peptidase M41                                      266   4e-79    Pedobacter glucosidilyticus
ref|XP_003979383.1|  PREDICTED: AFG3-like protein 2                     256   5e-79    
ref|WP_026951332.1|  peptidase M41                                      266   5e-79    Algoriphagus mannitolivorans
gb|ESA05195.1|  hypothetical protein GLOINDRAFT_66340                   265   6e-79    
ref|XP_001744500.1|  hypothetical protein                               264   7e-79    Monosiga brevicollis MX1
ref|WP_009186129.1|  peptidase M41                                      264   2e-78    Cecembia lonarensis
ref|WP_039137089.1|  ATPase AAA                                         263   3e-78    
gb|EMS32972.1|  Cell division protein FtsH                              264   3e-78    Mariniradius saccharolyticus AK6
dbj|GAO41819.1|  ATP-dependent zinc metalloprotease FtsH                263   3e-78    Flavihumibacter petaseus NBRC 106054
ref|WP_019597947.1|  peptidase M41                                      264   3e-78    Rhodonellum
ref|WP_020892866.1|  Cell division protein FtsH                         263   3e-78    Cyclobacterium qasimii
ref|WP_040480273.1|  peptidase M41                                      263   4e-78    
ref|WP_009578256.1|  Cell division protein FtsH                         263   4e-78    Fulvivirga imtechensis
ref|WP_039133743.1|  ATPase AAA                                         263   4e-78    
ref|WP_017733337.1|  hypothetical protein                               263   4e-78    Nafulsella turpanensis
ref|WP_035465307.1|  ATPase AAA                                         263   4e-78    
ref|WP_014021491.1|  peptidase M41                                      263   4e-78    Cyclobacterium marinum
gb|EXX70583.1|  m-AAA protease subunit YTA12                            266   5e-78    Rhizophagus irregularis DAOM 197198w
ref|WP_014221908.1|  peptidase M41                                      263   6e-78    Niastella koreensis
ref|WP_026999681.1|  peptidase M41                                      262   1e-77    Eisenibacter elegans
emb|CEJ01398.1|  Putative Cell division protease ftsH                   263   1e-77    Rhizopus microsporus
ref|WP_044213238.1|  peptidase M41                                      262   1e-77    Flammeovirga sp. OC4
gb|EGI59447.1|  AFG3-like protein 2                                     261   1e-77    Acromyrmex echinatior
ref|XP_005816528.1|  PREDICTED: AFG3-like protein 1-like                261   2e-77    
ref|WP_026945354.1|  peptidase M41                                      261   3e-77    Algoriphagus marincola
ref|XP_003590119.1|  Cell division protease ftsH-like protein           256   4e-77    
ref|WP_024284970.1|  peptidase M41                                      261   4e-77    Algoriphagus marincola
ref|WP_013453965.1|  peptidase M41                                      261   4e-77    Marivirga tractuosa
ref|WP_028787176.1|  ATPase AAA                                         261   5e-77    Terrimonas ferruginea
dbj|GAN02747.1|  ATP-dependent metallopeptidase Hfl                     261   5e-77    Mucor ambiguus
ref|WP_016195314.1|  Cell division protein FtsH                         261   6e-77    Arcticibacter svalbardensis
emb|CEG68111.1|  Putative Cell division protease ftsH                   261   6e-77    Rhizopus microsporus
emb|CEG68110.1|  Putative YALI0A10615p                                  261   7e-77    Rhizopus microsporus
gb|AHM60443.1|  membrane protease ftsh catalytic subunit                260   8e-77    Flammeovirgaceae bacterium 311
emb|CEI94349.1|  Putative AFG3 family protein                           263   8e-77    Rhizopus microsporus
ref|WP_009195895.1|  ATP-dependent zinc metalloprotease FtsH            260   9e-77    Cesiribacter andamanensis
ref|XP_011064067.1|  PREDICTED: AFG3-like protein 2 isoform X2          261   1e-76    Acromyrmex echinatior
ref|WP_026954726.1|  peptidase M41                                      259   1e-76    Algoriphagus vanfongensis
ref|WP_037327565.1|  ATPase AAA                                         259   1e-76    Asinibacterium sp. OR43
ref|XP_011064066.1|  PREDICTED: AFG3-like protein 2 isoform X1          262   1e-76    Acromyrmex echinatior
ref|WP_035757649.1|  peptidase M41                                      259   2e-76    Hugenholtzia roseola
ref|XP_012054526.1|  PREDICTED: AFG3-like protein 2                     261   3e-76    Atta cephalotes
ref|WP_022829689.1|  peptidase M41                                      259   3e-76    Cytophagales bacterium B6
ref|XP_007568550.1|  PREDICTED: AFG3-like protein 1                     260   3e-76    Poecilia formosa
ref|WP_015266230.1|  ATP-dependent metalloprotease FtsH                 258   3e-76    Echinicola vietnamensis
ref|WP_012927540.1|  peptidase M41                                      258   3e-76    
ref|XP_011407709.1|  PREDICTED: AFG3-like protein 2                     255   3e-76    Amphimedon queenslandica
emb|CDS03562.1|  hypothetical protein LRAMOSA00964                      259   4e-76    Lichtheimia ramosa
ref|XP_008408894.1|  PREDICTED: AFG3-like protein 1 isoform X1          259   4e-76    Poecilia reticulata
ref|WP_002694247.1|  peptidase M41                                      258   5e-76    Microscilla marina
emb|CEI95939.1|  Putative Mitochondrial inner membrane AAA protea...    258   5e-76    Rhizopus microsporus
ref|XP_011642238.1|  PREDICTED: AFG3-like protein 2                     260   5e-76    
gb|KFO11702.1|  AFG3-like 2                                             251   5e-76    
ref|XP_002681483.1|  aaa ATPase family protein                          262   5e-76    
ref|XP_005706412.1|  AAA-type ATPase                                    261   6e-76    
ref|XP_004566226.1|  PREDICTED: AFG3-like protein 1-like                259   6e-76    
ref|WP_037360570.1|  ATPase AAA                                         258   6e-76    
ref|XP_010302509.1|  PREDICTED: AFG3-like protein 2                     251   6e-76    
ref|WP_035076980.1|  peptidase M41                                      258   6e-76    
ref|XP_005946781.1|  PREDICTED: AFG3-like protein 1-like                259   6e-76    
gb|EFN79635.1|  AFG3-like protein 2                                     251   6e-76    
ref|XP_006805466.1|  PREDICTED: AFG3-like protein 1-like                258   6e-76    
ref|WP_013928835.1|  peptidase M41                                      257   7e-76    
ref|XP_005748823.1|  PREDICTED: AFG3-like protein 1-like                259   8e-76    
emb|CEI89004.1|  Putative Matrix AAA protease MAP-1                     257   8e-76    
emb|CEG69908.1|  Putative Mitochondrial inner membrane AAA protea...    258   1e-75    
gb|EPB90189.1|  AFG3 family protein                                     258   1e-75    
ref|XP_010637318.1|  PREDICTED: AFG3-like protein 2 isoform X2          254   1e-75    
ref|XP_004989050.1|  AFG3-like protein 2                                259   2e-75    
ref|WP_037369803.1|  ATPase AAA                                         256   2e-75    
ref|WP_018473204.1|  peptidase M41                                      256   2e-75    
ref|XP_001632616.1|  predicted protein                                  255   2e-75    
ref|WP_037352617.1|  ATPase AAA                                         256   2e-75    
ref|XP_003439591.1|  PREDICTED: AFG3-like protein 1-like                258   2e-75    
ref|XP_010747102.1|  PREDICTED: AFG3-like protein 1 isoform X1          258   2e-75    
ref|XP_011695717.1|  PREDICTED: AFG3-like protein 2                     255   2e-75    
ref|WP_045460063.1|  peptidase M41                                      257   2e-75    
ref|WP_039751710.1|  peptidase M41                                      256   2e-75    
gb|EGW00718.1|  AFG3-like protein 2                                     252   2e-75    
ref|XP_783782.2|  PREDICTED: AFG3-like protein 2 isoform X1             258   2e-75    
ref|WP_008507768.1|  peptidase M41                                      256   2e-75    
ref|XP_010747103.1|  PREDICTED: AFG3-like protein 1 isoform X2          258   2e-75    
ref|XP_006807100.1|  PREDICTED: AFG3-like protein 2-like                254   2e-75    
ref|XP_010290553.1|  PREDICTED: AFG3-like protein 2                     250   3e-75    
gb|KFQ80092.1|  AFG3-like 2                                             250   3e-75    
ref|WP_013408509.1|  peptidase M41                                      255   3e-75    
ref|WP_015027481.1|  peptidase M41                                      255   3e-75    
ref|XP_006675531.1|  hypothetical protein BATDEDRAFT_22321              257   4e-75    
ref|WP_037326393.1|  peptidase M41                                      254   4e-75    
ref|XP_004853318.1|  PREDICTED: AFG3-like protein 2 isoform X2          253   5e-75    
ref|XP_003737319.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    254   5e-75    
ref|WP_033411345.1|  ATPase AAA                                         254   6e-75    
ref|WP_020601428.1|  peptidase M41                                      254   1e-74    
emb|CDS12867.1|  hypothetical protein LRAMOSA05051                      256   1e-74    
gb|KFH71888.1|  AFG3 family protein                                     256   1e-74    
ref|XP_005946480.1|  PREDICTED: AFG3-like protein 2-like isoform X3     256   1e-74    
ref|XP_010223803.1|  PREDICTED: AFG3-like protein 2                     256   1e-74    
gb|KFQ87123.1|  AFG3-like 2                                             251   2e-74    
ref|WP_028981524.1|  peptidase M41                                      254   2e-74    
gb|ERL87558.1|  hypothetical protein D910_04949                         249   2e-74    
gb|KFP46134.1|  AFG3-like 2                                             251   2e-74    
ref|XP_010081449.1|  PREDICTED: AFG3-like protein 2                     251   2e-74    
gb|EIE90722.1|  hypothetical protein RO3G_15433                         256   2e-74    
gb|KGL73505.1|  AFG3-like 2                                             255   2e-74    
ref|WP_018619339.1|  peptidase M41                                      253   2e-74    
ref|XP_008049841.1|  PREDICTED: AFG3-like protein 2                     252   2e-74    
ref|WP_044003108.1|  peptidase M41                                      254   2e-74    
ref|WP_026994259.1|  peptidase M41                                      254   2e-74    
ref|XP_005282733.1|  PREDICTED: AFG3-like protein 2 isoform X1          256   2e-74    
ref|WP_014770837.1|  peptidase M41                                      253   3e-74    
ref|XP_005946478.1|  PREDICTED: AFG3-like protein 2-like isoform X1     256   3e-74    
ref|XP_008162617.1|  PREDICTED: AFG3-like protein 2 isoform X2          255   3e-74    
ref|XP_004656566.1|  PREDICTED: AFG3-like protein 2                     255   3e-74    
ref|XP_005946479.1|  PREDICTED: AFG3-like protein 2-like isoform X2     256   3e-74    
ref|XP_006641297.1|  PREDICTED: AFG3-like protein 1-like                255   3e-74    
ref|XP_011484595.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    255   3e-74    
ref|XP_011160232.1|  PREDICTED: AFG3-like protein 2 isoform X2          255   3e-74    
gb|EFX85159.1|  hypothetical protein DAPPUDRAFT_194014                  253   3e-74    
ref|XP_011254538.1|  PREDICTED: AFG3-like protein 2 isoform X2          255   3e-74    
ref|WP_044282937.1|  peptidase M41                                      252   4e-74    
ref|WP_035557847.1|  peptidase M41                                      253   4e-74    
ref|NP_001072759.1|  AFG3-like AAA ATPase 2                             255   4e-74    
ref|XP_011160223.1|  PREDICTED: AFG3-like protein 2 isoform X1          255   4e-74    
ref|XP_003458166.1|  PREDICTED: AFG3-like protein 2 isoform X1          254   5e-74    
ref|XP_004572477.1|  PREDICTED: AFG3-like protein 2-like                254   5e-74    
ref|XP_005476934.1|  PREDICTED: AFG3-like protein 2 isoform X5          254   5e-74    
ref|XP_005752595.1|  PREDICTED: AFG3-like protein 2-like                254   6e-74    
ref|XP_011254537.1|  PREDICTED: AFG3-like protein 2 isoform X1          255   6e-74    
ref|XP_005476933.1|  PREDICTED: AFG3-like protein 2 isoform X4          255   6e-74    
ref|XP_006612551.1|  PREDICTED: AFG3-like protein 2-like                254   7e-74    
ref|WP_012788140.1|  peptidase M41                                      252   7e-74    
ref|XP_003383809.1|  PREDICTED: AFG3-like protein 2                     253   7e-74    
ref|XP_010637317.1|  PREDICTED: AFG3-like protein 2 isoform X1          253   7e-74    
gb|ACE05676.1|  hypothetical protein Aasi_0232                          252   8e-74    
ref|XP_011862983.1|  PREDICTED: AFG3-like protein 2                     254   8e-74    
ref|XP_005476931.1|  PREDICTED: AFG3-like protein 2 isoform X2          254   8e-74    
ref|XP_005476932.1|  PREDICTED: AFG3-like protein 2 isoform X3          254   8e-74    
ref|XP_008286028.1|  PREDICTED: AFG3-like protein 1                     254   9e-74    
ref|XP_003693602.1|  PREDICTED: AFG3-like protein 2-like                254   1e-73    
ref|WP_025762249.1|  peptidase M41                                      252   1e-73    
ref|NP_001104667.1|  AFG3-like protein 2                                254   1e-73    
gb|EPZ30859.1|  ATPase, AAA-type domain-containing protein              250   1e-73    
ref|XP_624548.2|  PREDICTED: AFG3-like protein 2-like                   254   1e-73    
ref|WP_020528790.1|  hypothetical protein                               252   1e-73    
gb|KHJ47643.1|  ATP-dependent metallopeptidase HflB                     253   1e-73    
ref|XP_005074768.1|  PREDICTED: AFG3-like protein 2                     251   1e-73    
ref|XP_011245300.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   1e-73    
ref|WP_020595437.1|  peptidase M41                                      251   1e-73    
ref|XP_001956786.1|  GF24400                                            254   1e-73    
ref|WP_008202404.1|  peptidase M41                                      251   1e-73    
ref|XP_006117557.1|  PREDICTED: AFG3-like protein 2 isoform X2          254   1e-73    
ref|XP_006117556.1|  PREDICTED: AFG3-like protein 2 isoform X1          254   1e-73    
dbj|GAN09644.1|  ATP-dependent metallopeptidase Hfl                     253   1e-73    
ref|XP_008299957.1|  PREDICTED: AFG3-like protein 2                     253   1e-73    
ref|XP_009960252.1|  PREDICTED: AFG3-like protein 2                     253   1e-73    
ref|WP_034257071.1|  peptidase M41                                      251   2e-73    
ref|XP_004069425.1|  PREDICTED: AFG3-like protein 1                     253   2e-73    
gb|EFB23538.1|  hypothetical protein PANDA_019250                       253   2e-73    
ref|XP_002030868.1|  GM24348                                            253   2e-73    
ref|XP_003924961.2|  PREDICTED: AFG3-like protein 2 isoform X2          251   2e-73    
gb|EDM14729.1|  AFG3(ATPase family gene 3)-like 2 (yeast)               252   2e-73    
gb|KFO26923.1|  AFG3-like protein 2                                     253   2e-73    
ref|WP_010856866.1|  Cell division protein FtsH                         251   2e-73    
ref|XP_007062432.1|  PREDICTED: AFG3-like protein 2                     253   2e-73    
gb|EDL09647.1|  mCG127904                                               252   2e-73    
ref|XP_007643641.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   2e-73    
ref|NP_730250.1|  CG6512, isoform B                                     251   2e-73    
ref|XP_007109863.1|  PREDICTED: AFG3-like protein 2                     251   2e-73    
ref|XP_011235404.1|  PREDICTED: AFG3-like protein 2                     253   2e-73    
emb|CDS28120.1|  afg3 protein 2                                         252   2e-73    
emb|CDS05549.1|  hypothetical protein LRAMOSA08077                      251   3e-73    
ref|XP_005866972.1|  PREDICTED: AFG3-like protein 2 isoform X3          252   3e-73    
emb|CCH00875.1|  ATP-dependent metalloprotease FtsH                     251   3e-73    
ref|XP_005703090.1|  AAA-type ATPase                                    254   3e-73    
gb|EHJ64116.1|  hypothetical protein KGM_08960                          246   3e-73    
ref|XP_008309809.1|  PREDICTED: AFG3-like protein 1                     252   3e-73    
ref|XP_008977688.1|  PREDICTED: AFG3-like protein 2 isoform X2          252   3e-73    
ref|XP_006763325.1|  PREDICTED: AFG3-like protein 2 isoform X2          252   3e-73    
ref|XP_010374004.1|  PREDICTED: AFG3-like protein 2                     251   3e-73    
ref|XP_005073264.1|  PREDICTED: AFG3-like protein 1-like                245   3e-73    
ref|WP_045690242.1|  peptidase M41                                      251   3e-73    
ref|XP_011502504.1|  PREDICTED: AFG3-like protein 2                     252   4e-73    
ref|WP_028522492.1|  peptidase M41                                      250   4e-73    
gb|ELK30619.1|  AFG3-like protein 2                                     253   4e-73    
ref|XP_005866971.1|  PREDICTED: AFG3-like protein 2 isoform X2          252   4e-73    
ref|XP_005999264.1|  PREDICTED: AFG3-like protein 1-like                251   4e-73    
ref|XP_010333888.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   4e-73    
gb|KFO81406.1|  AFG3-like 2                                             252   4e-73    
ref|XP_005866970.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   4e-73    
ref|XP_011605421.1|  PREDICTED: AFG3-like protein 1 isoform X5          250   4e-73    
emb|CAB48398.1|  paraplegin-like protein                                252   4e-73    
ref|XP_004340807.1|  ATP-dependent metallopeptidase HflB subfamil...    251   4e-73    
ref|XP_006763324.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   5e-73    
gb|EPQ08204.1|  AFG3-like protein 2                                     252   5e-73    
gb|EAX01551.1|  AFG3 ATPase family gene 3-like 2 (yeast), isoform...    251   5e-73    
gb|EPB89883.1|  AFG3 family protein                                     251   5e-73    
dbj|BAE29204.1|  unnamed protein product                                252   5e-73    
ref|NP_001128336.1|  AFG3-like protein 2                                252   5e-73    
emb|CDH48427.1|  atp-dependent metallopeptidase hfl                     251   5e-73    
ref|XP_002757077.1|  PREDICTED: AFG3-like protein 2 isoform X1          252   5e-73    
ref|XP_004684027.1|  PREDICTED: AFG3-like protein 2                     251   5e-73    
ref|XP_008580361.1|  PREDICTED: AFG3-like protein 2                     251   6e-73    
ref|XP_007244085.1|  PREDICTED: AFG3-like protein 1-like                251   6e-73    
gb|EHH29159.1|  AFG3-like protein 2                                     251   6e-73    
ref|NP_081406.1|  AFG3-like protein 2                                   252   6e-73    
gb|AAC27764.1|  RcaA                                                    241   6e-73    
ref|XP_007085973.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_011840938.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_009579883.1|  PREDICTED: AFG3-like protein 2                     249   7e-73    
gb|KFV94066.1|  AFG3-like 2                                             249   7e-73    
gb|KDR07700.1|  AFG3-like protein 2                                     252   7e-73    
ref|XP_007633119.1|  PREDICTED: AFG3-like protein 2 isoform X2          251   7e-73    
ref|XP_008700356.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_011286260.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
gb|EFZ22674.1|  hypothetical protein SINV_06415                         251   7e-73    
gb|KFH68520.1|  AFG3 family protein                                     251   7e-73    
ref|XP_009566314.1|  PREDICTED: AFG3-like protein 2                     251   7e-73    
ref|XP_006008879.1|  PREDICTED: AFG3-like protein 2 isoform X2          251   7e-73    
ref|XP_002085240.1|  GD12422                                            252   7e-73    
ref|XP_011792051.1|  PREDICTED: AFG3-like protein 2                     251   8e-73    
ref|XP_006008878.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   8e-73    
gb|EHB14938.1|  AFG3-like protein 2                                     251   8e-73    
ref|XP_004903784.1|  PREDICTED: AFG3-like protein 2                     251   8e-73    
ref|WP_041258971.1|  peptidase M41                                      249   8e-73    
ref|XP_010394721.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
ref|XP_007427904.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
ref|XP_010857368.1|  PREDICTED: AFG3-like protein 2 isoform X3          250   9e-73    
gb|KFQ35154.1|  AFG3-like 2                                             251   9e-73    
ref|XP_008157913.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
gb|KFO93388.1|  AFG3-like 2                                             251   9e-73    
ref|XP_011605418.1|  PREDICTED: AFG3-like protein 1 isoform X3          250   9e-73    
emb|CDH61533.1|  predicted protein                                      250   9e-73    
ref|XP_011300136.1|  PREDICTED: AFG3-like protein 2                     251   9e-73    
ref|XP_010017023.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
gb|KFQ53424.1|  AFG3-like 2                                             251   1e-72    
ref|XP_006868771.1|  PREDICTED: AFG3-like protein 2-like                251   1e-72    
ref|NP_730248.2|  CG6512, isoform A                                     251   1e-72    
gb|KFO56363.1|  AFG3-like 2                                             251   1e-72    
ref|XP_006089365.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    251   1e-72    
ref|XP_009887391.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_011605416.1|  PREDICTED: AFG3-like protein 1 isoform X1          251   1e-72    
ref|XP_006269795.1|  PREDICTED: AFG3-like protein 2 isoform X2          251   1e-72    
gb|ELK15046.1|  AFG3-like protein 2                                     251   1e-72    
ref|XP_004470052.1|  PREDICTED: AFG3-like protein 2-like                251   1e-72    
ref|XP_011944140.1|  PREDICTED: AFG3-like protein 2 isoform X3          251   1e-72    
ref|XP_011379633.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
gb|KGL96547.1|  AFG3-like 2                                             250   1e-72    
ref|XP_010182228.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_011735014.1|  PREDICTED: AFG3-like protein 2                     249   1e-72    
ref|XP_005486772.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_010140308.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_006164216.1|  PREDICTED: AFG3-like protein 2                     250   1e-72    
ref|XP_008191461.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|WP_041932557.1|  peptidase M41                                      248   1e-72    
ref|XP_011146865.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_011605417.1|  PREDICTED: AFG3-like protein 1 isoform X2          250   1e-72    
gb|KFV62490.1|  AFG3-like 2                                             250   1e-72    
gb|AAH24282.1|  Similar to AFG3 ATPase family gene 3-like 2 (yeast)     251   1e-72    
gb|EPB86387.1|  AFG3 family protein                                     250   1e-72    
gb|ELR58811.1|  AFG3-like protein 2                                     250   1e-72    
ref|XP_009061516.1|  hypothetical protein LOTGIDRAFT_127065             248   1e-72    
ref|XP_008552422.1|  PREDICTED: AFG3-like protein 2                     251   1e-72    
ref|XP_003276764.2|  PREDICTED: AFG3-like protein 2                     251   2e-72    
ref|XP_012150883.1|  PREDICTED: AFG3-like protein 2                     251   2e-72    
ref|XP_010857366.1|  PREDICTED: AFG3-like protein 2 isoform X1          250   2e-72    
ref|XP_006269794.1|  PREDICTED: AFG3-like protein 2 isoform X1          251   2e-72    
ref|XP_002828063.1|  PREDICTED: AFG3-like protein 2                     251   2e-72    
gb|AAH71038.1|  LOC432063 protein                                       250   2e-72    
ref|XP_007463350.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    251   2e-72    
dbj|BAE30959.1|  unnamed protein product                                251   2e-72    
ref|XP_512199.2|  PREDICTED: AFG3-like protein 2                        250   2e-72    
ref|NP_006787.2|  AFG3-like protein 2                                   250   2e-72    



>ref|XP_007026989.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY07491.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=817

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 222/252 (88%), Positives = 236/252 (94%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++A EM+KPYS+KT AIID+EVREW+ KAYE TVQLIEEHKEHVA
Sbjct  686  YGFSDKVGLLSFPQRDDALEMTKPYSSKTGAIIDSEVREWVGKAYERTVQLIEEHKEHVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFK SEPTNYDRFK GF E+ + E+KDT E+K+  D
Sbjct  746  QIAELLLEKEVLHQEDLVRVLGERPFKPSEPTNYDRFKRGFQEENK-ESKDTTESKTVGD  804

Query  247  DDSSPLQPEVVP  212
            D S+PL+PEVVP
Sbjct  805  DGSAPLEPEVVP  816



>emb|CDP06599.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   459 bits (1181),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 218/252 (87%), Positives = 236/252 (94%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLER+TVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  571  FEAAIDRVIGGLEKKNKVISKLERQTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  631  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  690

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEMSKPYS+KTAAIIDNEVREW++KAYE T+QLIEEHK+HVA
Sbjct  691  YGFSDKVGLLSFPQRDDTFEMSKPYSSKTAAIIDNEVREWVSKAYERTIQLIEEHKDHVA  750

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLH  DLVRVLGERPFKSSEPTNYDRFK+GF+ED +   KD+ E KS +D
Sbjct  751  QIAELLLEKEVLHHGDLVRVLGERPFKSSEPTNYDRFKEGFIEDDKEVVKDSPEGKSVQD  810

Query  247  DDSSPLQPEVVP  212
            D S PL P+VVP
Sbjct  811  DSSPPLDPDVVP  822



>ref|XP_009772661.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=820

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/253 (87%), Positives = 238/253 (94%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLE+AEPLLKVTIVPRGTAAL
Sbjct  569  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEYAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEMSKPYS+KTAAIID+EVREW++KAYE TVQLIEEHKEHVA
Sbjct  689  YGFSDKVGLLSFPQREDGFEMSKPYSSKTAAIIDSEVREWVSKAYERTVQLIEEHKEHVA  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQEDLVRVLGERPFKS EPTNYDRFK GF E++  E K+  ENK+ +D
Sbjct  749  KIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDRFKQGF-EEENKETKNNPENKTVED  807

Query  247  DDSSPLQPEVVPV  209
              SSP++PEVVPV
Sbjct  808  KGSSPVEPEVVPV  820



>ref|XP_009598017.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=821

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 239/254 (94%), Gaps = 2/254 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEMSKPYS+KTAAIID+EVREW++KAYE TVQLIEEHKEHVA
Sbjct  689  YGFSDKVGLLSFPQREDGFEMSKPYSSKTAAIIDSEVREWVSKAYERTVQLIEEHKEHVA  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQEDLVRVLGERPFKS EPTNYDRFK GF E++  E K+  ENK+ +D
Sbjct  749  KIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDRFKQGF-EEENKETKNNPENKTVED  807

Query  247  D-DSSPLQPEVVPV  209
            +  SSP++PEVVPV
Sbjct  808  NGSSSPVEPEVVPV  821



>gb|AFX67028.1| putative AAA-metalloprotease FtsH, partial [Solanum tuberosum]
Length=318

 Score =   436 bits (1121),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 227/243 (93%), Gaps = 1/243 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  67   FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  126

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  127  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  186

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEMSKPYS+KTAAIID EVREW++KAYE TVQLIE+HKEHVA
Sbjct  187  YGFSDKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYERTVQLIEKHKEHVA  246

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYD FK GF E++  E KD  ENK+ +D
Sbjct  247  QIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDIFKQGF-EEENKERKDNPENKTVED  305

Query  247  DDS  239
            + S
Sbjct  306  NGS  308



>gb|KJB16964.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=817

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEM+KPYS+KT AIID+EVREW+ KAY  TVQLIEEHKEHVA
Sbjct  685  YGFSDKVGLLSFPQRDDAFEMTKPYSSKTGAIIDSEVREWVGKAYNRTVQLIEEHKEHVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GF E+ ++    + E+K+  D
Sbjct  745  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKKGFQEEDKSSKDTSTESKTVDD  804

Query  247  DDSSPLQPEVVP  212
            + S+PL+PEVVP
Sbjct  805  NGSTPLEPEVVP  816



>gb|KDO51173.1| hypothetical protein CISIN_1g005738mg [Citrus sinensis]
Length=680

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 237/253 (94%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  428  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  487

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  488  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  547

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+KT AIIDNEVREW+ KAY+ TV+LIEEH+EHVA
Sbjct  548  YGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVA  607

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE LLEKEVLHQ+DLVRVLGERPFK SEPTNYDRFK GF+ED + E+K+T E  + +D
Sbjct  608  QIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLED-DKESKETKEGGTAED  666

Query  247  DD-SSPLQPEVVP  212
            D+ SSPL+PEVVP
Sbjct  667  DNSSSPLEPEVVP  679



>gb|KHG12964.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=817

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 234/252 (93%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEM+KPYS+KT AIID+EVREW+ KAY+ TVQLIEEHKEHVA
Sbjct  685  YGFSDKVGLLSFPQRDDAFEMTKPYSSKTGAIIDSEVREWVGKAYDRTVQLIEEHKEHVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKS+EPTNYDRFK GF E+ +     + E+K+  D
Sbjct  745  QIAELLLEKEVLHQEDLVRVLGERPFKSTEPTNYDRFKKGFQEEDKASKDTSTESKTVDD  804

Query  247  DDSSPLQPEVVP  212
            + S+PL+PEVVP
Sbjct  805  NGSTPLEPEVVP  816



>ref|XP_006480880.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480881.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 2/254 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+KT AIIDNEVREW+ KAY+ TV+LIEEH+EHVA
Sbjct  686  YGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE LLEKEVLHQ+DLVRVLGERPFK SEPTNYDRFK GF+ED + E+K+T E  + +D
Sbjct  746  QIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLED-DKESKETKEGGTAED  804

Query  247  DD-SSPLQPEVVPV  209
            D+ SSPL+PEVVP 
Sbjct  805  DNSSSPLEPEVVPT  818



>ref|XP_006429118.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
 gb|ESR42358.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
Length=818

 Score =   450 bits (1157),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 2/254 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+KT AIIDNEVREW+ KAY+ TV+LIEEH+EHVA
Sbjct  686  YGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE LLEKEVLHQ+DLVRVLGERPFK SEPTNYDRFK GF+ED + E+K+T E  + +D
Sbjct  746  QIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLED-DKESKETKEGGTAED  804

Query  247  DD-SSPLQPEVVPV  209
            D+ SSPL+PEVVP 
Sbjct  805  DNSSSPLEPEVVPT  818



>ref|XP_010262544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=821

 Score =   449 bits (1155),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 233/253 (92%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  571  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  631  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAV  690

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+K  AIIDNEVREW+AKAYE TVQLIEEHKE VA
Sbjct  691  YGFSDKVGLLSFPQRDDTFEMTKPYSSKMGAIIDNEVREWVAKAYERTVQLIEEHKEQVA  750

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYDRFK GF ED+++  + T E  S + 
Sbjct  751  QIAELLLEKEVLHQEDLVRVLGERPFKSIEPTNYDRFKQGFQEDEKS--RQTTEVGSVEG  808

Query  247  DDSSPLQPEVVPV  209
            D SSPL+P+VVP 
Sbjct  809  DRSSPLEPDVVPT  821



>ref|XP_012074959.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Jatropha curcas]
 gb|KDP35648.1| hypothetical protein JCGZ_09086 [Jatropha curcas]
Length=828

 Score =   447 bits (1151),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 238/252 (94%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  577  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  636

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  637  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  696

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEM+KPYS+KT AIID+EVREW+AKAY+ T+QLIEEHK+HVA
Sbjct  697  YGFSEKVGLLSFPQREDMFEMTKPYSSKTGAIIDSEVREWVAKAYDRTIQLIEEHKDHVA  756

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYD+FK+GF +D++ E+K+T +N +  D
Sbjct  757  EIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDKFKEGF-QDEDKESKETTKNGTVVD  815

Query  247  DDSSPLQPEVVP  212
            D S+PL P+VVP
Sbjct  816  DGSAPLDPQVVP  827



>ref|XP_002323508.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
 gb|EEF05269.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
Length=814

 Score =   447 bits (1150),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 235/252 (93%), Gaps = 4/252 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVIS+LERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FEAAIDRVIGGLEKKNKVISRLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEMSKPYS++T AIID+EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  686  YGFSDKVGLLSFPQRDDAFEMSKPYSSETGAIIDSEVREWVGKAYDSTVKLIEEHKEQVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFK+SEPTNYDRFK GF +D     K+TA+ ++  D
Sbjct  746  QIAELLLEKEVLHQDDLVRVLGERPFKTSEPTNYDRFKQGFEQDD----KETAKGETFDD  801

Query  247  DDSSPLQPEVVP  212
            D SSP++P+VVP
Sbjct  802  DGSSPIEPQVVP  813



>ref|XP_008464106.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis melo]
Length=818

 Score =   447 bits (1149),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/252 (86%), Positives = 235/252 (93%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAV+GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E++FEMSKPYS+KTAAIID+EVREW+ KAYE TV+LIEEHKE VA
Sbjct  687  YGFSDKVGLLSFPPREDSFEMSKPYSSKTAAIIDSEVREWVGKAYERTVKLIEEHKEQVA  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFK SE TNYDRFK GFVE  E ++ +T   ++  D
Sbjct  747  QIAELLLEKEVLHQEDLVRVLGERPFKPSEVTNYDRFKQGFVEADE-KSVETPPVEAADD  805

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+VVP
Sbjct  806  DGSSPLEPQVVP  817



>ref|XP_011007151.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Populus euphratica]
Length=709

 Score =   443 bits (1139),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 234/252 (93%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVIS+LERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  460  FEAAIDRVIGGLEKKNKVISRLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  519

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  520  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  579

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEMSKPYS++T AIID+EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  580  YGFSDKVGLLSFPQRDDAFEMSKPYSSETGAIIDSEVREWVGKAYDSTVKLIEEHKEQVA  639

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFK+SEPTNYDRFK GF +D +  A   A+ ++  D
Sbjct  640  QIAELLLEKEVLHQDDLVRVLGERPFKTSEPTNYDRFKQGFEQDDKEAA---AKGETFDD  696

Query  247  DDSSPLQPEVVP  212
            D SSP++P+VVP
Sbjct  697  DGSSPMEPQVVP  708



>ref|XP_010256889.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=820

 Score =   446 bits (1146),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 233/254 (92%), Gaps = 5/254 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISK ERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKVISKQERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KP+S+KT AIIDNEVREW+AKAYE TV LIEEHKE VA
Sbjct  689  YGFSDKVGLLSFPQRDDTFEMTKPFSSKTGAIIDNEVREWVAKAYERTVNLIEEHKEQVA  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF--VEDKETEAKDTAENKST  254
            QIAE+LLEKEVLHQEDLVR+LGERPFKS+EPTNYDRFK+GF  V++K  EA D     + 
Sbjct  749  QIAEVLLEKEVLHQEDLVRILGERPFKSAEPTNYDRFKEGFREVDEKSREATDVG---TM  805

Query  253  KDDDSSPLQPEVVP  212
             DD SSPL+PEVVP
Sbjct  806  GDDGSSPLEPEVVP  819



>ref|XP_011007150.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=815

 Score =   444 bits (1142),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 234/252 (93%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVIS+LERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FEAAIDRVIGGLEKKNKVISRLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEMSKPYS++T AIID+EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  686  YGFSDKVGLLSFPQRDDAFEMSKPYSSETGAIIDSEVREWVGKAYDSTVKLIEEHKEQVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFK+SEPTNYDRFK GF +D +  A   A+ ++  D
Sbjct  746  QIAELLLEKEVLHQDDLVRVLGERPFKTSEPTNYDRFKQGFEQDDKEAA---AKGETFDD  802

Query  247  DDSSPLQPEVVP  212
            D SSP++P+VVP
Sbjct  803  DGSSPMEPQVVP  814



>gb|KJB55847.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=785

 Score =   443 bits (1139),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLER+TVAYHESGHAV+GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  533  FEAAIDRIIGGLEKKNRVISKLERKTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAAL  592

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  593  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  652

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEMSKPYSNKT AIID EVREW+AKAYE TVQLIEEHKE VA
Sbjct  653  YGFSDKVGLLSFPLREDGFEMSKPYSNKTGAIIDGEVREWVAKAYEKTVQLIEEHKEQVA  712

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKSSE TNYDRFK GF ED+ET++  T E     D
Sbjct  713  QIAELLLEKEVLHQEDLVRVLGERPFKSSELTNYDRFKQGF-EDEETKSMQTPEGGIADD  771

Query  247  DDSS-PLQPEVVP  212
            D S+ PL P+VVP
Sbjct  772  DGSAPPLVPQVVP  784



>ref|XP_002530989.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
 gb|EEF31401.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
Length=833

 Score =   444 bits (1142),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  582  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  641

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  642  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  701

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEMSKPYS+KT AIID+EVREW+ KAY+ T+QL+EEHKEH+A
Sbjct  702  YGFSDKVGLLSFPQRDDTFEMSKPYSSKTGAIIDSEVREWVGKAYQRTLQLVEEHKEHIA  761

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQEDL+RVLGERPFKSSEPTNYDRFK+GF ED + E+K+T +  +  D
Sbjct  762  EIAELLLEKEVLHQEDLIRVLGERPFKSSEPTNYDRFKEGFQED-DKESKETTKGGTLDD  820

Query  247  DDSSPLQPEVVP  212
            D S+ L+P+V P
Sbjct  821  DGSTTLEPQVAP  832



>gb|EYU41737.1| hypothetical protein MIMGU_mgv1a001461mg [Erythranthe guttata]
Length=815

 Score =   443 bits (1140),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 214/257 (83%), Positives = 231/257 (90%), Gaps = 5/257 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  560  FEAAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  619

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  620  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  679

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEMSKPYS+KTAAIID EVREW+ KAY  T+QLIEEHK+H++
Sbjct  680  YGFSEKVGLLSFPQKEDGFEMSKPYSSKTAAIIDTEVREWVGKAYARTIQLIEEHKDHIS  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK-  251
            QIAELLLEKEVLHQ+DLVRVLGERPF SSEPTNYDRFK GF+ED   ++     N +TK 
Sbjct  740  QIAELLLEKEVLHQDDLVRVLGERPFTSSEPTNYDRFKKGFIEDDNGKSGSNG-NTTTKG  798

Query  250  ---DDDSSPLQPEVVPV  209
               DD   PL PEVVPV
Sbjct  799  KKIDDGPLPLAPEVVPV  815



>gb|KJB55846.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=816

 Score =   443 bits (1139),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLER+TVAYHESGHAV+GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FEAAIDRIIGGLEKKNRVISKLERKTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEMSKPYSNKT AIID EVREW+AKAYE TVQLIEEHKE VA
Sbjct  684  YGFSDKVGLLSFPLREDGFEMSKPYSNKTGAIIDGEVREWVAKAYEKTVQLIEEHKEQVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKSSE TNYDRFK GF ED+ET++  T E     D
Sbjct  744  QIAELLLEKEVLHQEDLVRVLGERPFKSSELTNYDRFKQGF-EDEETKSMQTPEGGIADD  802

Query  247  DDSS-PLQPEVVP  212
            D S+ PL P+VVP
Sbjct  803  DGSAPPLVPQVVP  815



>ref|XP_011094875.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=817

 Score =   442 bits (1138),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKV+SK+ERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FEAAIDRVIGGLEKKNKVVSKVERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDM CMTLGGRA+EQV+LGKISTGAQNDLEKVTK+TY QVAV
Sbjct  626  GFAQYVPSENLLMTKEQLFDMICMTLGGRAAEQVLLGKISTGAQNDLEKVTKLTYDQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E  FEMSKPYS+KTAAIIDNEVREW  KAY  TVQLIEEHKEHVA
Sbjct  686  YGFSEKVGLLSFPQREQGFEMSKPYSSKTAAIIDNEVREWTGKAYTRTVQLIEEHKEHVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GFVE+KE E     +  +++D
Sbjct  746  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKQGFVENKE-ETTSIPKGNNSED  804

Query  247  DDSSPLQPEVVPV  209
            D SS L+P VVP 
Sbjct  805  DRSSSLEPHVVPT  817



>ref|XP_011094876.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=815

 Score =   442 bits (1138),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKV+SK+ERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FEAAIDRVIGGLEKKNKVVSKVERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDM CMTLGGRA+EQV+LGKISTGAQNDLEKVTK+TY QVAV
Sbjct  624  GFAQYVPSENLLMTKEQLFDMICMTLGGRAAEQVLLGKISTGAQNDLEKVTKLTYDQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E  FEMSKPYS+KTAAIIDNEVREW  KAY  TVQLIEEHKEHVA
Sbjct  684  YGFSEKVGLLSFPQREQGFEMSKPYSSKTAAIIDNEVREWTGKAYTRTVQLIEEHKEHVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GFVE+KE E     +  +++D
Sbjct  744  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKQGFVENKE-ETTSIPKGNNSED  802

Query  247  DDSSPLQPEVVPV  209
            D SS L+P VVP 
Sbjct  803  DRSSSLEPHVVPT  815



>ref|XP_009345397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   442 bits (1137),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 233/251 (93%), Gaps = 5/251 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEM+KPYS+KT AIID+EVREW+ KAY  TVQLIEEHKEHV 
Sbjct  687  YGFSDKVGLLSFPQREDSFEMTKPYSSKTGAIIDSEVREWVGKAYFRTVQLIEEHKEHVG  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPFKS+EPTNYDRFK+GF E+ + EAK+T    + KD
Sbjct  747  QIAELLLEKEVLHQEDLIRVLGERPFKSNEPTNYDRFKEGFQEE-DKEAKET----NAKD  801

Query  247  DDSSPLQPEVV  215
              S P+QP+VV
Sbjct  802  GRSPPIQPDVV  812



>ref|XP_009338598.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009338599.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   442 bits (1137),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 233/251 (93%), Gaps = 5/251 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEM+KPYS+KT AIID+EVREW+ KAY  TVQLIEEHKEHV 
Sbjct  687  YGFSDKVGLLSFPQREDSFEMTKPYSSKTGAIIDSEVREWVGKAYFRTVQLIEEHKEHVG  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPFKS+EPTNYDRFK+GF E+ + EAK+T    + KD
Sbjct  747  QIAELLLEKEVLHQEDLIRVLGERPFKSNEPTNYDRFKEGFQEE-DKEAKET----NAKD  801

Query  247  DDSSPLQPEVV  215
              S P+QP+VV
Sbjct  802  GRSPPIQPDVV  812



>ref|XP_007208082.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
 gb|EMJ09281.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
Length=808

 Score =   441 bits (1135),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKV+SKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  557  FEAAIDRVIGGLEKKNKVVSKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEM+KPYS+KT AIID+EVREW+AKAY  T++LIEEHKE V 
Sbjct  677  YGFSDKVGLLSFPQRDDAFEMAKPYSSKTGAIIDSEVREWVAKAYVRTIELIEEHKEQVG  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKS+EPTNYDRFK+GF E+ + E K+T E  +  D
Sbjct  737  QIAELLLEKEVLHQDDLVRVLGERPFKSNEPTNYDRFKEGFQEE-DKEPKETTEGGNVDD  795

Query  247  DDSSPLQPEVVP  212
              S P+QP+VVP
Sbjct  796  GRSPPIQPDVVP  807



>ref|XP_008369915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=815

 Score =   441 bits (1134),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 232/251 (92%), Gaps = 5/251 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEM+KPYS+KT AIID EVREW+ KAY  TVQLIEEHKEHV 
Sbjct  687  YGFSDKVGLLSFPQREDSFEMTKPYSSKTGAIIDXEVREWVGKAYFRTVQLIEEHKEHVG  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPFKS+EPTNYDRFK+GF E+ + EAK+T    + KD
Sbjct  747  QIAELLLEKEVLHQEDLIRVLGERPFKSNEPTNYDRFKEGFQEE-DKEAKET----NAKD  801

Query  247  DDSSPLQPEVV  215
              S P+QP+VV
Sbjct  802  GRSPPIQPDVV  812



>ref|XP_004143122.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis sativus]
 gb|KGN47136.1| hypothetical protein Csa_6G190270 [Cucumis sativus]
Length=818

 Score =   441 bits (1133),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 234/252 (93%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAV+GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E++FEMSKPYS+KTAAIID+EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  687  YGFSDKVGLLSFPPREDSFEMSKPYSSKTAAIIDSEVREWVGKAYKRTVELIEEHKEQVA  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+R+LGERPFK SE TNYDRFK GFVE  E   ++    ++ +D
Sbjct  747  QIAELLLEKEVLHQEDLLRILGERPFKPSEVTNYDRFKQGFVEADEKSVENPPV-EAAED  805

Query  247  DDSSPLQPEVVP  212
            + SSPL+P+VVP
Sbjct  806  NGSSPLEPQVVP  817



>gb|KHG20351.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=816

 Score =   440 bits (1132),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 232/253 (92%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLER+TVAYHESGHAV+GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FEAAIDRIIGGLEKKNRVISKLERKTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEMSKPYSNKT AIID EVREW+AKAYE TVQLIEEHKE VA
Sbjct  684  YGFSDKVGLLSFPQREDGFEMSKPYSNKTGAIIDGEVREWVAKAYEKTVQLIEEHKEQVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKSSE TNYDRFK GF E++ET++  T E     D
Sbjct  744  QIAELLLEKEVLHQEDLVRVLGERPFKSSELTNYDRFKLGF-EEEETKSMQTPEGGIADD  802

Query  247  DDSS-PLQPEVVP  212
            D S+ PL P+VVP
Sbjct  803  DGSAPPLVPQVVP  815



>ref|XP_010106514.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
 gb|EXC10690.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
Length=817

 Score =   439 bits (1130),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/252 (84%), Positives = 229/252 (91%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEH+EPLLKVTIVPRGTAAL
Sbjct  565  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHSEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVILGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM KPYS+KTAAIIDNEVREW+ KAYE TVQLIEEHKEHVA
Sbjct  685  YGFSDKVGLLSFPQREDTFEMIKPYSSKTAAIIDNEVREWVGKAYERTVQLIEEHKEHVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERPFKS E TNYDRFK GF E+ E   +    + S ++
Sbjct  745  QIAELLLEKEVLHQDDLLKVLGERPFKSVEVTNYDRFKQGFQEEDEKPVEVPLNDASEEE  804

Query  247  DDSSPLQPEVVP  212
            D SSPL P+VVP
Sbjct  805  DGSSPLDPQVVP  816



>ref|XP_008240759.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Prunus mume]
Length=816

 Score =   438 bits (1126),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 232/252 (92%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKV+SKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FEAAIDRVIGGLEKKNKVVSKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++AFEM+KPYS+KT AIID+EVREW+AKAY  T++LIEEHK  V 
Sbjct  685  YGFSDKVGLLSFPQRDDAFEMAKPYSSKTGAIIDSEVREWVAKAYVRTIELIEEHKVQVG  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKS+EPTNYDRFK+GF E+ + E K+T E  +  D
Sbjct  745  QIAELLLEKEVLHQDDLVRVLGERPFKSNEPTNYDRFKEGFQEEGK-EPKETTEGGNVDD  803

Query  247  DDSSPLQPEVVP  212
              S P+QP+VVP
Sbjct  804  GRSPPIQPDVVP  815



>gb|KDO72822.1| hypothetical protein CISIN_1g047690mg [Citrus sinensis]
Length=811

 Score =   437 bits (1124),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/252 (85%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLLTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEMSKPYS+KT AIID EVREW+ KAY  TVQLIEEHKEHVA
Sbjct  682  YGFSDKVGLLSFPQREDTFEMSKPYSSKTGAIIDAEVREWVGKAYVRTVQLIEEHKEHVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK GF E++++ A        T D
Sbjct  742  QIAELLLEKEVLHQDDLLRVLGERPFKSSELTNYDRFKQGFEEEEKSSA---PPETGTVD  798

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V P
Sbjct  799  DGSSPLEPQVAP  810



>ref|XP_008777200.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=679

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  426  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  485

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+++LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  486  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEILLGKISTGAQNDLEKVTKMTYAQVAV  545

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYS+KT AIID EVREW+AKAY+ TV+LI EHK+HV 
Sbjct  546  YGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIREHKDHVI  605

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLV+VLGERPFK SEPTNYDRFK GF + +E + + T+E  +  D
Sbjct  606  QIAELLLEKEVLHQDDLVQVLGERPFKLSEPTNYDRFKQGFQDQEEQKGQQTSEAATMAD  665

Query  247  DD-SSPLQPEVVP  212
            DD SS L  EVVP
Sbjct  666  DDGSSSLDGEVVP  678



>gb|KHN21936.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   436 bits (1122),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+N+VISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTA+L
Sbjct  559  FEAAIDRIIGGLEKRNRVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTASL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCM LGGRASEQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  619  GFAQYVPSENLLMTKEQLFDMTCMALGGRASEQVLIGRISTGAQNDLEKVTKMTYAQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E+SKPYS+KTAAIIDNEVR+W+ KAYE TVQLI+EHKE VA
Sbjct  679  YGFSDKVGLLSFPPTEGSYEISKPYSSKTAAIIDNEVRDWVNKAYEHTVQLIKEHKEQVA  738

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFK +EPTNYDRFK GF+E++E  A+ T +    K 
Sbjct  739  QIAELLLEKEVLHQDDLLRVLGERPFKVTEPTNYDRFKQGFIEEEEKVAESTIDTPE-KG  797

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  798  GGSSPLEPQVVP  809



>ref|XP_003537985.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 233/252 (92%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+N+VISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTA+L
Sbjct  559  FEAAIDRIIGGLEKRNRVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTASL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCM LGGRASEQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  619  GFAQYVPSENLLMTKEQLFDMTCMALGGRASEQVLIGRISTGAQNDLEKVTKMTYAQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E+SKPYS+KTAAIIDNEVR+W+ KAYE TVQLI+EHKE VA
Sbjct  679  YGFSDKVGLLSFPPTEGSYEISKPYSSKTAAIIDNEVRDWVNKAYEHTVQLIKEHKEQVA  738

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFK +EPTNYDRFK GF+E++E  A+ T +    K 
Sbjct  739  QIAELLLEKEVLHQDDLLRVLGERPFKVTEPTNYDRFKQGFIEEEEKVAESTIDTPE-KG  797

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  798  GGSSPLEPQVVP  809



>ref|XP_010931245.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=678

 Score =   432 bits (1110),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  426  FEAAVDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  485

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  486  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  545

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYS+KT AIID EVREW+AKAY+ TV+LI+EHK+HV 
Sbjct  546  YGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIKEHKDHVM  605

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E +E +++ T+E  +  D
Sbjct  606  QIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEQEEQKSQQTSEAATMAD  665

Query  247  DDSSPLQPEVVP  212
            D  S L  EVVP
Sbjct  666  DGPSSLDGEVVP  677



>gb|AAU44017.1| putative AAA-metalloprotease FtsH (fragment) [Oryza sativa Japonica 
Group]
Length=475

 Score =   424 bits (1091),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  224  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  283

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  284  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  343

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  344  YGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  403

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A      D
Sbjct  404  KIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPD  462

Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  463  DDGTPSLGEVVP  474



>ref|XP_006341014.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum tuberosum]
Length=817

 Score =   436 bits (1120),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 227/243 (93%), Gaps = 1/243 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEMSKPYS+KTAAIID EVREW++KAYE TVQLIE+HKEHVA
Sbjct  686  YGFSDKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYERTVQLIEKHKEHVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYD FK GF E++  E KD  ENK+ +D
Sbjct  746  QIAELLLEKEVLHQEDLVRVLGERPFKSLEPTNYDIFKQGF-EEENKERKDNPENKTVED  804

Query  247  DDS  239
            + S
Sbjct  805  NGS  807



>ref|XP_006488359.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=810

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENLLLTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEMSKPYS+KT AIID EVREW+ KAY  TVQLIEEHKEHVA
Sbjct  681  YGFSEKVGLLSFPQREDTFEMSKPYSSKTGAIIDAEVREWVGKAYVRTVQLIEEHKEHVA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK GF E++++ A        T D
Sbjct  741  QIAELLLEKEVLHQDDLLRVLGERPFKSSELTNYDRFKQGFEEEEKSSA---PPETGTVD  797

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V P
Sbjct  798  DGSSPLEPQVAP  809



>ref|XP_008448079.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=824

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  572  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  631

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  632  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  691

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYS+KT AIID+EVREW+ KAY+ TVQLIEEHKEHVA
Sbjct  692  YGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYQRTVQLIEEHKEHVA  751

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFK+ EPTNYDRFK+GF +D+   AK+  E  +  +
Sbjct  752  QIAELLLEKEVLHQDDLVRVLGERPFKTLEPTNYDRFKEGF-KDEVDGAKEKTERGNAGN  810

Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  811  SSSPPLEPDIVP  822



>ref|XP_008448063.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
 ref|XP_008448071.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=825

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  573  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  632

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  633  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  692

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYS+KT AIID+EVREW+ KAY+ TVQLIEEHKEHVA
Sbjct  693  YGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYQRTVQLIEEHKEHVA  752

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFK+ EPTNYDRFK+GF +D+   AK+  E  +  +
Sbjct  753  QIAELLLEKEVLHQDDLVRVLGERPFKTLEPTNYDRFKEGF-KDEVDGAKEKTERGNAGN  811

Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  812  SSSPPLEPDIVP  823



>ref|XP_010043512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010043513.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
Length=683

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 232/253 (92%), Gaps = 3/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  432  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+
Sbjct  492  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAI  551

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+  EM+KPYS+KTAA+ID EVREW+ KAYECT++LI EHKEHVA
Sbjct  552  YGFSDKVGLLSFPQREDGSEMTKPYSSKTAALIDGEVREWVNKAYECTLELITEHKEHVA  611

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPF+SSE TNYDR+K GF  ++E ++ +T E  + +D
Sbjct  612  QIAELLLEKEVLHQEDLLRVLGERPFQSSEMTNYDRYKLGF--EEEEKSTETPETGAVED  669

Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  670  DESPRPLDPQVVP  682



>ref|XP_006349501.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Solanum tuberosum]
Length=688

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISK+ERRT+AYHESGHAVAGWFLE+A+PLLKVTI+PRGTAAL
Sbjct  419  FEAAIDRVIGGLEKKNKVISKMERRTIAYHESGHAVAGWFLEYADPLLKVTIIPRGTAAL  478

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYV +EN LMTKEQLFDMTCMTLGGRA+EQ+++GKISTGAQ+DLEKVTKMTYAQVAV
Sbjct  479  GFAQYVSSENHLMTKEQLFDMTCMTLGGRAAEQILIGKISTGAQDDLEKVTKMTYAQVAV  538

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+A E SKPYS+KTAA+IDNEVR+W+AKAY+ T+QLIEEH+EHVA
Sbjct  539  YGFSDKVGLLSFPQREDALETSKPYSSKTAALIDNEVRKWVAKAYDRTLQLIEEHREHVA  598

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQED+ +VLGERPF+SSEPTNY RFK GF E++  E KD+ + K+T+D
Sbjct  599  QIAELLLEKEVLHQEDMAQVLGERPFESSEPTNYYRFKQGF-EEENGETKDSTDGKTTQD  657

Query  247  DDSSPLQPEVVPV  209
            D SSP++P++VPV
Sbjct  658  DRSSPVEPKIVPV  670



>ref|XP_006349500.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=700

 Score =   431 bits (1109),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISK+ERRT+AYHESGHAVAGWFLE+A+PLLKVTI+PRGTAAL
Sbjct  419  FEAAIDRVIGGLEKKNKVISKMERRTIAYHESGHAVAGWFLEYADPLLKVTIIPRGTAAL  478

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYV +EN LMTKEQLFDMTCMTLGGRA+EQ+++GKISTGAQ+DLEKVTKMTYAQVAV
Sbjct  479  GFAQYVSSENHLMTKEQLFDMTCMTLGGRAAEQILIGKISTGAQDDLEKVTKMTYAQVAV  538

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+A E SKPYS+KTAA+IDNEVR+W+AKAY+ T+QLIEEH+EHVA
Sbjct  539  YGFSDKVGLLSFPQREDALETSKPYSSKTAALIDNEVRKWVAKAYDRTLQLIEEHREHVA  598

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQED+ +VLGERPF+SSEPTNY RFK GF E++  E KD+ + K+T+D
Sbjct  599  QIAELLLEKEVLHQEDMAQVLGERPFESSEPTNYYRFKQGF-EEENGETKDSTDGKTTQD  657

Query  247  DDSSPLQPEVVPV  209
            D SSP++P++VPV
Sbjct  658  DRSSPVEPKIVPV  670



>ref|XP_006424865.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
 ref|XP_006488358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Citrus sinensis]
 gb|ESR38105.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
Length=811

 Score =   435 bits (1118),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/252 (85%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLLTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEMSKPYS+KT AIID EVREW+ KAY  TVQLIEEHKEHVA
Sbjct  682  YGFSEKVGLLSFPQREDTFEMSKPYSSKTGAIIDAEVREWVGKAYVRTVQLIEEHKEHVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK GF E++++ A        T D
Sbjct  742  QIAELLLEKEVLHQDDLLRVLGERPFKSSELTNYDRFKQGFEEEEKSSA---PPETGTVD  798

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V P
Sbjct  799  DGSSPLEPQVAP  810



>ref|XP_006349498.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=815

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 233/254 (92%), Gaps = 6/254 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FESAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FE +KPY +KTAAIID EVREW+AKAY+ TVQL+E+HKEHVA
Sbjct  687  YGFSDKVGLLSFPQREDSFE-AKPYGSKTAAIIDTEVREWVAKAYDHTVQLVEKHKEHVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE+LLEKEVLHQEDL++VLGERPF S EPTNYDRFK GF    E E KD AE K+ +D
Sbjct  746  QIAEMLLEKEVLHQEDLIQVLGERPFVSVEPTNYDRFKQGF----EEENKDGAEAKTAQD  801

Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  802  DGSSSPVEPEIVPV  815



>ref|XP_006349497.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=816

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 233/254 (92%), Gaps = 6/254 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  568  FESAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  627

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  628  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  687

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FE +KPY +KTAAIID EVREW+AKAY+ TVQL+E+HKEHVA
Sbjct  688  YGFSDKVGLLSFPQREDSFE-AKPYGSKTAAIIDTEVREWVAKAYDHTVQLVEKHKEHVA  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE+LLEKEVLHQEDL++VLGERPF S EPTNYDRFK GF    E E KD AE K+ +D
Sbjct  747  QIAEMLLEKEVLHQEDLIQVLGERPFVSVEPTNYDRFKQGF----EEENKDGAEAKTAQD  802

Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  803  DGSSSPVEPEIVPV  816



>ref|XP_006349499.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=716

 Score =   431 bits (1109),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 236/253 (93%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISK+ERRT+AYHESGHAVAGWFLE+A+PLLKVTI+PRGTAAL
Sbjct  419  FEAAIDRVIGGLEKKNKVISKMERRTIAYHESGHAVAGWFLEYADPLLKVTIIPRGTAAL  478

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYV +EN LMTKEQLFDMTCMTLGGRA+EQ+++GKISTGAQ+DLEKVTKMTYAQVAV
Sbjct  479  GFAQYVSSENHLMTKEQLFDMTCMTLGGRAAEQILIGKISTGAQDDLEKVTKMTYAQVAV  538

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+A E SKPYS+KTAA+IDNEVR+W+AKAY+ T+QLIEEH+EHVA
Sbjct  539  YGFSDKVGLLSFPQREDALETSKPYSSKTAALIDNEVRKWVAKAYDRTLQLIEEHREHVA  598

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQED+ +VLGERPF+SSEPTNY RFK GF E++  E KD+ + K+T+D
Sbjct  599  QIAELLLEKEVLHQEDMAQVLGERPFESSEPTNYYRFKQGF-EEENGETKDSTDGKTTQD  657

Query  247  DDSSPLQPEVVPV  209
            D SSP++P++VPV
Sbjct  658  DRSSPVEPKIVPV  670



>ref|XP_011653641.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Cucumis sativus]
Length=825

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLE+AEPLLKVTIVPRGTAAL
Sbjct  573  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEYAEPLLKVTIVPRGTAAL  632

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  633  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  692

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYS+KT AIID+EVREW+ KAYE TVQLIEEHKEHVA
Sbjct  693  YGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYERTVQLIEEHKEHVA  752

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFK+ EPTNYDRFK+GF  D+   AK+  E  +  +
Sbjct  753  QIAELLLEKEVLHQEDLVRVLGERPFKTLEPTNYDRFKEGF-RDEVDGAKEKTERGNPGN  811

Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  812  SSSPPLEPDIVP  823



>ref|XP_004142062.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Cucumis sativus]
 gb|KGN54261.1| hypothetical protein Csa_4G296150 [Cucumis sativus]
Length=824

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLE+AEPLLKVTIVPRGTAAL
Sbjct  572  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEYAEPLLKVTIVPRGTAAL  631

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  632  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  691

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYS+KT AIID+EVREW+ KAYE TVQLIEEHKEHVA
Sbjct  692  YGFSEKVGLLSFPQRDEMFEMSKPYSSKTGAIIDSEVREWVTKAYERTVQLIEEHKEHVA  751

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFK+ EPTNYDRFK+GF  D+   AK+  E  +  +
Sbjct  752  QIAELLLEKEVLHQEDLVRVLGERPFKTLEPTNYDRFKEGF-RDEVDGAKEKTERGNPGN  810

Query  247  DDSSPLQPEVVP  212
              S PL+P++VP
Sbjct  811  SSSPPLEPDIVP  822



>ref|XP_004249560.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum lycopersicum]
Length=812

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 234/254 (92%), Gaps = 6/254 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FESAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++F+ +KPY +KTAAIID EVREW+AKAY+ TVQL+EEH+EHVA
Sbjct  684  YGFSDKVGLLSFPQREDSFD-AKPYGSKTAAIIDTEVREWVAKAYDRTVQLVEEHREHVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE+LLEKEVLHQEDL++VLGERPF S E TNYDRFK GF    E E KD+AE+K+ +D
Sbjct  743  QIAEMLLEKEVLHQEDLIQVLGERPFTSVEATNYDRFKQGF----EEENKDSAESKTAQD  798

Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  799  DGSSSPVEPEIVPV  812



>ref|XP_009600786.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009600787.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=716

 Score =   431 bits (1107),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 233/253 (92%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRT+AYHESGHA+AGWFLEHAEPLLKVTI+PRGTAAL
Sbjct  419  FEAAIDRVIGGLEKKNKVISKLERRTIAYHESGHAIAGWFLEHAEPLLKVTIIPRGTAAL  478

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMT+EQLFDMTCMTLGGRA+EQV++GKIS+GAQNDLEKVTKMTYAQVAV
Sbjct  479  GFAQYVPNENLLMTREQLFDMTCMTLGGRAAEQVLIGKISSGAQNDLEKVTKMTYAQVAV  538

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FE SKPYS+KTAAIID+EVREWIAKAY+ T+QLIEEH+EHVA
Sbjct  539  YGFSDKVGLLSFPQRDDTFETSKPYSSKTAAIIDDEVREWIAKAYDRTLQLIEEHREHVA  598

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLH EDLV+VLGERPF+SSE TNY+RFK GF E++  E KD  ++ + +D
Sbjct  599  QIAELLLEKEVLHHEDLVQVLGERPFESSELTNYNRFKQGF-EEENGEIKDIPKDMTAQD  657

Query  247  DDSSPLQPEVVPV  209
            + SS  + EVVP+
Sbjct  658  NQSSSEESEVVPI  670



>ref|XP_010312354.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Solanum lycopersicum]
Length=813

 Score =   434 bits (1115),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 234/254 (92%), Gaps = 6/254 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FESAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++F+ +KPY +KTAAIID EVREW+AKAY+ TVQL+EEH+EHVA
Sbjct  685  YGFSDKVGLLSFPQREDSFD-AKPYGSKTAAIIDTEVREWVAKAYDRTVQLVEEHREHVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAE+LLEKEVLHQEDL++VLGERPF S E TNYDRFK GF    E E KD+AE+K+ +D
Sbjct  744  QIAEMLLEKEVLHQEDLIQVLGERPFTSVEATNYDRFKQGF----EEENKDSAESKTAQD  799

Query  247  D-DSSPLQPEVVPV  209
            D  SSP++PE+VPV
Sbjct  800  DGSSSPVEPEIVPV  813



>ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Vitis vinifera]
 emb|CBI16104.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   434 bits (1115),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 228/252 (90%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVIS+LERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  568  FEAAIDRIIGGLEKKNKVISQLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  627

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  628  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  687

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYS+KT AIID EVREW+ KAYE T+QLIEEHKE VA
Sbjct  688  YGFSDKVGLLSFPQREDGFEMTKPYSSKTGAIIDTEVREWVGKAYERTLQLIEEHKEQVA  747

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL RVLGERPFKS EP+NYDRFK GF E+ +  A     +++  +
Sbjct  748  QIAELLLEKEVLHQDDLTRVLGERPFKSLEPSNYDRFKQGFEEENDKSAITQDSSRTEPE  807

Query  247  DDSSPLQPEVVP  212
            + + PL+PEVVP
Sbjct  808  NGAPPLEPEVVP  819



>ref|XP_008777193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=822

 Score =   433 bits (1113),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 230/254 (91%), Gaps = 1/254 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+++LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEILLGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYS+KT AIID EVREW+AKAY+ TV+LI EHK+HV 
Sbjct  689  YGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIREHKDHVI  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLV+VLGERPFK SEPTNYDRFK GF + +E + + T+E  +  D
Sbjct  749  QIAELLLEKEVLHQDDLVQVLGERPFKLSEPTNYDRFKQGFQDQEEQKGQQTSEAATMAD  808

Query  247  DD-SSPLQPEVVPV  209
            DD SS L  EVVP 
Sbjct  809  DDGSSSLDGEVVPT  822



>ref|XP_004246405.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum lycopersicum]
Length=813

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/243 (86%), Positives = 226/243 (93%), Gaps = 1/243 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEMSKPYS+KTAAIID EVREW++KAY+ TVQLIE+HKEHVA
Sbjct  682  YGFSDKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYDRTVQLIEKHKEHVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPFKS EPTNYD FK GF E++  E K   ENK+ +D
Sbjct  742  QIAELLLEKEVLHQEDLVRVLGERPFKSHEPTNYDIFKQGF-EEENKETKVNPENKTVED  800

Query  247  DDS  239
            + S
Sbjct  801  NGS  803



>ref|XP_007016370.1| FTSH protease 10 [Theobroma cacao]
 gb|EOY33989.1| FTSH protease 10 [Theobroma cacao]
Length=813

 Score =   432 bits (1112),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLER+TVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FEAAIDRIIGGLEKKNRVISKLERKTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEMSKPYSNKT AIID EVR+W+ KAYE TVQLIEEHKE VA
Sbjct  682  YGFSEKVGLLSFPQRDDGFEMSKPYSNKTGAIIDGEVRKWVGKAYEKTVQLIEEHKEQVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DLVRVLGERPFKSSE TNYDRFK GF E++  ++    E  S ++
Sbjct  742  EIAELLLEKEVLHQDDLVRVLGERPFKSSELTNYDRFKQGF-EEEANKSMQAPEVGSVEN  800

Query  247  DDSSPLQPEVVP  212
            D S+PL P+VVP
Sbjct  801  DGSAPLDPQVVP  812



>ref|XP_010931244.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=816

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FEAAVDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYS+KT AIID EVREW+AKAY+ TV+LI+EHK+HV 
Sbjct  684  YGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIKEHKDHVM  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E +E +++ T+E  +  D
Sbjct  744  QIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEQEEQKSQQTSEAATMAD  803

Query  247  DDSSPLQPEVVP  212
            D  S L  EVVP
Sbjct  804  DGPSSLDGEVVP  815



>ref|XP_004294648.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=810

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 229/252 (91%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FESAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEMSKPYS+KTAA+ID EVREW+ KAY  TV L+EEHK+ VA
Sbjct  681  YGFSDKVGLLSFPQRDDGFEMSKPYSSKTAALIDGEVREWVGKAYAHTVALLEEHKDQVA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERP+KSSE +NYDRFK GF ++K  EA  +      ++
Sbjct  741  QIAELLLEKEVLHQDDLLRVLGERPYKSSEVSNYDRFKQGFEDEKTVEAPVSV---GREE  797

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  798  DGSSPLEPQVLP  809



>gb|ACN36802.1| unknown [Zea mays]
Length=417

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 224/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  167  FESAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  226

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  227  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  286

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  287  YGFSEKVGLLSFPQKDGGFEMSKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  346

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL RVLGERPFK+ E TNYD FK GF ED    ++  AEN    D
Sbjct  347  QIAELLLEKEVLHQDDLTRVLGERPFKALESTNYDLFKKGF-EDGGDNSQAPAENAELPD  405

Query  247  DDSSPLQPEVVP  212
            D S P+  +VVP
Sbjct  406  DSSPPVG-DVVP  416



>ref|XP_010931243.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=821

 Score =   431 bits (1109),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/252 (83%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAVDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYS+KT AIID EVREW+AKAY+ TV+LI+EHK+HV 
Sbjct  689  YGFSEKVGLLSFPQRDDGFEMTKPYSSKTGAIIDTEVREWVAKAYQRTVELIKEHKDHVM  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E +E +++ T+E  +  D
Sbjct  749  QIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEQEEQKSQQTSEAATMAD  808

Query  247  DDSSPLQPEVVP  212
            D  S L  EVVP
Sbjct  809  DGPSSLDGEVVP  820



>ref|XP_004961860.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Setaria italica]
Length=816

 Score =   431 bits (1108),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  685  YGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL RVLGERPFK++EPTNYD FK GF +D + +++  A+N    D
Sbjct  745  QIAELLLEKEVLHQDDLTRVLGERPFKATEPTNYDLFKQGF-QDDDDKSQAPAKNAELPD  803

Query  247  DDSSPLQPEVVP  212
            DD+SP   EVVP
Sbjct  804  DDASPSLGEVVP  815



>gb|KCW85528.1| hypothetical protein EUGRSUZ_B02325 [Eucalyptus grandis]
Length=816

 Score =   431 bits (1108),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 231/253 (91%), Gaps = 3/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  565  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAI  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+  EM+KPYS+KTAA+ID EVREW+ KAYECT++LI EHKEHVA
Sbjct  685  YGFSDKVGLLSFPQREDGSEMTKPYSSKTAALIDGEVREWVNKAYECTLELITEHKEHVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPF+SSE TNYDR+K GF E  E ++ +T E  + +D
Sbjct  745  QIAELLLEKEVLHQEDLLRVLGERPFQSSEMTNYDRYKLGFEE--EEKSTETPETGAVED  802

Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  803  DESPRPLDPQVVP  815



>ref|XP_009804923.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009804924.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
Length=716

 Score =   427 bits (1099),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/253 (81%), Positives = 233/253 (92%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRT+AYHESGHAVAGWFLEHAEPLLKVTI+PRGTAAL
Sbjct  419  FEAAIDRVIGGLEKKNKVISKLERRTIAYHESGHAVAGWFLEHAEPLLKVTIIPRGTAAL  478

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQ+DLEKVTKMTYAQVAV
Sbjct  479  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQDDLEKVTKMTYAQVAV  538

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FE SKPYS+KTAAIID+EVREW+AKAY+ T+QLIEEH+EHVA
Sbjct  539  YGFSDKVGLLSFPLRDDTFETSKPYSSKTAAIIDDEVREWVAKAYDRTLQLIEEHREHVA  598

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLV+VLGER F++SE TNY+RFK GF E++  E KD  ++K+ +D
Sbjct  599  QIAELLLEKEVLHQEDLVQVLGERSFENSELTNYNRFKQGF-EEENREIKDIPKDKTAQD  657

Query  247  DDSSPLQPEVVPV  209
            + SS    EVVP+
Sbjct  658  NQSSSEGSEVVPI  670



>ref|XP_009384843.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 228/254 (90%), Gaps = 1/254 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  568  FEAAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  627

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  628  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  687

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYSNKT AIID EVREWI+KAYE TV+LI+EHK+HVA
Sbjct  688  YGFSDKVGLLSFPQREDGFEMTKPYSNKTGAIIDTEVREWISKAYERTVELIKEHKDHVA  747

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLL+KEVLHQ+DL +VLGERPFK +EPTNYDRFK GF E  E ++++T E     D
Sbjct  748  QIAELLLKKEVLHQDDLAQVLGERPFKLTEPTNYDRFKQGFQEATEKKSQETLEGSIVAD  807

Query  247  -DDSSPLQPEVVPV  209
             D SS L  EVVP 
Sbjct  808  GDGSSSLDGEVVPT  821



>ref|XP_010043511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
Length=847

 Score =   431 bits (1109),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 232/253 (92%), Gaps = 3/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  596  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAAL  655

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+
Sbjct  656  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAI  715

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+  EM+KPYS+KTAA+ID EVREW+ KAYECT++LI EHKEHVA
Sbjct  716  YGFSDKVGLLSFPQREDGSEMTKPYSSKTAALIDGEVREWVNKAYECTLELITEHKEHVA  775

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPF+SSE TNYDR+K GF  ++E ++ +T E  + +D
Sbjct  776  QIAELLLEKEVLHQEDLLRVLGERPFQSSEMTNYDRYKLGF--EEEEKSTETPETGAVED  833

Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  834  DESPRPLDPQVVP  846



>ref|XP_009375915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   430 bits (1106),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E +FEMSKPYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A
Sbjct  681  YGFSDKVGLLSFPQREESFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K+ E         ++D
Sbjct  741  QIAELLLEKEVLHQDDLIKVLGERPYKPAEATNYDRFKDGF-EEKDAEKTVETPLVGSED  799

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811



>ref|XP_006592192.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Glycine max]
Length=674

 Score =   426 bits (1095),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+NKVISKLERRT AYHE+GHAV+GWFLEH EPLLKVTIVPRGTA L
Sbjct  423  FEAAIDRIIGGLEKRNKVISKLERRTAAYHEAGHAVSGWFLEHGEPLLKVTIVPRGTAGL  482

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENL MTKEQLFD+TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  483  GFAQYVPNENLFMTKEQLFDITCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  542

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E SKPYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V 
Sbjct  543  YGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVT  602

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +    + 
Sbjct  603  EIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EG  661

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  662  GGSSPLEPQVVP  673



>ref|XP_009384842.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=833

 Score =   431 bits (1107),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 228/253 (90%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  580  FEAAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  639

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  640  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  699

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYSNKT AIID EVREWI+KAYE TV+LI+EHK+HVA
Sbjct  700  YGFSDKVGLLSFPQREDGFEMTKPYSNKTGAIIDTEVREWISKAYERTVELIKEHKDHVA  759

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLL+KEVLHQ+DL +VLGERPFK +EPTNYDRFK GF E  E ++++T E     D
Sbjct  760  QIAELLLKKEVLHQDDLAQVLGERPFKLTEPTNYDRFKQGFQEATEKKSQETLEGSIVAD  819

Query  247  -DDSSPLQPEVVP  212
             D SS L  EVVP
Sbjct  820  GDGSSSLDGEVVP  832



>ref|XP_009416148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=809

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/245 (84%), Positives = 226/245 (92%), Gaps = 5/245 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQL DMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLLDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYS+KT AIIDNEVREWI+KAYE TV+LI+EHK+HVA
Sbjct  689  YGFSDKVGLLSFPQREDGFEMTKPYSSKTGAIIDNEVREWISKAYEKTVELIKEHKDHVA  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            Q+A+LLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK GF E++E ++     +  T D
Sbjct  749  QVAKLLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKQGFQEEEENKS-----SLETLD  803

Query  247  DDSSP  233
            DD  P
Sbjct  804  DDVVP  808



>ref|XP_009140963.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brassica rapa]
Length=803

 Score =   428 bits (1101),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  552  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  611

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  612  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  671

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ +KPYSNKT AIID EVREW+AKAY  TV+LIEEHKE VA
Sbjct  672  YGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVAKAYVKTVELIEEHKEQVA  731

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQEDL++VLGERPFKS+E TNYDRFK GF ED E E   T       +
Sbjct  732  EIAELLLEKEVLHQEDLLKVLGERPFKSAEVTNYDRFKSGF-EDSEKEEAATTVTPVVDE  790

Query  247  DDSSPLQPEVVP  212
              S PL+P+VVP
Sbjct  791  GGSPPLEPQVVP  802



>ref|XP_008359096.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=777

 Score =   427 bits (1098),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  526  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  585

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  586  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAV  645

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E +FEMSKPYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A
Sbjct  646  YGFSDKVGLLSFPQREESFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIA  705

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K+ E         ++D
Sbjct  706  EIAELLLEKEVLHQDDLIKVLGERPYKPAEATNYDRFKDGF-EEKDGEKTVETPLVGSED  764

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  765  DGSSPLEPQVLP  776



>ref|XP_008384940.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
 ref|XP_008366266.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   428 bits (1101),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E +FEMSKPYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A
Sbjct  681  YGFSDKVGLLSFPQREESFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K+ E         ++D
Sbjct  741  EIAELLLEKEVLHQDDLIKVLGERPYKPAEATNYDRFKDGF-EEKDGEKTVETPLVGSED  799

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811



>ref|XP_006293791.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
 gb|EOA26689.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
Length=679

 Score =   424 bits (1090),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 203/253 (80%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  427  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  486

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  487  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  546

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVREW++KAYE TV+L+EEHKE VA
Sbjct  547  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYERTVELVEEHKEKVA  606

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF ED E ++  T   +   D
Sbjct  607  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EDNEKDSTTTPRVEPVVD  665

Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  666  EGAPPPLEPQVVP  678



>ref|XP_009364366.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FEAAIDRIIGGLEKKNRVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNEN+LMTKEQLFDMTCMTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENILMTKEQLFDMTCMTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEMSKPYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A
Sbjct  681  YGFSDKVGLLSFPQREDSFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFKDGF E+K  E         ++D
Sbjct  741  QIAELLLEKEVLHQDDLLKVLGERPYKPAEATNYDRFKDGF-EEKNDEKTVETPLVGSED  799

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811



>ref|XP_006592191.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Glycine max]
Length=782

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+NKVISKLERRT AYHE+GHAV+GWFLEH EPLLKVTIVPRGTA L
Sbjct  531  FEAAIDRIIGGLEKRNKVISKLERRTAAYHEAGHAVSGWFLEHGEPLLKVTIVPRGTAGL  590

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENL MTKEQLFD+TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  591  GFAQYVPNENLFMTKEQLFDITCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  650

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E SKPYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V 
Sbjct  651  YGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVT  710

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +    + 
Sbjct  711  EIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EG  769

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  770  GGSSPLEPQVVP  781



>gb|KHN32138.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=771

 Score =   426 bits (1095),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+NKVISKL+RRTVAYHE+GHAV+GWFLEH EPLLKVTIVPRGTAAL
Sbjct  520  FEAAIDRIIGGLEKRNKVISKLQRRTVAYHEAGHAVSGWFLEHVEPLLKVTIVPRGTAAL  579

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENL+MTKEQLFD+TCM LGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  580  GFAQYVPNENLIMTKEQLFDITCMALGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  639

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E SKPYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V 
Sbjct  640  YGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVT  699

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +    + 
Sbjct  700  EIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EG  758

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  759  GGSSPLEPQVVP  770



>ref|XP_010685724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=819

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 230/254 (91%), Gaps = 5/254 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  568  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  627

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  628  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  687

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYSNKT AIID EVREW+ KAY+ TV+LIEE KE VA
Sbjct  688  YGFSDKVGLLSFPQREDGFEMTKPYSNKTGAIIDEEVREWVTKAYKRTVELIEEKKEQVA  747

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVE--DKETEAKDTAENKST  254
             IAELLLEKEVLHQEDLVRVLGERP+K +E TNYDRFK GF E  DK ++A   ++ +++
Sbjct  748  TIAELLLEKEVLHQEDLVRVLGERPYKPAELTNYDRFKQGFQEEPDKSSQA---SKKQTS  804

Query  253  KDDDSSPLQPEVVP  212
            +D+ S PL P+VVP
Sbjct  805  EDEGSPPLIPDVVP  818



>emb|CDY31753.1| BnaA04g16890D [Brassica napus]
Length=788

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  537  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  596

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  597  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  656

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ +KPYSNKT AIID EVREW+AKAY  TV+LIEEHKE VA
Sbjct  657  YGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVAKAYVKTVELIEEHKEQVA  716

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQEDL++VLGERPFKS+E TNYDRFK GF E ++ EA  T       +
Sbjct  717  EIAELLLEKEVLHQEDLLKVLGERPFKSAEVTNYDRFKSGFEESEKEEAATTV-TPVVDE  775

Query  247  DDSSPLQPEVVP  212
              S PL+P+VVP
Sbjct  776  GGSPPLEPQVVP  787



>dbj|BAE98430.1| AAA-type like ATPase [Arabidopsis thaliana]
Length=326

 Score =   410 bits (1055),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 217/235 (92%), Gaps = 1/235 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRG AAL
Sbjct  87   FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGAAAL  146

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  147  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  206

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA
Sbjct  207  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVA  266

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVE-DKETEAKDTAE  266
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E +K++ A  T E
Sbjct  267  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTVE  321



>emb|CDX77230.1| BnaC04g40250D [Brassica napus]
Length=789

 Score =   426 bits (1095),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  538  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  597

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  598  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  657

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ +KPYSNKT AIID EVREW+ KAYE TV+LIEEHKE VA
Sbjct  658  YGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIEEHKEQVA  717

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLL+KEVLHQEDL++VLGERPFKS+E TNYDRFK GF ED E E   T       +
Sbjct  718  EIAELLLDKEVLHQEDLLKVLGERPFKSAEVTNYDRFKSGF-EDSEKEEAATTVTPVVDE  776

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  777  GGPPPLEPQVVP  788



>ref|XP_007207144.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
 gb|EMJ08343.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
Length=814

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLE+AEPLLKVTIVPRGTAAL
Sbjct  563  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVTGWFLEYAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  623  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+KT AIID+EVREW+ KAY  TV++IEEHKE VA
Sbjct  683  YGFSDKVGLLSFPQRDDGFEMAKPYSSKTGAIIDSEVREWVGKAYTRTVEIIEEHKEQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK+GF E+K+ E         +++
Sbjct  743  QIAELLLEKEVLHQDDLLRVLGERPFKSSEVTNYDRFKEGF-EEKDDEKIVEIPLVGSEE  801

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  802  DGSSPLEPQVLP  813



>ref|XP_006417796.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
 gb|ESQ36149.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
Length=815

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 226/252 (90%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E  F  SKPYSN+T A+ID EVREW+AKAY+ TV+LIEEHKE VA
Sbjct  685  YGFSDKIGLLSFPQREEEF--SKPYSNRTGAMIDEEVREWVAKAYKRTVELIEEHKEQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   ++    K T+D
Sbjct  743  QIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEETEKKSQEEPVTVKPTED  802

Query  247  DDSSPLQPEVVP  212
            D S PL+P+VVP
Sbjct  803  DGSPPLEPQVVP  814



>gb|KFK43073.1| hypothetical protein AALP_AA1G075200 [Arabis alpina]
Length=814

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 227/252 (90%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+AKAY+ TV+L+EEHKE VA
Sbjct  684  YGFSDKIGLLSFPQREDEF--SKPYSNRTGAMIDEEVREWVAKAYKRTVELVEEHKEQVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS+E TNYDRFK GF E  +   ++T   K  +D
Sbjct  742  QIAELLLEKEVLHQDDLAKVLGERPFKSAEKTNYDRFKSGFEETDKKSQEETVTTKPVED  801

Query  247  DDSSPLQPEVVP  212
            D + PL+P+VVP
Sbjct  802  DGAPPLEPQVVP  813



>ref|XP_008222305.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Prunus mume]
Length=814

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/252 (82%), Positives = 229/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  563  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  623  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+KT AIID+EVREW+ KAY  TV++IEEHK  VA
Sbjct  683  YGFSDKVGLLSFPQRDDGFEMAKPYSSKTGAIIDSEVREWVGKAYTRTVEIIEEHKVQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFKSSE TNYDRFK+GF E+K+ E         +++
Sbjct  743  QIAELLLEKEVLHQDDLLRVLGERPFKSSEVTNYDRFKEGF-EEKDDEKTVEIPLVGSEE  801

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  802  DGSSPLEPQVLP  813



>ref|XP_003539663.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Glycine max]
Length=806

 Score =   426 bits (1095),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/252 (79%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+NKVISKLERRT AYHE+GHAV+GWFLEH EPLLKVTIVPRGTA L
Sbjct  555  FEAAIDRIIGGLEKRNKVISKLERRTAAYHEAGHAVSGWFLEHGEPLLKVTIVPRGTAGL  614

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENL MTKEQLFD+TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  615  GFAQYVPNENLFMTKEQLFDITCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  674

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E SKPYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V 
Sbjct  675  YGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVT  734

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+RVLGERPFK++EPTNYDRFK GF+E++E  A+ T +    + 
Sbjct  735  EIAELLLEKEVLHQDDLLRVLGERPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EG  793

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  794  GGSSPLEPQVVP  805



>ref|XP_008356937.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FEAAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEMSKPYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A
Sbjct  681  YGFSDKVGLLSFPQREDSFEMSKPYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERP+K +E TNYDRFK+GF E+K  E         ++D
Sbjct  741  QIAELLLEKEVLHQDDLLKVLGERPYKPAEVTNYDRFKEGF-EEKNDEKTVETPLVGSED  799

Query  247  DDSSPLQPEVVP  212
            D SSPL+P+V+P
Sbjct  800  DGSSPLEPQVLP  811



>ref|XP_011089809.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Sesamum indicum]
Length=826

 Score =   427 bits (1097),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/253 (81%), Positives = 230/253 (91%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F +AIDR+IGGLEKKNKVISKLERRTVA+HESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  575  FNAAIDRIIGGLEKKNKVISKLERRTVAFHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  634

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  635  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  694

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEMSKPYS+KTAAIID EVREW++KAYE TV+LI+EHKE VA
Sbjct  695  YGFSEKVGLLSFPQRDDGFEMSKPYSSKTAAIIDTEVREWVSKAYERTVELIQEHKEQVA  754

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            ++AELLLEKE L+QEDLV++LGERPFK SE TNYD+FK GF  + E   + TAE+ +T+D
Sbjct  755  KMAELLLEKETLYQEDLVQLLGERPFKPSEMTNYDKFKQGFQGENEKSGQ-TAEDGTTED  813

Query  247  DDSSPLQPEVVPV  209
            D SSPL P+VVP 
Sbjct  814  DGSSPLVPDVVPT  826



>gb|KFK32242.1| hypothetical protein AALP_AA6G216200 [Arabis alpina]
Length=802

 Score =   426 bits (1094),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 227/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHA+PLLKVTIVPRG+AAL
Sbjct  551  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHADPLLKVTIVPRGSAAL  610

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  611  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  670

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVREW++KAYE TV+LIEEHK+ VA
Sbjct  671  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYEKTVELIEEHKDQVA  730

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERPFKS+E TNYDRFK GF E+ E E   T  N    +
Sbjct  731  QIAELLLEKEVLHQDDLLKVLGERPFKSAEVTNYDRFKSGF-EESEQEPTTTTVNPVVDE  789

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  790  GAPPPLEPQVVP  801



>ref|XP_004302718.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=812

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 221/243 (91%), Gaps = 1/243 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  561  FEAAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVA+
Sbjct  621  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAI  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP N N FEM KPYS+KT AIID+EVREW+AKAY  T++LIEEHKEHV 
Sbjct  681  YGFSDKVGLLSFPQN-NEFEMMKPYSSKTGAIIDSEVREWVAKAYTRTIELIEEHKEHVG  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERP+KS EPTNYD+FK GF E+ +   + T E K+  D
Sbjct  740  QIAELLLEKEVLHQEDLVRVLGERPWKSEEPTNYDKFKQGFQEEDKEAKQTTTEGKNVND  799

Query  247  DDS  239
              S
Sbjct  800  GQS  802



>ref|XP_010937593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial-like [Elaeis guineensis]
Length=820

 Score =   426 bits (1095),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 207/253 (82%), Positives = 229/253 (91%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNK ISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKAISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTC TLGGRASE+V+LGKISTGAQ+DLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDMTCRTLGGRASEEVLLGKISTGAQDDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FEM+KPYS+KTAAIID+EVREW+ KAY+ TV+LI+EHK+ V 
Sbjct  689  YGFSDKVGLLSFPQRDDTFEMTKPYSSKTAAIIDSEVREWVTKAYQRTVELIKEHKDQVI  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E+ E E ++ ++    +D
Sbjct  749  QIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQEEAEDEGREPSK-AIEED  807

Query  247  DDSSPLQPEVVPV  209
            D SS L  EVVP 
Sbjct  808  DRSSSLSGEVVPT  820



>ref|XP_010043509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW85526.1| hypothetical protein EUGRSUZ_B02323 [Eucalyptus grandis]
Length=816

 Score =   425 bits (1093),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 230/253 (91%), Gaps = 3/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  565  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAI  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYS+KTAA+ID EVRE + KAYE T++LI EHKEHVA
Sbjct  685  YGFSDKVGLLSFPQREDGFEMTKPYSSKTAALIDGEVREVVNKAYERTLELITEHKEHVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPFKSSE TNYDR+K GF E  E ++ +T E  + +D
Sbjct  745  QIAELLLEKEVLHQEDLLRVLGERPFKSSEMTNYDRYKLGFEE--EEKSTETPETGAVED  802

Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  803  DESPPPLDPQVVP  815



>ref|XP_003539662.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+NKVISKLERRTVAYHE+GHAV+GWFLEH EPLLKVTIVPRGTAAL
Sbjct  559  FEAAIDRIIGGLEKRNKVISKLERRTVAYHEAGHAVSGWFLEHVEPLLKVTIVPRGTAAL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTK+TYAQVAV
Sbjct  619  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKLTYAQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E SKPYS+KTAAIID+EVR+W+ KAY+ T+QLIEEHKE V 
Sbjct  679  YGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDSEVRDWVDKAYKHTIQLIEEHKEQVT  738

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFK++E TNYDRFK GF+E++E   + T +    + 
Sbjct  739  QIAELLLEKEVLHQDDLLRVLGERPFKATELTNYDRFKQGFIEEEEKVVESTVDTPE-EG  797

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  798  GGSSPLEPQVVP  809



>ref|XP_002439915.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
 gb|EES18345.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
Length=815

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/253 (81%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FESAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVR+W+ KAY+ TV+LI EHKE VA
Sbjct  685  YGFSEKVGLLSFPQKDDGFEMTKPYSNQTASIIDDEVRDWVGKAYKKTVELITEHKEQVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL RVLGERPFK+ EPTNYD FK GF +D + +++ T+EN    D
Sbjct  745  QIAELLLEKEVLHQDDLTRVLGERPFKALEPTNYDLFKQGF-QDDDDKSQATSENAELPD  803

Query  247  DDSSPLQPEVVPV  209
            D S PL  EVVP 
Sbjct  804  DSSPPLG-EVVPT  815



>ref|XP_010475511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Camelina sativa]
Length=815

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  685  YGFSDKIGLLSFPQKEDEF--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +D
Sbjct  743  QIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKDSQKESVTLKPVED  802

Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  803  DGVPPLEPQVVP  814



>gb|KHN32140.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   424 bits (1091),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 230/252 (91%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEK+NKVISKLERRTVAYHE+GHAV+GWFLEH EPLLKVTIVPRGTAAL
Sbjct  559  FEAAIDRIIGGLEKRNKVISKLERRTVAYHEAGHAVSGWFLEHVEPLLKVTIVPRGTAAL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  619  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E ++E SKPYS+KTAAIID+EVR+W+ KAY+ T+QLIEEHKE V 
Sbjct  679  YGFSDKVGLLSFPPTEGSYEFSKPYSSKTAAIIDSEVRDWVDKAYKHTIQLIEEHKEQVT  738

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+RVLGERPFK++E TNYDRFK GF+E++E   + T +    + 
Sbjct  739  EIAELLLEKEVLHQDDLLRVLGERPFKATELTNYDRFKQGFIEEEEKVVESTVDTPE-EG  797

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  798  GGSSPLEPQVVP  809



>ref|NP_001055745.1| Os05g0458400 [Oryza sativa Japonica Group]
 sp|Q0DHL4.1|FTSH8_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 8, mitochondrial; 
Short=OsFTSH8; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAF17659.1| Os05g0458400 [Oryza sativa Japonica Group]
Length=822

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  571  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  631  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  690

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  691  YGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  750

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A      D
Sbjct  751  KIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPD  809

Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  810  DDGTPSLGEVVP  821



>ref|XP_010475512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Camelina sativa]
Length=813

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  563  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  623  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  683  YGFSDKIGLLSFPQKEDEF--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +D
Sbjct  741  QIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKDSQKESVTLKPVED  800

Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  801  DGVPPLEPQVVP  812



>gb|EEE63976.1| hypothetical protein OsJ_18802 [Oryza sativa Japonica Group]
Length=792

 Score =   424 bits (1089),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  541  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  600

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  601  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  660

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  661  YGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  720

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A      D
Sbjct  721  KIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPD  779

Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  780  DDGTPSLGEVVP  791



>ref|XP_009387530.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=818

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 228/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  567  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  626

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLL+TKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  627  GFAQYVPSENLLLTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  686

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS KVGLLSFP  ++  EM+KPYS+KT AIID EVREW++KAYE TV LI+EHK+HV 
Sbjct  687  YGFSSKVGLLSFPQRDDTLEMTKPYSSKTGAIIDEEVREWVSKAYERTVALIKEHKDHVI  746

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPF SSEPTNYD+F  GF +D++  + +  E+ + +D
Sbjct  747  QIAELLLEKEVLHQEDLVRVLGERPFVSSEPTNYDKFIQGF-QDEDNTSNNLPEDAALED  805

Query  247  DDSSPLQPEVVP  212
            D SSPL  EVVP
Sbjct  806  DGSSPLNGEVVP  817



>ref|XP_010521866.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=679

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 223/252 (88%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKN VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  430  FEAAIDRVIGGLEKKNLVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  489

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  490  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  549

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ ++ SKPYSNKT A+ID EVREW++KAYE TV+LIEE KE VA
Sbjct  550  YGFSDKIGLLSFPQREDGYDFSKPYSNKTGAMIDEEVREWVSKAYERTVELIEERKEQVA  609

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLV+VLGERPFKS+E TNYDR+K GF   +E E K      +  D
Sbjct  610  QIAELLLEKEVLHQEDLVKVLGERPFKSNEVTNYDRYKSGF---EEAEKKGDEAKPAEDD  666

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  667  GGVPPLEPQVVP  678



>gb|EEC79350.1| hypothetical protein OsI_20217 [Oryza sativa Indica Group]
Length=829

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 226/252 (90%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  578  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  637

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  638  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  697

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  698  YGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  757

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAE+LLEKEVLHQ+DLVRVLGERPFK+SEPTNYD FK GF +D+E      A      D
Sbjct  758  KIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPD  816

Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  817  DDGTPSLGEVVP  828



>ref|XP_010487541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=815

 Score =   424 bits (1090),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  685  YGFSDKIGLLSFPQREDEF--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +D
Sbjct  743  QIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKESQKESVTVKPVED  802

Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  803  DGVPPLEPQVVP  814



>ref|XP_003568313.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Brachypodium distachyon]
Length=814

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 230/251 (92%), Gaps = 1/251 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEM+KPYSN+TA+IID EVR+W++KAY+ TV+L+ EHKE VA
Sbjct  682  YGFSEKVGLLSFPQREDGFEMNKPYSNQTASIIDEEVRDWVSKAYKKTVELVTEHKEQVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL+RVLGERPFK+ E TNYD FK GF +D++ ++ + A+N    D
Sbjct  742  QIAELLLEKEVLHQDDLMRVLGERPFKAVELTNYDLFKQGF-QDEDGKSPEAAKNAEVPD  800

Query  247  DDSSPLQPEVV  215
            DD SP+ P+VV
Sbjct  801  DDGSPVLPDVV  811



>ref|XP_010920548.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Elaeis guineensis]
Length=819

 Score =   423 bits (1088),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLLTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  ++ FEMSKPYS+KT AIID EVREW+ KAY+ TV+L++EHK+HV 
Sbjct  689  YGFSDKIGLLSFPQRDDGFEMSKPYSSKTGAIIDAEVREWVTKAYQRTVELMKEHKDHVI  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSEPTNYDRFK GF E  E + K    +K+  +
Sbjct  749  QIAELLLEKEVLHQDDLVRVLGERPFKSSEPTNYDRFKQGFQE--EEDDKGGEPSKAVDE  806

Query  247  DDSSPLQPEVVP  212
            DD S     VVP
Sbjct  807  DDGSSSLCGVVP  818



>ref|XP_009781386.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=808

 Score =   423 bits (1087),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 226/243 (93%), Gaps = 2/243 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHE+GHAV GWFLE+AEPLLKVTIVPRGTAAL
Sbjct  559  FESAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVVGWFLEYAEPLLKVTIVPRGTAAL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  619  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++ FE +KPY +KTAAIID+EVREW+AKAY+ TV+L+EEH+EHVA
Sbjct  679  YGFSDKVGLLSFPQRDDTFE-AKPYGSKTAAIIDSEVREWVAKAYDNTVKLVEEHREHVA  737

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVRVLGERPF+SSEPTNYDRF  GF E++ +E  D+ E K+ +D
Sbjct  738  QIAELLLEKEVLHQEDLVRVLGERPFQSSEPTNYDRFTQGF-EEENSETTDSTEEKTAED  796

Query  247  DDS  239
            + S
Sbjct  797  NGS  799



>ref|XP_010469994.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010469995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=812

 Score =   423 bits (1087),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/253 (80%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  560  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  619

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  620  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  679

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVREW++KAYE T++L+EEHKE VA
Sbjct  680  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYERTLELVEEHKEKVA  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF ED E ++  T   +   D
Sbjct  740  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EDSEKDSAATPRVEPVVD  798

Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  799  EGAPPPLEPQVVP  811



>ref|XP_010487557.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Camelina sativa]
Length=815

 Score =   423 bits (1087),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQ+++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQLLIGRISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  685  YGFSDKIGLLSFPQREDEF--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +D
Sbjct  743  QIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGFEETEKESQKESVTVKPVED  802

Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  803  DGVPPLEPQVVP  814



>ref|XP_002881027.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57286.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   422 bits (1086),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 223/252 (88%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  626  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVREW+AKAYE TV+L+EEHK  VA
Sbjct  686  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVREWVAKAYERTVELVEEHKVKVA  745

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERPFKS+E TNYDRFK GF E ++  A          +
Sbjct  746  QIAELLLEKEVLHQDDLLKVLGERPFKSAEVTNYDRFKSGFEESEKDSAPTPTVEPVVDE  805

Query  247  DDSSPLQPEVVP  212
                PL+P+V+P
Sbjct  806  GVPPPLEPQVIP  817



>ref|XP_010414442.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Camelina sativa]
Length=812

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/253 (79%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  560  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  619

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  620  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  679

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVREW++KAYE T++L+EEHKE VA
Sbjct  680  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVREWVSKAYERTIELVEEHKEKVA  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E+ E ++  T   +   D
Sbjct  740  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EESEKDSAATPRVEPVVD  798

Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  799  EGAPPPLEPQVVP  811



>ref|XP_010521865.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=809

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 223/252 (88%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKN VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  560  FEAAIDRVIGGLEKKNLVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  619

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  620  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  679

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ ++ SKPYSNKT A+ID EVREW++KAYE TV+LIEE KE VA
Sbjct  680  YGFSDKIGLLSFPQREDGYDFSKPYSNKTGAMIDEEVREWVSKAYERTVELIEERKEQVA  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLV+VLGERPFKS+E TNYDR+K GF   +E E K      +  D
Sbjct  740  QIAELLLEKEVLHQEDLVKVLGERPFKSNEVTNYDRYKSGF---EEAEKKGDEAKPAEDD  796

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  797  GGVPPLEPQVVP  808



>gb|AFW82207.1| hypothetical protein ZEAMMB73_958383 [Zea mays]
Length=815

 Score =   421 bits (1083),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FESAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  685  YGFSEKVGLLSFPQKDGGFEMSKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL RVLGERPFK+ EPTNYD FK GF ED    ++  AEN    D
Sbjct  745  QIAELLLEKEVLHQDDLTRVLGERPFKALEPTNYDLFKKGF-EDGGDNSQAPAENAELPD  803

Query  247  DDSSPLQPEVVP  212
            D S P+  +VVP
Sbjct  804  DSSPPVG-DVVP  814



>ref|XP_012066998.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Jatropha curcas]
 gb|KDP42240.1| hypothetical protein JCGZ_02970 [Jatropha curcas]
Length=803

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISK ERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  557  FEAAIDRIIGGLEKKNKVISKQERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPNENLLLTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E+++EMSKPYS+KT A+ID EVREW+ KAYE TVQLIEEHKE VA
Sbjct  677  YGFSDKVGLLSFPPREDSYEMSKPYSSKTGALIDGEVREWVGKAYERTVQLIEEHKEQVA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKET  287
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSE TNYDRFK+GF E+++ 
Sbjct  737  QIAELLLEKEVLHQDDLVRVLGERPFKSSEVTNYDRFKEGFKEEEKV  783



>ref|XP_010510537.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Camelina sativa]
Length=809

 Score =   421 bits (1082),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 229/253 (91%), Gaps = 2/253 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  557  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVR+W++KAYE T++L+EEHKE VA
Sbjct  677  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDQEVRDWVSKAYERTLELVEEHKEKVA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLL+KEVLHQ+DL+++LGERPFKS+E TNYDRFK GF ED E ++  T   +   D
Sbjct  737  EIAELLLDKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGF-EDSEKDSAATPRVEPVVD  795

Query  247  DDS-SPLQPEVVP  212
            + +  PL+P+VVP
Sbjct  796  EGAPPPLEPQVVP  808



>ref|XP_012066999.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Jatropha curcas]
Length=798

 Score =   421 bits (1081),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISK ERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  557  FEAAIDRIIGGLEKKNKVISKQERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPNENLLLTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP E+++EMSKPYS+KT A+ID EVREW+ KAYE TVQLIEEHKE VA
Sbjct  677  YGFSDKVGLLSFPPREDSYEMSKPYSSKTGALIDGEVREWVGKAYERTVQLIEEHKEQVA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKET  287
            QIAELLLEKEVLHQ+DLVRVLGERPFKSSE TNYDRFK+GF E+++ 
Sbjct  737  QIAELLLEKEVLHQDDLVRVLGERPFKSSEVTNYDRFKEGFKEEEKV  783



>emb|CDY39531.1| BnaC04g15300D [Brassica napus]
Length=822

 Score =   421 bits (1082),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  571  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  631  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  690

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ +KPYSNKT AIID EVREW+ KAYE TV+LIE HKE VA
Sbjct  691  YGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIETHKEKVA  750

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL++VLGERPFK +E TNYDRFK GF E+++ EA  T       +
Sbjct  751  EIAELLLEKEVLHQDDLLKVLGERPFKPAEVTNYDRFKSGFEENEKEEATPTVA-PVVDE  809

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  810  GAPPPLEPQVVP  821



>ref|NP_850129.1| FTSH protease 3 [Arabidopsis thaliana]
 sp|Q84WU8.1|FTSH3_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=AtFTSH3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22572.1| putative AAA-type ATPase [Arabidopsis thaliana]
 gb|AEC08208.1| FTSH protease 3 [Arabidopsis thaliana]
Length=809

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 222/252 (88%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  557  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA
Sbjct  677  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A          D
Sbjct  737  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDD  796

Query  247  DDSSPLQPEVVP  212
                P +P+VVP
Sbjct  797  GAPPPFEPQVVP  808



>ref|XP_009611240.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=811

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 225/244 (92%), Gaps = 2/244 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHE+GHAV GWFLE+AEPLLKVTIVPRGTAAL
Sbjct  561  FESAIDRVIGGLEKKNKVISKLERRTVAYHEAGHAVVGWFLEYAEPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  621  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FE +KPY +KTAAIID+EVREW+AKAY+ TV+LIEEH+EHVA
Sbjct  681  YGFSDKVGLLSFPQREDTFE-AKPYGSKTAAIIDSEVREWVAKAYDNTVKLIEEHREHVA  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLV+VLG RPFKSSEPTNYDRF  GF E++ +E   + E K+ +D
Sbjct  740  QIAELLLEKEVLHQEDLVQVLGARPFKSSEPTNYDRFTQGF-EEENSETTASTEEKTAED  798

Query  247  DDSS  236
            + SS
Sbjct  799  NGSS  802



>gb|AAC33234.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=807

 Score =   420 bits (1080),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 222/252 (88%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  555  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  614

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  615  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  674

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA
Sbjct  675  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVA  734

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A          D
Sbjct  735  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDD  794

Query  247  DDSSPLQPEVVP  212
                P +P+VVP
Sbjct  795  GAPPPFEPQVVP  806



>ref|XP_009125053.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Brassica rapa]
Length=814

 Score =   421 bits (1081),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  563  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  623  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ +KPYSNKT AIID EVREW+ KAYE TV+LIE HKE VA
Sbjct  683  YGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIETHKEKVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL++VLGERPFK +E TNYDRFK GF E ++ EA  T       +
Sbjct  743  EIAELLLEKEVLHQDDLLKVLGERPFKPAEVTNYDRFKSGFEESEKEEATPTVA-PVVDE  801

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  802  GAPPPLEPQVVP  813



>ref|XP_006655377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Oryza brachyantha]
Length=798

 Score =   420 bits (1079),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 229/252 (91%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  548  FESAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  607

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  608  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  667

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+EVREW+ KAY+ TV+LI +HKE VA
Sbjct  668  YGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDDEVREWVGKAYKNTVELITKHKEQVA  727

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAE+LLEKEVLHQ+DLVRVLGERPFK+ EPTNYD FK GF +D++ + ++  +N    D
Sbjct  728  KIAEMLLEKEVLHQDDLVRVLGERPFKAVEPTNYDLFKQGF-QDEDNKNQEVVKNPQP-D  785

Query  247  DDSSPLQPEVVP  212
            DD +P   EVVP
Sbjct  786  DDGTPSLGEVVP  797



>ref|XP_002313426.1| FtsH protease family protein [Populus trichocarpa]
 gb|EEE87381.1| FtsH protease family protein [Populus trichocarpa]
Length=786

 Score =   419 bits (1078),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 226/252 (90%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DRVIGGLEKKNKVISKLER+TVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  537  FEAAVDRVIGGLEKKNKVISKLERKTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  596

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  597  GFAQYVPNENLLFTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  656

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEM+KPYSN+T AIID+EVREW+ KAY  TVQL+E+HKE VA
Sbjct  657  YGFSDKVGLLSFPQKEDSFEMTKPYSNETGAIIDSEVREWVGKAYGHTVQLVEKHKEQVA  716

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+RVLGERPFKSSE +NYD FK GF E++E + +  A      +
Sbjct  717  QIAELLLEKEVLHQEDLIRVLGERPFKSSEVSNYDIFKQGF-EEEEKKVETPASTTDGDE  775

Query  247  DDSSPLQPEVVP  212
            D SSP+  E VP
Sbjct  776  DQSSPI--EAVP  785



>ref|XP_006306790.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
 gb|EOA39688.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
Length=811

 Score =   420 bits (1079),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 226/252 (90%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  682  YGFSDKIGLLSFPQREDEF--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFK+ E TNYDRFK GF E +E++ K++   K  + 
Sbjct  740  QIAELLLEKEVLHQDDLAKVLGERPFKTGETTNYDRFKSGFEETEESQ-KESVTVKPVEG  798

Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  799  DGVPPLEPQVVP  810



>gb|AAL36270.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=809

 Score =   420 bits (1079),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 221/252 (88%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  557  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAPEQVLIGKISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA
Sbjct  677  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL+++LGERPFKS+E TNYDRFK GF E ++  A          D
Sbjct  737  EIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDD  796

Query  247  DDSSPLQPEVVP  212
                P +P+VVP
Sbjct  797  GAPPPFEPQVVP  808



>emb|CDY47876.1| BnaA07g14210D [Brassica napus]
Length=830

 Score =   420 bits (1080),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 224/252 (89%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  579  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  638

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  639  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  698

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ +KPYSNKT AIID EVREW+ KAYE TV+LIE HKE VA
Sbjct  699  YGFSDKVGLLSFPPRDDGYDFNKPYSNKTGAIIDEEVREWVGKAYEKTVELIETHKEKVA  758

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DL++VLGERPFK +E TNYDRFK GF E ++ EA  T       +
Sbjct  759  EIAELLLEKEVLHQDDLLKVLGERPFKPAEVTNYDRFKSGFEESEKEEATPTVA-PVVDE  817

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  818  GAPPPLEPQVVP  829



>emb|CDP09082.1| unnamed protein product [Coffea canephora]
Length=821

 Score =   419 bits (1078),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 229/252 (91%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F++AIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  571  FDAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  631  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  690

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSF P  + FEM++PY +KTAAIID EVREW+ KAY  TV+LIEEHKE VA
Sbjct  691  YGFSEKVGLLSF-PQRDEFEMTRPYGSKTAAIIDAEVREWVGKAYNRTVELIEEHKERVA  749

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQ+DLV+VLG+RPF+S+E TNYDR+K GF E++  + K   ++++T D
Sbjct  750  KIAELLLEKEVLHQDDLVQVLGKRPFESAEVTNYDRYKQGF-EEEVQKTKQAIDDRTTND  808

Query  247  DDSSPLQPEVVP  212
            D  SPL+PEVVP
Sbjct  809  DGPSPLEPEVVP  820



>ref|XP_010542637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010542639.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
Length=817

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 225/253 (89%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKN+VISKLERRTVAYHE+GHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FEAAIDRVIGGLEKKNRVISKLERRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+K+GLLSFPP E  F+ SKPYSNKT A+ID EVREW++KAYE TV+LI EHKE VA
Sbjct  684  YGFSEKIGLLSFPPREEGFDFSKPYSNKTGAMIDEEVREWVSKAYERTVELIMEHKEQVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            Q+AELLLE+EVLHQ+DLV+VLGERPF+S E TNYDRFK GF E  +  + + + +   +D
Sbjct  744  QVAELLLEREVLHQDDLVKVLGERPFQSMEVTNYDRFKSGFEESDKPASHEGSSSAPVED  803

Query  247  DDSS-PLQPEVVP  212
               + PL+P+VVP
Sbjct  804  SGGAPPLEPQVVP  816



>ref|XP_006409951.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
 gb|ESQ51404.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
Length=813

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  562  FESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  621

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  622  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  681

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ ++ SKPYSNKT AIID EVR+W++KAYE TV+LIEEHKE VA
Sbjct  682  YGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVSKAYEKTVELIEEHKEQVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL++VLGERPFKS+E TNYDRFK GF E  E E   T       +
Sbjct  742  QIAELLLEKEVLHQDDLLKVLGERPFKSAEVTNYDRFKSGFEE-SEKEETTTTVTPVVDE  800

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  801  GAPPPLEPQVVP  812



>ref|XP_009118433.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Brassica rapa]
 emb|CDY06264.1| BnaA09g49390D [Brassica napus]
Length=800

 Score =   418 bits (1075),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 223/252 (88%), Gaps = 5/252 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  553  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  612

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  613  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  672

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E  F  SKPYSN+T A+ID EVREW+AKAY+ TV+LIEEHKE VA
Sbjct  673  YGFSDKIGLLSFPQREEEF--SKPYSNRTGALIDEEVREWVAKAYKRTVELIEEHKEQVA  730

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF   +ET+ ++        D
Sbjct  731  QIAELLLEKEVLHQDDLAKVLGERPFKSGETTNYDRFKSGF---EETDKENVTVKPVEDD  787

Query  247  DDSSPLQPEVVP  212
              S PL+P+VVP
Sbjct  788  GASPPLEPQVVP  799



>ref|XP_007133225.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
 gb|ESW05219.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
Length=811

 Score =   418 bits (1075),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 211/253 (83%), Positives = 234/253 (92%), Gaps = 1/253 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISK+ERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRG+AAL
Sbjct  558  FESAIDRIIGGLEKKNKVISKVERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGSAAL  617

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  618  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLVGKISTGAQNDLEKVTKMTYAQVAV  677

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFPP E++FEMSKPYS+KTAAIID+EVREW+ KAYE TVQLIEEHKE VA
Sbjct  678  YGFSEKVGLLSFPPREDSFEMSKPYSSKTAAIIDSEVREWVNKAYERTVQLIEEHKEQVA  737

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETE-AKDTAENKSTK  251
            QIAELLLEKEVLHQEDL R+LGERPFKS EPTNYDRFK+GF E++E + A+    +   +
Sbjct  738  QIAELLLEKEVLHQEDLHRILGERPFKSIEPTNYDRFKEGFKEEEEEKVAESIIVDVPEQ  797

Query  250  DDDSSPLQPEVVP  212
               SSPL+P+VVP
Sbjct  798  GGGSSPLEPQVVP  810



>ref|NP_172231.2| FTSH protease 10 [Arabidopsis thaliana]
 sp|Q8VZI8.1|FTSHA_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; 
Short=AtFTSH10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36045.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AAM70517.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AEE28137.1| FTSH protease 10 [Arabidopsis thaliana]
Length=813

 Score =   418 bits (1075),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 203/252 (81%), Positives = 225/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  563  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  623  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+  E SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  683  YGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +D
Sbjct  741  QIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVED  800

Query  247  DDSSPLQPEVVP  212
            D   PL+P+VVP
Sbjct  801  DGIPPLEPQVVP  812



>ref|XP_011032280.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
 ref|XP_011042728.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
Length=813

 Score =   417 bits (1071),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/252 (81%), Positives = 225/252 (89%), Gaps = 3/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  564  FEAAVDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  623

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL TKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  624  GFAQYVPNENLLFTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  683

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E++FEM+KPYSN+T AIID EVREW+ KAY  T+QL+E+HKE VA
Sbjct  684  YGFSDKVGLLSFPQKEDSFEMTKPYSNETGAIIDGEVREWVGKAYGHTLQLVEKHKEQVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDL+R+LGERPFKSSE +NYD FK GF E +E + +  A      +
Sbjct  744  QIAELLLEKEVLHQEDLIRILGERPFKSSEASNYDIFKQGFEE-EEEKVETPASTTDGDE  802

Query  247  DDSSPLQPEVVP  212
            D SSP+  EVVP
Sbjct  803  DQSSPI--EVVP  812



>gb|AAK77908.1|AF397903_1 AAA-metalloprotease FtsH [Pisum sativum]
Length=810

 Score =   416 bits (1070),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 226/252 (90%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHE+GHAV GWFLEH +PLLKVTIVPRGTAAL
Sbjct  560  FEAAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVTGWFLEHTDPLLKVTIVPRGTAAL  619

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL TKEQLFDMTCMTLGGRA+E+V++G ISTGAQNDLEKVTKMTYAQVAV
Sbjct  620  GFAQYVPNENLLKTKEQLFDMTCMTLGGRAAEKVLIGTISTGAQNDLEKVTKMTYAQVAV  679

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E++ EM+KPYS+KT AIID EVREW+ KAYE T+QLIEEHK  VA
Sbjct  680  YGFSEKVGLLSFPQREDSMEMTKPYSSKTGAIIDTEVREWVNKAYERTIQLIEEHKAKVA  739

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            +IAELLLEKEVLHQEDL+RVLGERPF+S+EPT+YDRFK GF +  E +  +T  N++  D
Sbjct  740  EIAELLLEKEVLHQEDLLRVLGERPFQSAEPTHYDRFKLGFQD--EEKVVETTVNEAKDD  797

Query  247  DDSSPLQPEVVP  212
              SSPL+PEVVP
Sbjct  798  GGSSPLEPEVVP  809



>ref|XP_002889652.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65911.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score =   416 bits (1068),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/252 (80%), Positives = 224/252 (89%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  563  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  623  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GLLSFP  E+ F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VA
Sbjct  683  YGFSDKIGLLSFPQREDEF--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +D
Sbjct  741  QIAELLLEKEVLHQDDLTKVLGERPFKSGERTNYDRFKSGFEETEKESEKESVPVKPVED  800

Query  247  DDSSPLQPEVVP  212
                PL+P+VVP
Sbjct  801  GGVPPLEPQVVP  812



>ref|XP_008784613.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=817

 Score =   414 bits (1065),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK+GL+SFP  ++AFEMSKPYS+KT AIID EVREW+ KAY+ TV+LI+EHK+H+ 
Sbjct  689  YGFSDKIGLVSFPQRDDAFEMSKPYSSKTGAIIDAEVREWVTKAYQRTVELIKEHKDHIT  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  266
            +IAELLLEKEVLHQ+DLV VLGER FKSSEPTNYDRFK GF E+ E E     E
Sbjct  749  RIAELLLEKEVLHQDDLVGVLGERTFKSSEPTNYDRFKQGFQEEDEREPSKVVE  802



>ref|NP_001044774.1| Os01g0842600 [Oryza sativa Japonica Group]
 sp|Q8S2A7.1|FTSH3_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=OsFTSH3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB86453.1| putative AAA-metalloprotease FtsH [Oryza sativa Japonica Group]
 dbj|BAF06688.1| Os01g0842600 [Oryza sativa Japonica Group]
 gb|EAZ14117.1| hypothetical protein OsJ_04041 [Oryza sativa Japonica Group]
 dbj|BAG94510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=802

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  556  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  615

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPN+NLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  616  GFAQYVPNDNLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  675

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEMSKPYS++TA+IID EVREW+AKAYE TV+LI++HK+ VA
Sbjct  676  YGFSEKVGLLSFPQREDGFEMSKPYSSQTASIIDTEVREWVAKAYEKTVELIKQHKDQVA  735

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            QIAELLLEKEVLHQ+DLV+VLGERPFK+ EPTNYDRFK GF
Sbjct  736  QIAELLLEKEVLHQDDLVQVLGERPFKTLEPTNYDRFKQGF  776



>gb|EAY76461.1| hypothetical protein OsI_04395 [Oryza sativa Indica Group]
Length=802

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/221 (88%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  556  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  615

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPN+NLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  616  GFAQYVPNDNLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  675

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEMSKPYS++TA+IID EVREW+AKAYE TV+LI++HK+ VA
Sbjct  676  YGFSEKVGLLSFPQREDGFEMSKPYSSQTASIIDTEVREWVAKAYEKTVELIKQHKDQVA  735

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            QIAELLLEKEVLHQ+DLV+VLGERPFK+ EPTNYDRFK GF
Sbjct  736  QIAELLLEKEVLHQDDLVQVLGERPFKTLEPTNYDRFKQGF  776



>ref|XP_006845226.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Amborella trichopoda]
 gb|ERN06901.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
Length=825

 Score =   413 bits (1061),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/252 (79%), Positives = 222/252 (88%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRG+AAL
Sbjct  574  FEAAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGSAAL  633

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQ++LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  634  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQILLGKISTGAQNDLEKVTKMTYAQVAV  693

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E AFEM+KPYSN T  IID EVR+W++ AY+ T++LIEE +E VA
Sbjct  694  YGFSDKVGLLSFPQREEAFEMTKPYSNGTGEIIDKEVRDWVSNAYKRTLELIEEKREQVA  753

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            ++AELLLEKEVLHQ+DL++VLGERP+KSSEPTNYDRF  GF E++E E  D        +
Sbjct  754  KVAELLLEKEVLHQDDLLKVLGERPYKSSEPTNYDRFTKGFQEEQE-EKSDAPSEGVVME  812

Query  247  DDSSPLQPEVVP  212
            DD+  L   VVP
Sbjct  813  DDTPSLDGAVVP  824



>dbj|BAJ98147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03446.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93081.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score =   412 bits (1058),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/251 (79%), Positives = 223/251 (89%), Gaps = 1/251 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  559  FESAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  619  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYSN+TA+IID EVREW+AKAY+ TV L+ E KE VA
Sbjct  679  YGFSDKVGLLSFPQREDGFEMNKPYSNQTASIIDTEVREWVAKAYKRTVDLLTEKKEQVA  738

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
             IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D+E +  +  ++    D
Sbjct  739  LIAELLLEKEVLHQDDLTRVLGDRPFKAAELTNYDLFKQGF-QDEEGKTAEPTKDTEVPD  797

Query  247  DDSSPLQPEVV  215
            DD S + P VV
Sbjct  798  DDGSAVLPNVV  808



>ref|XP_006644995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Oryza brachyantha]
Length=807

 Score =   411 bits (1057),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 191/238 (80%), Positives = 220/238 (92%), Gaps = 0/238 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHA+PLLKVTIVPRGTAAL
Sbjct  561  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHADPLLKVTIVPRGTAAL  620

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPN+NLLMTKEQLFDMTCMTLGGRA+E+V++ KISTGAQNDLEKVTKMTYAQVA+
Sbjct  621  GFAQYVPNDNLLMTKEQLFDMTCMTLGGRAAEEVLIRKISTGAQNDLEKVTKMTYAQVAI  680

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ FEMS+PYS++TA+IID EVREW+AKAYE TV+LI++HK+ VA
Sbjct  681  YGFSEKVGLLSFPQREDGFEMSRPYSSQTASIIDTEVREWVAKAYETTVELIKKHKDQVA  740

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKST  254
            QIAELLLEKEV+HQ+DLVR+LGERPFK+ EPTNYDRFK GF ++  + + + ++   T
Sbjct  741  QIAELLLEKEVIHQDDLVRILGERPFKTLEPTNYDRFKQGFEDEGSSNSAEVSDVDGT  798



>gb|KJB16965.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=782

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 205/217 (94%), Gaps = 0/217 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FEGAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD+TCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPNENLLMTKEQLFDVTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDK GLLSFP    AFEM+ PYS+ T AIID+EVREW+ KAY+ TVQLIEEHKEHVA
Sbjct  685  YGFSDKAGLLSFPRTHYAFEMTMPYSSTTGAIIDSEVREWVGKAYDRTVQLIEEHKEHVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            QI ELLLEK++LHQEDLVRVLGERPFKSSEPTNYDRF
Sbjct  745  QITELLLEKDILHQEDLVRVLGERPFKSSEPTNYDRF  781



>ref|XP_004970544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Setaria italica]
Length=810

 Score =   410 bits (1053),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLER+TVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FEAAIDRVIGGLEKKNKVISKLERQTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  625  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ F MSKPY  +TA+IID EVREW+AKAYE T+ LI+ HKE VA
Sbjct  685  YGFSEKVGLLSFPQREDGFGMSKPYGGETASIIDTEVREWVAKAYEKTLDLIKTHKEQVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF-VEDKETEAKDTAENKST  254
            QIAELLLEKEVLHQ+DLVRVLGERPFK++EPTNYDRFK GF VE+ +  A+ +  N S+
Sbjct  745  QIAELLLEKEVLHQDDLVRVLGERPFKTAEPTNYDRFKQGFQVEESDKSAEVSDANPSS  803



>gb|EMT04659.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=703

 Score =   406 bits (1044),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 224/254 (88%), Gaps = 3/254 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  450  FESAIDRIIGGLEKKNKVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  509

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  510  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  569

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYSN+TA+IID EVREW+AKAY+ TV L+ E KE VA
Sbjct  570  YGFSDKVGLLSFPQREDGFEMNKPYSNQTASIIDTEVREWVAKAYKRTVDLLTEKKEQVA  629

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
             IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D+E +  + A+     D
Sbjct  630  LIAELLLEKEVLHQDDLTRVLGDRPFKAAELTNYDLFKQGF-QDEEGKTTEPAKPAEVPD  688

Query  247  DD--SSPLQPEVVP  212
            DD  ++ L   VVP
Sbjct  689  DDGPAAALPDVVVP  702



>gb|EMS50561.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=748

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 197/254 (78%), Positives = 226/254 (89%), Gaps = 3/254 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEK+NKVISKLERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  495  FESAIDRIIGGLEKRNKVISKLERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAAL  554

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  555  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAV  614

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP   + FEM+KPYSN+TA+IID EVREW+AKAY+ TV+L+ E KE VA
Sbjct  615  YGFSDKVGLLSFPQRGDGFEMNKPYSNQTASIIDTEVREWVAKAYKRTVELLTEKKEQVA  674

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
             IAELLLEKEVLHQ+DL RVLG+RPFK++E TNYD FK GF +D++++  + A+N    D
Sbjct  675  LIAELLLEKEVLHQDDLTRVLGDRPFKAAELTNYDLFKQGF-QDEDSKTTEPAKNAEVPD  733

Query  247  DD--SSPLQPEVVP  212
            DD  ++ L   VVP
Sbjct  734  DDGPAAALPDVVVP  747



>ref|XP_008799731.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=820

 Score =   408 bits (1049),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 223/252 (88%), Gaps = 1/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  569  FEAAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  628

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLL+TKEQLFDMTC TLGGRASE+V+LGKISTGAQ+DLEKVTKMTYAQVAV
Sbjct  629  GFAQYVPNENLLLTKEQLFDMTCRTLGGRASEEVLLGKISTGAQDDLEKVTKMTYAQVAV  688

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  ++   M  PYS+KTAAIID EVREW++KAY+ TV+LI+EH +HV 
Sbjct  689  YGFSDKVGLLSFPQRDDTSAMIMPYSSKTAAIIDAEVREWVSKAYQRTVELIKEHTDHVI  748

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVL Q+DLVRVLGERPFK  EPTNYDRFK GF E+ + E ++ ++    +D
Sbjct  749  QIAELLLEKEVLRQDDLVRVLGERPFKLGEPTNYDRFKQGFQEEVDDEGREPSKVME-ED  807

Query  247  DDSSPLQPEVVP  212
            D SS L  EVVP
Sbjct  808  DRSSSLSGEVVP  819



>ref|XP_007132051.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
 gb|ESW04045.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
Length=809

 Score =   406 bits (1043),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 200/252 (79%), Positives = 231/252 (92%), Gaps = 0/252 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKNKVISK+ER TVAYHESGHAVAGWFLEHAEPLLKVTIVPRG+AAL
Sbjct  557  FESAIDRIIGGLEKKNKVISKVERHTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGSAAL  616

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAV
Sbjct  617  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAV  676

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E++FEMSKPYS+KTAA+ID+EVR+W+ KAYE T+ LIEEHKE VA
Sbjct  677  YGFSEKVGLLSFPSREDSFEMSKPYSSKTAALIDSEVRDWVNKAYERTLHLIEEHKEQVA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            Q+A+LLLEKEVLHQEDL  +LGERPFK++EPTNYDRFK+GF E++E  A+ +  +   + 
Sbjct  737  QLAQLLLEKEVLHQEDLRGILGERPFKATEPTNYDRFKEGFEEEEEKVAESSIVDVPEEG  796

Query  247  DDSSPLQPEVVP  212
              SSPL+P+VVP
Sbjct  797  GGSSPLEPQVVP  808



>ref|XP_003606687.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES88884.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=807

 Score =   405 bits (1041),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 221/252 (88%), Gaps = 4/252 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISK ERRTVAYHE+GHAVAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  559  FEAAIDRIIGGLEKKNRVISKRERRTVAYHEAGHAVAGWFLEHCEPLLKVTIVPRGTAAL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLL TKEQL DMTCMTLGGRA+EQV++G ISTGAQNDLEKVTKMTYAQVA+
Sbjct  619  GFAQYVPSENLLRTKEQLLDMTCMTLGGRAAEQVLIGAISTGAQNDLEKVTKMTYAQVAI  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP NE+ F   KPYS  T  IID EVR+W+  AYE TVQLIEEHKE +A
Sbjct  679  YGFSEKVGLLSFPQNEDQF--GKPYSGDTGNIIDQEVRDWVNHAYERTVQLIEEHKEKLA  736

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQEDLVR+LGERPFKS+EPTNYDRFK GF +  E +A +T  +++ + 
Sbjct  737  QIAELLLEKEVLHQEDLVRILGERPFKSAEPTNYDRFKLGFQD--EEKAAETTVDEAEEG  794

Query  247  DDSSPLQPEVVP  212
              SSPL+PEVVP
Sbjct  795  SGSSPLEPEVVP  806



>gb|EYU38460.1| hypothetical protein MIMGU_mgv1a001496mg [Erythranthe guttata]
Length=808

 Score =   405 bits (1041),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 218/253 (86%), Gaps = 15/253 (6%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDR+IGGLEKKNKVISKLERRTVAYHESGHAV GW LEHA+PLLKVTIVPRGTAAL
Sbjct  571  FDSAIDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWLLEHADPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  631  GFAQYVPSENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  690

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+ +EM KPYS+KTAAIID EVREW AKAY+ TV+LIEEHKE VA
Sbjct  691  YGFSEKVGLLSFPQREDGYEMMKPYSSKTAAIIDTEVREWAAKAYKRTVELIEEHKEQVA  750

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKE LHQEDLV+VLG RPF+SSE TNYDR+K GF ++   EA           
Sbjct  751  QIAELLLEKETLHQEDLVQVLGPRPFQSSEMTNYDRYKKGFQDEAAEEAV----------  800

Query  247  DDSSPLQPEVVPV  209
                 + PEVVPV
Sbjct  801  -----VLPEVVPV  808



>gb|AAF79577.1|AC022464_35 F22G5.10 [Arabidopsis thaliana]
Length=843

 Score =   406 bits (1043),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 203/274 (74%), Positives = 225/274 (82%), Gaps = 24/274 (9%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+SAIDRVIGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  571  FDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  630

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASE----------------------QVMLGK  674
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E                      QV++G+
Sbjct  631  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQLVGRQFVELFPLTEVKNSLRFQVLIGR  690

Query  673  ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVR  494
            ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+  E SKPYSN+T A+ID EVR
Sbjct  691  ISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVR  748

Query  493  EWIAKAYECTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK  314
            EW+ KAY+ TV+LIEEHKE VAQIAELLLEKEVLHQ+DL +VLGERPFKS E TNYDRFK
Sbjct  749  EWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFK  808

Query  313  DGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  212
             GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  809  SGFEESEKESQKESVPVKPVEDDGIPPLEPQVVP  842



>ref|XP_002458748.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
 gb|EES03868.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
Length=808

 Score =   404 bits (1039),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 215/234 (92%), Gaps = 5/234 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  566  FEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  625

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPN++LLMTKEQLFDMTCMTLGGRA+E++++GKISTGAQNDLEKVT+MTYAQVAV
Sbjct  626  GFAQYVPNDSLLMTKEQLFDMTCMTLGGRAAEEILIGKISTGAQNDLEKVTQMTYAQVAV  685

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FEMSKPYS+ TA+IID EVREW+AKAY+ TV LI+ HKE VA
Sbjct  686  YGFSEKVGLLSFP--QKGFEMSKPYSSHTASIIDTEVREWVAKAYQRTVDLIKTHKEQVA  743

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF---VEDKETEAKD  275
            QIAELLLEKEVLH +DLVRVLGERPFK++EPTNYDRFK GF   V DK +E  D
Sbjct  744  QIAELLLEKEVLHHDDLVRVLGERPFKTAEPTNYDRFKQGFQAEVVDKSSEVAD  797



>gb|KCW85527.1| hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis]
Length=799

 Score =   402 bits (1032),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 224/253 (89%), Gaps = 6/253 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN VISKLERRTVAYHESGHAVAGWFLEH EPLLKVTIVPRGTA L
Sbjct  551  FEAAIDRIIGGLEKKNLVISKLERRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTANL  610

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNE+LL+TKEQLFD TCM LGGRA+EQV+LGKI+TGA++DLE VTK TYAQVAV
Sbjct  611  GFAQYVPNEDLLVTKEQLFDRTCMALGGRAAEQVLLGKITTGARSDLEGVTKATYAQVAV  670

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP     +EM+KPYS+KTAAIID+EVREW+ KAYE T++LI EHKEHVA
Sbjct  671  YGFSDKVGLLSFP---QGYEMTKPYSSKTAAIIDSEVREWVTKAYEHTLELITEHKEHVA  727

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLH EDL+RVLGERPFKSSE TNYDR+K GF+E  E ++ +T+E    +D
Sbjct  728  QIAELLLEKEVLHHEDLLRVLGERPFKSSEVTNYDRYKLGFLE--EEKSAETSETDVVED  785

Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  786  DESPPPLDPQVVP  798



>ref|XP_010043510.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=813

 Score =   401 bits (1031),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 224/253 (89%), Gaps = 6/253 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN VISKLERRTVAYHESGHAVAGWFLEH EPLLKVTIVPRGTA L
Sbjct  565  FEAAIDRIIGGLEKKNLVISKLERRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTANL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNE+LL+TKEQLFD TCM LGGRA+EQV+LGKI+TGA++DLE VTK TYAQVAV
Sbjct  625  GFAQYVPNEDLLVTKEQLFDRTCMALGGRAAEQVLLGKITTGARSDLEGVTKATYAQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP     +EM+KPYS+KTAAIID+EVREW+ KAYE T++LI EHKEHVA
Sbjct  685  YGFSDKVGLLSFP---QGYEMTKPYSSKTAAIIDSEVREWVTKAYEHTLELITEHKEHVA  741

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLH EDL+RVLGERPFKSSE TNYDR+K GF+E  E ++ +T+E    +D
Sbjct  742  QIAELLLEKEVLHHEDLLRVLGERPFKSSEVTNYDRYKLGFLE--EEKSAETSETDVVED  799

Query  247  DDS-SPLQPEVVP  212
            D+S  PL P+VVP
Sbjct  800  DESPPPLDPQVVP  812



>gb|EPS71434.1| hypothetical protein M569_03325, partial [Genlisea aurea]
Length=778

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/221 (86%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F SAIDR+IGGLEKKNKVIS+LERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  556  FNSAIDRIIGGLEKKNKVISRLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  615

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+EQV+LGKISTGAQNDLEKVT+MTYAQVAV
Sbjct  616  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTRMTYAQVAV  675

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+ FEM+KPYSNKTAAIID EVREWIA+AYE T+ LIEE +E VA
Sbjct  676  YGFSDKVGLLSFPQREDGFEMTKPYSNKTAAIIDGEVREWIARAYEKTLSLIEERREEVA  735

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            ++AELLL KE LHQEDLV+ LGERPF+ +E +NYD FK GF
Sbjct  736  KVAELLLAKETLHQEDLVQALGERPFRPAETSNYDIFKHGF  776



>ref|NP_001145329.1| uncharacterized protein LOC100278654 [Zea mays]
 gb|ACG46821.1| hypothetical protein [Zea mays]
Length=485

 Score =   388 bits (997),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/214 (86%), Positives = 202/214 (94%), Gaps = 1/214 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDR+IGGLEKKN+VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  224  FESAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  283

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  284  GFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAV  343

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  FE+SKPYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA
Sbjct  344  YGFSEKVGLLSFPQKDGGFELSKPYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVA  403

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKS-SEPTN  329
            QIAELLLEKEVLHQ+DL RVLGERPFK+  +PT 
Sbjct  404  QIAELLLEKEVLHQDDLTRVLGERPFKALDQPTT  437



>ref|XP_008358519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=800

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKLERRTVAYHESGHAV GWFLEHAEPLLKVTIVPRGTAAL
Sbjct  563  FEAAIDRIIGGLEKKNRVISKLERRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAAL  622

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYV NENLLMTKEQLFDMTCMTLGGRA+EQVMLGKIST AQNDLEKVTKMTYAQ+AV
Sbjct  623  GFAQYVLNENLLMTKEQLFDMTCMTLGGRAAEQVMLGKISTVAQNDLEKVTKMTYAQIAV  682

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            +GF+DKVGLLSFP  E +FEMSKPYS+KT A+ID+EVREW+ KAY  TV+L+EEHKE VA
Sbjct  683  HGFNDKVGLLSFPQREESFEMSKPYSSKTGALIDSEVREWVGKAYARTVELVEEHKEQVA  742

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            QIAELLLEKEVLHQ+DL++VLG RP+K +E TNYDRFK+GF
Sbjct  743  QIAELLLEKEVLHQDDLLKVLGGRPYKPAEATNYDRFKEGF  783



>gb|KJB36698.1| hypothetical protein B456_006G171800 [Gossypium raimondii]
Length=617

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 217/253 (86%), Gaps = 16/253 (6%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRG A L
Sbjct  379  FEAAVDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGIATL  438

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQL D+ CMTLGGRA++QV+L KISTGAQ+DL+KVTKMTYAQVAV
Sbjct  439  GFAQYVPNENLLMTKEQLSDVACMTLGGRAAKQVLLRKISTGAQSDLKKVTKMTYAQVAV  498

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLS  P  +AFEM+KPYS+KT AIID+EVREW+ KAYE T+QLIEEHKEHVA
Sbjct  499  YGFSDKVGLLSV-PQRDAFEMTKPYSSKTGAIIDSEVREWVVKAYEPTMQLIEEHKEHVA  557

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTA-ENKSTK  251
                         QEDL+R+LG+RPFKSSEPTNY+RFK GF E+ + E KDT  E ++  
Sbjct  558  -------------QEDLIRILGKRPFKSSEPTNYERFKQGFQEENK-EPKDTKDEGRTAG  603

Query  250  DDDSSPLQPEVVP  212
            DD S+PL+PEVVP
Sbjct  604  DDGSTPLKPEVVP  616



>ref|XP_004507174.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=800

 Score =   394 bits (1011),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 215/252 (85%), Gaps = 11/252 (4%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN VISK+ERRTVAYHE+GHAV GWFLEH EPLLKVTIVPRGTAAL
Sbjct  559  FEAAIDRIIGGLEKKNLVISKVERRTVAYHEAGHAVVGWFLEHTEPLLKVTIVPRGTAAL  618

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLLMTKE LFD TCMTLGGRA+E++++G I+TGAQNDLEKVTKMTY QVAV
Sbjct  619  GFAQYLPNENLLMTKEHLFDRTCMTLGGRAAEEILIGTITTGAQNDLEKVTKMTYDQVAV  678

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFP  E+++ M+KPYS+KT AIID EVREW+ KAYE T+QLIE+HKE VA
Sbjct  679  YGFSDKVGLLSFPQREDSYGMAKPYSSKTGAIIDTEVREWVNKAYEHTLQLIEKHKEQVA  738

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            QIAELLLEKEVLHQ+DL +VLGERPFK++E +NYDRFK GF ED +              
Sbjct  739  QIAELLLEKEVLHQDDLRQVLGERPFKNAELSNYDRFKLGFQEDDKEGG-----------  787

Query  247  DDSSPLQPEVVP  212
              SSPL PEVVP
Sbjct  788  GSSSPLDPEVVP  799



>emb|CDM84966.1| unnamed protein product [Triticum aestivum]
Length=760

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  517  FESAIDRVIGGLEKKNTVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  576

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQ FD TCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTY QVAV
Sbjct  577  GFAQYVPSENLLMTKEQFFDRTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYQQVAV  636

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  ++ F M KPYS +TA++ID EVRE +AKAY  T +LI +HK+ VA
Sbjct  637  YGFSEKVGLLSFPQRDDGFWMDKPYSGQTASMIDTEVRELVAKAYNTTTELIRKHKDKVA  696

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKS  257
            Q+AELLLEKEVLHQ+DL+RVLGERPFK+ EPTNYDRFK GF++ +++++ +   + S
Sbjct  697  QVAELLLEKEVLHQDDLIRVLGERPFKTDEPTNYDRFKQGFMDSEDSKSGEVDPSSS  753



>ref|XP_001785268.1| predicted protein [Physcomitrella patens]
 gb|EDQ49920.1| predicted protein [Physcomitrella patens]
Length=693

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 213/252 (85%), Gaps = 2/252 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKK +VISK ERRTVAYHE+GHAV+GWFLEHAEPLLKV+IVPRGTAAL
Sbjct  428  FEAAIDRIIGGLEKKKRVISKEERRTVAYHEAGHAVSGWFLEHAEPLLKVSIVPRGTAAL  487

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLLMTKEQL DMTCMTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAV
Sbjct  488  GFAQYLPNENLLMTKEQLLDMTCMTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAV  547

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSFPP ++ FEMSKPYSN+T  IID EVR+W+A AY  T+ LI EHK  V 
Sbjct  548  YGFSDKVGLLSFPPKDDGFEMSKPYSNETGEIIDQEVRDWVASAYARTLALITEHKAGVE  607

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
             +A  LLEKEVLHQEDLV +LGERPFK++E +NYD+FK GF   +E +AK  +   S  +
Sbjct  608  ALALKLLEKEVLHQEDLVAILGERPFKNAELSNYDKFKLGFAPSREDQAKLGSSQPS--E  665

Query  247  DDSSPLQPEVVP  212
            D  SP QP   P
Sbjct  666  DGISPEQPSSTP  677



>gb|EMS48627.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=808

 Score =   391 bits (1004),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/252 (77%), Positives = 215/252 (85%), Gaps = 9/252 (4%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  565  FESAIDRVIGGLEKKNTVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  624

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQ FD TCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTY QVAV
Sbjct  625  GFAQYVPSENLLMTKEQFFDRTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYEQVAV  684

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP   + F M KPYS +TA++ID EVRE +AKAY  T +LI +HK+ VA
Sbjct  685  YGFSEKVGLLSFPQRYDGFGMDKPYSGQTASMIDTEVRELVAKAYNTTTELIRKHKDKVA  744

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            Q+AELLLEKEVLHQ+DLVRVLGERPFK  EPTNYDRFK GF+        D+ ++KS + 
Sbjct  745  QVAELLLEKEVLHQDDLVRVLGERPFKPDEPTNYDRFKQGFM--------DSEDSKSAEV  796

Query  247  DDSSPLQPEVVP  212
            D SS +  E VP
Sbjct  797  DPSSSVG-EAVP  807



>gb|EMT07840.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=953

 Score =   393 bits (1009),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKN VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL
Sbjct  579  FESAIDRVIGGLEKKNTVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  638

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVP+ENLLMTKEQ FD TCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTY QVAV
Sbjct  639  GFAQYVPSENLLMTKEQFFDRTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYEQVAV  698

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP   + F M KPYS +TA++ID EVRE +AKAY  T +LI +HK+ VA
Sbjct  699  YGFSEKVGLLSFPQRYDGFGMDKPYSGQTASMIDTEVRELVAKAYNTTTELIRKHKDKVA  758

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKET  287
            Q+AELLLEKEVLHQ+DLVRVLGERPFK++EPTNYDRFK GF++ +++
Sbjct  759  QVAELLLEKEVLHQDDLVRVLGERPFKTAEPTNYDRFKQGFMDSEDS  805



>emb|CDY09913.1| BnaC08g45380D [Brassica napus]
Length=767

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 208/243 (86%), Gaps = 5/243 (2%)
 Frame = -2

Query  943  IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPN  764
            I  + K   VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPN
Sbjct  528  IANVRKIEHVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPN  587

Query  763  ENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVG  584
            ENLLMTKEQLFDMTCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+G
Sbjct  588  ENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIG  647

Query  583  LLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLE  404
            LLSFP  E   E SKPYSN+T A+ID EVREW+AKAY+ TV+LIEEHKE VA+IAELLLE
Sbjct  648  LLSFPQREE--EFSKPYSNRTGALIDEEVREWVAKAYKRTVELIEEHKEQVAEIAELLLE  705

Query  403  KEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQP  224
            KEVLHQ+DL +VLGERPFKS E TNYDRFK GF   +ET+ ++        D  S PL+P
Sbjct  706  KEVLHQDDLAKVLGERPFKSGETTNYDRFKSGF---EETDKENVTVKPVEDDGASPPLEP  762

Query  223  EVV  215
            +VV
Sbjct  763  QVV  765



>ref|XP_003567261.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brachypodium distachyon]
Length=635

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/244 (75%), Positives = 210/244 (86%), Gaps = 9/244 (4%)
 Frame = -2

Query  943  IGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPN  764
            +G    +N VISK+ER TVAYHESGHAVAGWFLEHAE LLKVTIVPRGTAALGFAQYV N
Sbjct  400  VGPSRVRNLVISKMERLTVAYHESGHAVAGWFLEHAELLLKVTIVPRGTAALGFAQYVQN  459

Query  763  ENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVG  584
            +NLLMTKEQLFDMTCMTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVA+YGFS+KVG
Sbjct  460  DNLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVALYGFSEKVG  519

Query  583  LLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLE  404
            LLSFP  ++ FEM+KPYS++TA+IID EVREW+A+AY+ T++LI++HKE VAQIAELLLE
Sbjct  520  LLSFPQRDDGFEMNKPYSSQTASIIDTEVREWVAEAYKHTIELIKKHKEQVAQIAELLLE  579

Query  403  KEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQP  224
            KEVLHQ+DLVRVLGERPFK+ EP NYDRFK GF+        D   NKST+ D SS L  
Sbjct  580  KEVLHQDDLVRVLGERPFKTVEPINYDRFKHGFI--------DADNNKSTEVDPSSSLG-  630

Query  223  EVVP  212
            E VP
Sbjct  631  EAVP  634



>ref|XP_011623752.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial [Amborella trichopoda]
Length=491

 Score =   367 bits (942),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+V+ KLERRTVAYHE+GHAVAGWFLE+AEPL KVTIV RGTAAL
Sbjct  264  FEAAIDRIIGGLEKKNRVMRKLERRTVAYHEAGHAVAGWFLEYAEPLFKVTIVRRGTAAL  323

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLLMTKEQLFD+TCMTLGGRASEQ++LGKISTGAQ+DLEK TKMTYAQVAV
Sbjct  324  GFAQYIPNENLLMTKEQLFDITCMTLGGRASEQILLGKISTGAQDDLEKETKMTYAQVAV  383

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  +  +E +KPYSN+T  IID EVR+WI KAY+ T++LIEE +  V 
Sbjct  384  YGFSEKVGLLSFPQKDEGYERTKPYSNRTEEIIDKEVRDWITKAYDRTLELIEEKRGQVV  443

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
            +IAELLL+KEVLH+ DL+++LGERPF SSEPTNYD F  GF ++++
Sbjct  444  KIAELLLQKEVLHKHDLLKMLGERPFMSSEPTNYDPFTKGFQDEQQ  489



>gb|KEH23850.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=701

 Score =   373 bits (958),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISKL+RRTVAYHE+GHAVAGWFLEH +PLLKVTIVPRGT+AL
Sbjct  479  FEAAIDRIIGGLEKKNRVISKLQRRTVAYHEAGHAVAGWFLEHTDPLLKVTIVPRGTSAL  538

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNENLLMTKEQLFD TCMTLGGRA+EQV++G ISTGAQ+DLEKVTKMTYAQVAV
Sbjct  539  GFAQYVPNENLLMTKEQLFDRTCMTLGGRAAEQVLIGTISTGAQDDLEKVTKMTYAQVAV  598

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E++ EMSKPYSNKT AIIDNEVREW+ KAYE TVQLIE+ KE VA
Sbjct  599  YGFSEKVGLLSFPQKEDSLEMSKPYSNKTGAIIDNEVREWVDKAYERTVQLIEKQKEKVA  658

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSE  338
            Q+AELLLEKEVLHQ+DL+ +LG RPFKS+E
Sbjct  659  QLAELLLEKEVLHQDDLLPILGVRPFKSTE  688



>ref|XP_001782950.1| predicted protein [Physcomitrella patens]
 gb|EDQ52248.1| predicted protein [Physcomitrella patens]
Length=872

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 201/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISK ERRTVAYHE+GHAV GWFLE+AEPLLKV+IVPRGTAAL
Sbjct  607  FEAAIDRIIGGLEKKNRVISKEERRTVAYHEAGHAVTGWFLEYAEPLLKVSIVPRGTAAL  666

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLLMTKEQL DMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  667  GFAQYLPNENLLMTKEQLLDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  726

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFPP ++  EMSKPYSN+T  IID E R+W+A AYE T+ LI  HKE V 
Sbjct  727  YGFSEKVGLLSFPPKDDGLEMSKPYSNETGEIIDKEARDWVALAYERTLALITRHKEGVE  786

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAK  278
             +A  LLEKEVLHQEDLV +LGERPFK +E +NYD+FK GF   ++ + K
Sbjct  787  ALALKLLEKEVLHQEDLVAILGERPFKHAELSNYDKFKLGFPSSRDDQVK  836



>ref|XP_001759881.1| predicted protein [Physcomitrella patens]
 gb|EDQ75385.1| predicted protein [Physcomitrella patens]
Length=670

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 198/230 (86%), Gaps = 0/230 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKK +VISK ERRTVAYHE+GHAV GWFLE+AEPLLKV+IVPRGTAAL
Sbjct  405  FEAAIDRIIGGLEKKKRVISKEERRTVAYHEAGHAVTGWFLEYAEPLLKVSIVPRGTAAL  464

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLLMTKEQL DMTCMTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAV
Sbjct  465  GFAQYLPNENLLMTKEQLLDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAV  524

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFPP ++  EMSKPYSN+T  IID EVR+W+  AY  T+ LI +HK  V 
Sbjct  525  YGFSEKVGLLSFPPKDDGLEMSKPYSNETGEIIDQEVRDWMGTAYARTLALITKHKAGVE  584

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAK  278
             +A  LLEKEVLHQEDLV +LG RPF  SE +NYD+FK GF   KE +AK
Sbjct  585  ALALRLLEKEVLHQEDLVAILGPRPFHHSELSNYDKFKLGFEPSKEDQAK  634



>gb|AES75793.2| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=681

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 207/233 (89%), Gaps = 5/233 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISK +RRTVAYHE+GH VAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  436  FEAAIDRIIGGLEKKNKVISKKDRRTVAYHEAGHVVAGWFLEHTEPLLKVTIVPRGTAAL  495

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQ+VPN++ LMTKEQLFD TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQV V
Sbjct  496  GFAQFVPNDDHLMTKEQLFDRTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVTV  555

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E++FE SKPYS++T+AIIDNEVR+W+ KAY+ T++LIEE+K  VA
Sbjct  556  YGFSEKVGLLSFPSIEDSFETSKPYSSETSAIIDNEVRDWVKKAYKHTIELIEEYKGKVA  615

Query  427  QIAELLLEKEVLHQEDLVRVLGER-PFKSSEPTNYDRFKDGFVEDKETEAKDT  272
            ++AELLLEKEVLHQ++L++VLG R PFKS+E  NYD+ K G     + EAKD 
Sbjct  616  EVAELLLEKEVLHQDELLKVLGVRLPFKSAEHDNYDQIKLGI----QDEAKDV  664



>ref|XP_003624038.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES80256.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=643

 Score =   358 bits (919),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 193/212 (91%), Gaps = 2/212 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKN+VISK ERRT+AYHE+GHAV GWFLEH EPLLKVTIVPRGTAAL
Sbjct  431  FEAAIDRIIGGLEKKNRVISKQERRTIAYHEAGHAVVGWFLEHTEPLLKVTIVPRGTAAL  490

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYV NENLLMTKEQLFD TCMTLGGRA+EQV++G ISTGAQNDLEKVTKMTYAQVA+
Sbjct  491  GFAQYVSNENLLMTKEQLFDRTCMTLGGRAAEQVLIGTISTGAQNDLEKVTKMTYAQVAI  550

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E++ E SKPYS+KT AIIDNEVREW+ KAY+ T+QLIEE K  VA
Sbjct  551  YGFSEKVGLLSFPQREDSSETSKPYSSKTGAIIDNEVREWVNKAYKHTIQLIEERKGKVA  610

Query  427  QIAELLLEKEVLHQEDLVRVLGER--PFKSSE  338
            +IAELLLEKEVLHQ+DL++VLG R  PFKS+E
Sbjct  611  EIAELLLEKEVLHQDDLLQVLGPRPSPFKSAE  642



>ref|XP_003619575.1| Cell division protease ftsH-like protein [Medicago truncatula]
Length=765

 Score =   361 bits (927),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 207/233 (89%), Gaps = 5/233 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISK +RRTVAYHE+GH VAGWFLEH EPLLKVTIVPRGTAAL
Sbjct  466  FEAAIDRIIGGLEKKNKVISKKDRRTVAYHEAGHVVAGWFLEHTEPLLKVTIVPRGTAAL  525

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQ+VPN++ LMTKEQLFD TCMTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQV V
Sbjct  526  GFAQFVPNDDHLMTKEQLFDRTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVTV  585

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E++FE SKPYS++T+AIIDNEVR+W+ KAY+ T++LIEE+K  VA
Sbjct  586  YGFSEKVGLLSFPSIEDSFETSKPYSSETSAIIDNEVRDWVKKAYKHTIELIEEYKGKVA  645

Query  427  QIAELLLEKEVLHQEDLVRVLGER-PFKSSEPTNYDRFKDGFVEDKETEAKDT  272
            ++AELLLEKEVLHQ++L++VLG R PFKS+E  NYD+ K G     + EAKD 
Sbjct  646  EVAELLLEKEVLHQDELLKVLGVRLPFKSAEHDNYDQIKLGI----QDEAKDV  694



>gb|ERN06910.1| hypothetical protein AMTR_s00005p00257870 [Amborella trichopoda]
Length=369

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  919  KVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKE  740
            KV+ KLERRTVAYHE+GHAVAGWFLE+AEPL KVTIV RGTAALGFAQY+PNENLLMTKE
Sbjct  158  KVMRKLERRTVAYHEAGHAVAGWFLEYAEPLFKVTIVRRGTAALGFAQYIPNENLLMTKE  217

Query  739  QLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNE  560
            QLFD+TCMTLGGRASEQ++LGKISTGAQ+DLEK TKMTYAQVAVYGFS+KVGLLSFP  +
Sbjct  218  QLFDITCMTLGGRASEQILLGKISTGAQDDLEKETKMTYAQVAVYGFSEKVGLLSFPQKD  277

Query  559  NAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKEVLHQED  380
              +E +KPYSN+T  IID EVR+WI KAY+ T++LIEE +  V +IAELLL+KEVLH+ D
Sbjct  278  EGYERTKPYSNRTEEIIDKEVRDWITKAYDRTLELIEEKRGQVVKIAELLLQKEVLHKHD  337

Query  379  LVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
            L+++LGERPF SSEPTNYD F  GF ++++
Sbjct  338  LLKMLGERPFMSSEPTNYDPFTKGFQDEQQ  367



>ref|XP_002981661.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
 gb|EFJ17143.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
Length=737

 Score =   348 bits (894),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRV+GG+EKKNKVIS  ERRTVAYHE+GHAVAGWFLEHAEPL+KV+IVPRG+AAL
Sbjct  482  FEAAIDRVLGGMEKKNKVISPEERRTVAYHEAGHAVAGWFLEHAEPLIKVSIVPRGSAAL  541

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY PNENLLMTKEQ+ DMTCM LGGRA+EQVMLGKISTGAQNDLE+VT++TYAQVAV
Sbjct  542  GFAQYFPNENLLMTKEQMLDMTCMALGGRAAEQVMLGKISTGAQNDLERVTRLTYAQVAV  601

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+  E+SKPYSN+T  +ID EVREW  +AY+ TV L+EEHKE + 
Sbjct  602  YGFSEKVGLLSFPQKEDGMELSKPYSNETGELIDREVREWTDRAYKRTVALLEEHKEGLE  661

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            ++A+ LL +EVLH  DLV VLG RPFK++E    DR +  F
Sbjct  662  KLAQQLLAREVLHYNDLVEVLGPRPFKTAESGQLDRIRQRF  702



>ref|XP_002967857.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
 gb|EFJ31204.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
Length=828

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRV+GG+EKKNKVIS  ERRTVAYHE+GHAVAGWFLEHAEPL+KV+IVPRG+AAL
Sbjct  573  FEAAIDRVLGGMEKKNKVISPEERRTVAYHEAGHAVAGWFLEHAEPLIKVSIVPRGSAAL  632

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY PNENLLMTKEQ+ DMTCM LGGRA+EQVMLGKISTGAQNDLE+VT++TYAQVAV
Sbjct  633  GFAQYFPNENLLMTKEQMLDMTCMALGGRAAEQVMLGKISTGAQNDLERVTRLTYAQVAV  692

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFP  E+  E+SKPYSN+T  +ID EVREW  +AY+ TV L+EEHKE + 
Sbjct  693  YGFSEKVGLLSFPQKEDGMELSKPYSNETGELIDREVREWTDRAYKRTVALLEEHKEGLE  752

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
            ++A+ LL +EVLH  DLV VLG RPFK++E    DR +  F
Sbjct  753  KLAQQLLAREVLHYNDLVEVLGPRPFKTAESGQLDRIRQRF  793



>ref|XP_002980658.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
 gb|EFJ18309.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
Length=453

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 187/231 (81%), Gaps = 4/231 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
             E+ +DRVI G+E+KN+V+SK ERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRG+AAL
Sbjct  222  LEAGVDRVIAGIERKNRVVSKDERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGSAAL  281

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNE+LLMTK+Q  D+ CM LGGRA+E+V+LG+I+TGAQNDLEKVT M YAQVA 
Sbjct  282  GFAQYVPNEDLLMTKQQFNDIICMALGGRAAEEVLLGRITTGAQNDLEKVTLMAYAQVAE  341

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGL+SF P ++  E+ KP+SN T+ ++D E R  +  AY  T  LI++H++ VA
Sbjct  342  YGFSDKVGLVSF-PRKSQTELLKPFSNNTSKLMDEEARAIVNDAYARTRALIDKHRDGVA  400

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKD  275
            +IAELLLEKEVL QEDL+ VLGERPF      NYD ++ GF   K+ EA D
Sbjct  401  KIAELLLEKEVLRQEDLLAVLGERPFAQGSRNNYDIYRHGF---KQEEAND  448



>ref|XP_002984562.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
 gb|EFJ14207.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
Length=453

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 187/231 (81%), Gaps = 4/231 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
             E+ +DRVI G+E+KN+V+SK ERRTVAYHE+GHAVAGWFLEHAEPLLKVTIVPRG+AAL
Sbjct  222  LEAGVDRVIAGIERKNRVVSKDERRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGSAAL  281

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNE+LLMTK+Q  D+ CM LGGRA+E+V+LG+I+TGAQNDLEKVT M YAQVA 
Sbjct  282  GFAQYVPNEDLLMTKQQFNDIICMALGGRAAEEVLLGRITTGAQNDLEKVTLMAYAQVAE  341

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGL+SF P ++  E+ KP+SN T+ ++D E R  ++ AY  T  LI++H++ VA
Sbjct  342  YGFSDKVGLVSF-PRKSQTELLKPFSNNTSKLMDEEARAIVSDAYARTRALIDKHRDGVA  400

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKD  275
            +IAELLLEKEVL QEDL+ VLGERPF      NYD ++ GF   K  EA D
Sbjct  401  KIAELLLEKEVLRQEDLLAVLGERPFAQGSRNNYDIYRHGF---KPEEAND  448



>ref|XP_005651157.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26613.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
Length=712

 Score =   324 bits (830),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 189/226 (84%), Gaps = 2/226 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A DRVIGGLEKKNKVIS +ER+TVA+HE+GHAV  WFLE+AEPLLKV+IVPRGTAAL
Sbjct  446  FEAATDRVIGGLEKKNKVISVVERKTVAFHEAGHAVVAWFLEYAEPLLKVSIVPRGTAAL  505

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLLMT EQ+ DMTCM LGGRA+EQ+MLGKISTGAQNDLE+VTKM YAQVA+
Sbjct  506  GFAQYLPNENLLMTMEQMRDMTCMALGGRAAEQIMLGKISTGAQNDLERVTKMAYAQVAI  565

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVGL+SFP  +  F  SKPYS++TA +ID EVRE +  AYE T++L+ E K+ V 
Sbjct  566  YGMNKKVGLVSFPAEDGQF--SKPYSDETAQLIDKEVREMVNDAYERTLELLTEKKDLVE  623

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
            ++A  LLEKEV++ EDL  +LGERP++S+E  N D+F+DGF +  E
Sbjct  624  KLALTLLEKEVVNSEDLTEILGERPYRSAELRNIDKFRDGFAKKIE  669



>ref|XP_002505472.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66730.1| predicted protein [Micromonas sp. RCC299]
Length=680

 Score =   318 bits (814),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 5/240 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESA DRVI GLEKKNKV++K+ER TVAYHE+GHAV GWFLEHAEPLLKV+IVPRG+AAL
Sbjct  416  FESAADRVIAGLEKKNKVVNKVERNTVAYHEAGHAVVGWFLEHAEPLLKVSIVPRGSAAL  475

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLL T +QL DM CMTLGGRA+E+VMLGKISTGAQNDLEKVTKM Y +VAV
Sbjct  476  GFAQYLPNENLLATTQQLTDMMCMTLGGRAAEEVMLGKISTGAQNDLEKVTKMAYNRVAV  535

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG+LSFP ++  F+  KPYS  TA +ID EVRE + +AY+ TV L++E KE V 
Sbjct  536  YGMNEKVGMLSFPSDDQQFQ--KPYSQDTARMIDEEVRELVDQAYKRTVALVKEKKEAVE  593

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
             +A+ LLE+EVL + DLV++LG+RPFK     N D   +GF   K  E K TAE+ + +D
Sbjct  594  ALAQGLLEREVLQRHDLVKILGDRPFKYEGQQNIDILNEGF---KMPELKTTAEDDAKED  650



>ref|XP_001422694.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01011.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=476

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 189/258 (73%), Gaps = 12/258 (5%)
 Frame = -2

Query  976  WTIFESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGT  797
             T FE A DRVI GLEKK+KV++K ERRTVAYHE+GHAV GWFLEHAEPLLKV+IVPRG+
Sbjct  221  LTHFEYAADRVIAGLEKKSKVVNKTERRTVAYHEAGHAVVGWFLEHAEPLLKVSIVPRGS  280

Query  796  AALGFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQ  617
            AALGFAQY+PNENLL T +QL DM CMTLGGRA+EQVMLGKISTGAQNDLEKVT+M Y  
Sbjct  281  AALGFAQYLPNENLLATTQQLIDMMCMTLGGRAAEQVMLGKISTGAQNDLEKVTQMAYNT  340

Query  616  VAVYGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKE  437
            VAVYG ++K+GLLSFP +E +  +  PYS  TA +ID EVR  +  AY+ T+ L++E K 
Sbjct  341  VAVYGMNEKIGLLSFPKDEQS--LKSPYSEDTARMIDEEVRLLVDTAYKRTLALVKEKKH  398

Query  436  HVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF-------VEDKETEAK  278
             V  +A+ LL+KEVL + DLV++LG+RPF S  P N D   +GF           E E  
Sbjct  399  LVEAMAQGLLDKEVLQRHDLVKLLGDRPFVSENPQNIDILNEGFKMHYPKTATAPEDEPA  458

Query  277  DTAENKSTKDDDSSPLQP  224
            DT E    +DD+ SP  P
Sbjct  459  DTDE---PEDDEPSPAFP  473



>ref|XP_003082962.1| FtsH protease, putative (ISS) [Ostreococcus tauri]
 emb|CAL56917.1| Peptidase M41, FtsH extracellular [Ostreococcus tauri]
Length=809

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE A DRVI GLEKK+KV++K ERRTVAYHE+GHAV GWFLEHAEPLLKV+IVPRG+AAL
Sbjct  555  FEYAADRVIAGLEKKSKVVNKTERRTVAYHEAGHAVVGWFLEHAEPLLKVSIVPRGSAAL  614

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLL T +QL DM CMTLGGRA+EQVMLGKISTGAQNDLEKVT+M Y  VAV
Sbjct  615  GFAQYLPNENLLATTQQLVDMMCMTLGGRAAEQVMLGKISTGAQNDLEKVTQMAYNTVAV  674

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++K+GLLSFP +E +  +  PYS  TA +ID EVR  + KAY+ TV L+EE K  V 
Sbjct  675  YGMNEKIGLLSFPKDEQS--LKSPYSEDTARMIDEEVRLLVDKAYQRTVALVEEKKHLVE  732

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
             +A  LL+KEVL + DLV++LGERPF S  P N D   +GF
Sbjct  733  AMARGLLDKEVLQRHDLVQLLGERPFVSENPQNIDILNEGF  773



>gb|ERN06906.1| hypothetical protein AMTR_s00005p00257390 [Amborella trichopoda]
Length=504

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 184/239 (77%), Gaps = 13/239 (5%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AID +IGGLEKKNKV+ KLE RTVAYHE+GH VAGWFLE+AEPLLKVTI PRGTAAL
Sbjct  264  FEAAIDWIIGGLEKKNKVMRKLECRTVAYHEAGHGVAGWFLEYAEPLLKVTIAPRGTAAL  323

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLG---KISTGAQNDLEKVTKMTYAQ  617
            GFAQY+PNENLLMTKEQLFD+TCMTLGGRASE  +      +  G +N +   + + Y  
Sbjct  324  GFAQYIPNENLLMTKEQLFDITCMTLGGRASELSLHPADLALLYGKENIIIIGSLIYYMY  383

Query  616  VAVYG----------FSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYEC  467
            +  +G           S+KVGLLSFP  +  +E ++PYSN+T  IID EVR+W+ KAY+ 
Sbjct  384  IFCWGRSRLGLRMTWRSEKVGLLSFPQKDEGYERTQPYSNRTEEIIDKEVRDWVTKAYDR  443

Query  466  TVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  290
            T++LIEE +E V +IAELLLE+EVLH+ DL++VLGERPFKSSEPTNYD F  GF E+++
Sbjct  444  TLELIEEKREQVVKIAELLLEREVLHKHDLLKVLGERPFKSSEPTNYDPFTKGFQEEQQ  502



>ref|XP_007509883.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18998.1| predicted protein [Bathycoccus prasinos]
Length=922

 Score =   309 bits (792),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 190/264 (72%), Gaps = 15/264 (6%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE A+DRVI GLEKK KVIS++ER TVAYHE+GHAV GWF+EHAEPLLKV+IVPRG+AAL
Sbjct  662  FERAVDRVIAGLEKKEKVISRVERETVAYHEAGHAVVGWFMEHAEPLLKVSIVPRGSAAL  721

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNEN+L T EQL DM CMTLGGRA+E VMLGKISTGAQNDLEKVTKM Y   AV
Sbjct  722  GFAQYLPNENVLATTEQLSDMMCMTLGGRAAEDVMLGKISTGAQNDLEKVTKMAYNMTAV  781

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + K+GLLSFP  +N F+   PYS  TA +ID EVRE + KAY  TV L+ E K  V 
Sbjct  782  YGLNQKIGLLSFPKGDNDFK--SPYSEDTARMIDEEVRELVDKAYLRTVALVREKKAVVE  839

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDK-----ETEAKDTAEN  263
             +A  LL+KEVL + DLV+VLGERPFK     N D    GF ++K      + ++D A N
Sbjct  840  SLARALLDKEVLQRHDLVKVLGERPFKYEGQQNIDILNQGFRDEKLLPKTPSSSEDAATN  899

Query  262  KSTKD------DDSSPLQPEVVPV  209
             + +D      D S P+ P  +PV
Sbjct  900  DNDEDSKKEDGDASIPVTP--IPV  921



>ref|XP_003631103.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AET05579.1| peptidase family M41 protein [Medicago truncatula]
Length=406

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 176/220 (80%), Gaps = 17/220 (8%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDR+IGGLEKKNKVISK  RRTVAYHE+GHAVAGWFLEH  P LKVTIVPRGTAAL
Sbjct  127  FEAAIDRIIGGLEKKNKVISKQHRRTVAYHEAGHAVAGWFLEHTNPFLKVTIVPRGTAAL  186

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQYVPNEN LMT+                  V++G ISTGAQ+DLEKVTKM YAQVAV
Sbjct  187  GFAQYVPNENHLMTR-----------------AVLIGTISTGAQDDLEKVTKMIYAQVAV  229

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFS+KVGLLSFPP+E++FE SKPYS+KT+AIIDNEVR+ + KAY+ T+QLIEE+K  +A
Sbjct  230  YGFSEKVGLLSFPPSEDSFETSKPYSSKTSAIIDNEVRDRVNKAYKHTIQLIEEYKGKLA  289

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IA+LLLEKEVLHQ+DL++VLG +     E  + +   DG
Sbjct  290  EIAKLLLEKEVLHQDDLLQVLGFKLGLQDEAEDVEIIVDG  329



>ref|XP_011400128.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM27161.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
protothecoides]
Length=1210

 Score =   313 bits (801),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 180/220 (82%), Gaps = 2/220 (1%)
 Frame = -2

Query  967   FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
             FE+A+DRVIGGLEKKNKVIS  ERRTVAYHE+GHAV GWFL HAEPLLKV+IVPRG+AAL
Sbjct  992   FEAAVDRVIGGLEKKNKVISGEERRTVAYHEAGHAVVGWFLRHAEPLLKVSIVPRGSAAL  1051

Query  787   GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
             GFAQY+PNENLL T EQ+ DM  M LGGRA+EQVMLG+ISTGAQNDLE+VTKM YAQVAV
Sbjct  1052  GFAQYLPNENLLATGEQMADMMAMALGGRAAEQVMLGRISTGAQNDLERVTKMAYAQVAV  1111

Query  607   YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
             YG +D VGL+SFP  E AF  +KPYS+ TA +ID EVR  +A AY  T+ L+EE +  V 
Sbjct  1112  YGMNDAVGLVSFPQEEGAF--NKPYSDDTARLIDGEVRALVAGAYRRTLALLEEKRGAVE  1169

Query  427   QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
              +A+ LLE+EVL  E+L  +LGERP++S+E  N D+F+DG
Sbjct  1170  AMAQALLEREVLGTEELEALLGERPYRSAELRNIDKFRDG  1209



>ref|XP_003059742.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55694.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=651

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE A DRVI GLEKKNKV++K+ER TVAYHE+GHAV GW LEHAEPLLKV+IVPRG+AAL
Sbjct  428  FEQAADRVIAGLEKKNKVVNKVERNTVAYHEAGHAVVGWMLEHAEPLLKVSIVPRGSAAL  487

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+PNENLL T +QL DM CMTLGGRA+E+VMLGKISTGAQNDLEKVTKM Y +VAV
Sbjct  488  GFAQYLPNENLLATTQQLTDMMCMTLGGRAAEEVMLGKISTGAQNDLEKVTKMAYNRVAV  547

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG+LSFP ++  F+  KPYS  TA +ID EVR  +A AY+ T+ LI + +  V 
Sbjct  548  YGMNEKVGMLSFPSDDQQFQ--KPYSQDTAKLIDEEVRLLVANAYQRTLDLITKERSKVE  605

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGF  305
             +A+ LLEKEVL + DLV VLG RPF      N D   +GF
Sbjct  606  ALAQALLEKEVLQRHDLVTVLGARPFAYDGQQNIDILNEGF  646



>gb|KEH16019.1| ATP-dependent zinc metalloprotease FTSH protein, partial [Medicago 
truncatula]
Length=553

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 170/206 (83%), Gaps = 16/206 (8%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKN  +                + GWFLEH EPLLKVTIVPRGT  L
Sbjct  239  FEAAIDRVIGGLEKKNMAM---------------LLWGWFLEHTEPLLKVTIVPRGTETL  283

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            GFAQY+ NENLLMTKEQLFD TCM LGGRA+EQV++G ISTGAQ+DLEKVTKMTYAQVAV
Sbjct  284  GFAQYLSNENLLMTKEQLFDRTCMALGGRAAEQVLIGTISTGAQDDLEKVTKMTYAQVAV  343

Query  607  YGFSDKVGLLSFPPN-ENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YGFS++VGLLSFP + E++FEMSKPYS++T AIID EVREW+ KA++ T+QLIEEHK  V
Sbjct  344  YGFSEQVGLLSFPHHKEDSFEMSKPYSSETGAIIDKEVREWVNKAFKHTIQLIEEHKGKV  403

Query  430  AQIAELLLEKEVLHQEDLVRVLGERP  353
            A+IAELLLEKEVL+Q+DL++VL + P
Sbjct  404  AEIAELLLEKEVLYQDDLLQVLEKLP  429



>ref|XP_001689949.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP09687.1| membrane AAA-metalloprotease, partial [Chlamydomonas reinhardtii]
Length=752

 Score =   291 bits (744),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 181/233 (78%), Gaps = 15/233 (6%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+AIDRVIGGLEKKNKVIS  ERRTVAYHESGHAV  WFL++AEPLLKV+IVPRGTA L
Sbjct  522  FEAAIDRVIGGLEKKNKVISSEERRTVAYHESGHAVVSWFLQYAEPLLKVSIVPRGTATL  581

Query  787  GFAQYVPNENLLMTK-------------EQLFDMTCMTLGGRASEQVMLGKISTGAQNDL  647
            GFAQY+PNE++L+TK             EQL D  C TLGGRA+EQVMLGKISTGA NDL
Sbjct  582  GFAQYLPNESVLLTKARHGGGREPGGMGEQLLDRVCATLGGRAAEQVMLGKISTGAVNDL  641

Query  646  EKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYEC  467
            E++T+M Y+QVAVYG ++KVGL+SF  + +AF+  KPYS+ TA +ID EVR +I +AY  
Sbjct  642  ERITQMAYSQVAVYGMNEKVGLVSFRMDRDAFD--KPYSDTTAQLIDEEVRSFIDEAYRR  699

Query  466  TVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            T+ L+E+H+  +  + + LL KEVL+ +D+ R+LG+RPF S+E  N DRF+ G
Sbjct  700  TLGLVEQHRGLIEAMTQELLHKEVLNLDDVERLLGKRPFVSAELRNIDRFRHG  752



>gb|KHG19679.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Gossypium 
arboreum]
Length=404

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 154/189 (81%), Gaps = 24/189 (13%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE+A+DRVIGGLEKKNKVISKLE +TVAYHESGHAVAG                      
Sbjct  229  FEAAVDRVIGGLEKKNKVISKLESQTVAYHESGHAVAG----------------------  266

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
             FAQYVPNENLLMTKEQL D+TCMTLGGR ++QV+L KISTGAQ+DL+KVTKMTY QVAV
Sbjct  267  -FAQYVPNENLLMTKEQLSDVTCMTLGGRDAKQVLLRKISTGAQSDLKKVTKMTYTQVAV  325

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YGFSDKVGLLSF P  +AFEM+KPYS+KT AIID+EVR+W+ KAYE T+QLIEEHKEHV 
Sbjct  326  YGFSDKVGLLSF-PQRDAFEMTKPYSSKTGAIIDSEVRKWVVKAYERTMQLIEEHKEHVT  384

Query  427  QIAELLLEK  401
            Q+AELLLEK
Sbjct  385  QVAELLLEK  393



>ref|WP_041883641.1| peptidase M41 [Pedobacter sp. NL19]
 gb|KIO76076.1| peptidase M41 [Pedobacter sp. NL19]
Length=697

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 176/246 (72%), Gaps = 2/246 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  446  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  505

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +
Sbjct  506  GYAQYLPKEQFLYTTEQLTDGMCMTMGGRVAEDLVFGKISTGAQNDLERITKLSYAMVTI  565

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +  +G +SF   +N +  +KPYS KT+ +ID EVR  I + YE T+QL+ E +E + 
Sbjct  566  YGMNTTIGNVSFHDPQNEYNFNKPYSEKTSELIDIEVRTLINQVYERTMQLLIEKREGLE  625

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            ++AE LLEKE+L Q DL  +LG+RPF +   T YD F +G  + K        E      
Sbjct  626  KLAEKLLEKEILFQADLEEILGKRPFDNR--TTYDEFVNGTGDQKPAAEGLLHEGVGETT  683

Query  247  DDSSPL  230
            D SSPL
Sbjct  684  DPSSPL  689



>ref|XP_005850885.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
 gb|EFN58783.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
Length=751

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = -2

Query  916  VISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQ  737
            VIS  ERRTVAYHE+GHAV GWFL+HAEPLLKV+IVPRG+AALGFAQY+PNEN+LMT EQ
Sbjct  456  VISVEERRTVAYHEAGHAVTGWFLQHAEPLLKVSIVPRGSAALGFAQYLPNENVLMTTEQ  515

Query  736  LFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNEN  557
            L DM  M LGGRA+EQVMLG+ISTGAQNDLE+VTKM Y+QVA+YG + KVGLLSFPP E 
Sbjct  516  LNDMMAMALGGRAAEQVMLGRISTGAQNDLERVTKMAYSQVAIYGMNPKVGLLSFPPEEG  575

Query  556  AFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKEVLHQEDL  377
              +++KPYS+ TA IID EVR  +  AY+ TVQL+EE K  V  +A+ LL+KEVL  E+L
Sbjct  576  --QLNKPYSDDTARIIDGEVRSLVDLAYQRTVQLLEEKKHLVEGMAQALLKKEVLGTEEL  633

Query  376  VRVLGERPFKSSEPTNYDRFK  314
              +LG RP++S+E  N D+ K
Sbjct  634  EALLGARPYRSAELRNIDKLK  654



>ref|XP_003292084.1| hypothetical protein DICPUDRAFT_39991 [Dictyostelium purpureum]
 gb|EGC31386.1| hypothetical protein DICPUDRAFT_39991 [Dictyostelium purpureum]
Length=514

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F++AIDR+IGGLEKKNKV+S  E++TVAYHE+GHAV  WFL+H  PLLKV+IVPRG AAL
Sbjct  281  FDAAIDRIIGGLEKKNKVLSPQEKKTVAYHEAGHAVVSWFLKHCHPLLKVSIVPRGVAAL  340

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L  KEQ+FDM CM LGGR +EQ+  G I+TGAQ+DL+K+TKM Y+Q+++
Sbjct  341  GYAQYLPKEQFLQNKEQIFDMMCMALGGRVAEQLTFGTITTGAQDDLQKITKMAYSQISI  400

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG LSFP  +N+ ++++PYS +TA ++D EVR+ +  AY+ T +L+ EHK+ + 
Sbjct  401  YGMNEKVGPLSFPRRDNS-DLTRPYSEETAELVDEEVRKLLKAAYDRTKELLIEHKDGLE  459

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSE  338
             +A+LLLEKEV+H E++  VLG+RPF+ ++
Sbjct  460  SVAKLLLEKEVIHYEEVENVLGKRPFEKTK  489



>ref|WP_037443193.1| peptidase M41 [Sphingobacterium antarcticum]
 gb|KEQ28898.1| peptidase M41 [Sphingobacterium antarcticus 4BY]
Length=696

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 178/248 (72%), Gaps = 2/248 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  446  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  505

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +
Sbjct  506  GYAQYLPKEQFLYTTEQLTDGMCMTMGGRVAEDLVFGKISTGAQNDLERITKLSYAMVTI  565

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +  +G +SF   +N +  +KPYS KT+ +ID EVR+ ++  YE T+QL+ + +E + 
Sbjct  566  YGMNSTIGNVSFHDPQNEYNFNKPYSEKTSELIDIEVRKLVSGVYERTMQLLTDQREGLE  625

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            ++AE LLEKE+L Q DL  +LG+RPF++   T YD F +G  + K        E      
Sbjct  626  KLAEKLLEKEILFQTDLEEILGKRPFENR--TTYDEFVNGTGDQKPAAEGLLHEGVGETT  683

Query  247  DDSSPLQP  224
              S+P+ P
Sbjct  684  APSAPVAP  691



>ref|WP_026897433.1| peptidase M41 [Pedobacter oryzae]
Length=696

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 180/243 (74%), Gaps = 3/243 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  447  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  506

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMTLGGR +E ++ GKISTGAQNDLE++TK++YA V +
Sbjct  507  GYAQYLPKEQFLYTTEQLLDGMCMTLGGRVAEDIVFGKISTGAQNDLERITKLSYAMVTI  566

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +++VG +SF   +  ++ +KPYS KT+ IID EVRE I ++Y+ T  L+ E ++ + 
Sbjct  567  YGMNERVGNVSFNDTQGEYQFNKPYSEKTSEIIDIEVREQIDRSYQRTKALLTEKRDGLE  626

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            ++A  LLEKE+L Q DL  +LG+RPF +   T YD F +G V +   E ++  E++   D
Sbjct  627  KLAHKLLEKEILFQSDLEEILGKRPFDNR--TTYDEFVNG-VPEVGNEVRENLEHEGVID  683

Query  247  DDS  239
             ++
Sbjct  684  HNA  686



>dbj|GAM28243.1| hypothetical protein SAMD00019534_114190 [Acytostelium subglobosum 
LB1]
Length=838

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F++AIDRVIGGLEKKNKV+S  E++TVAYHE+GHAV  WFLEH  PLLKV+IVPRG AAL
Sbjct  593  FDAAIDRVIGGLEKKNKVLSPQEKKTVAYHEAGHAVVSWFLEHCNPLLKVSIVPRGVAAL  652

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L TKEQ+FD  CM LGGR +EQ+  G I+TGAQ+DLEK+TKM Y+QV +
Sbjct  653  GYAQYMPKEEFLNTKEQIFDKMCMALGGRVAEQMTFGTITTGAQDDLEKITKMAYSQVGI  712

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +DKVG LS+P  +++ +++KPYS +TA I+D EVR  + +AY+ T ++++EHKE + 
Sbjct  713  YGMNDKVGPLSYPRKDSS-DLTKPYSEETAEIMDQEVRILLQRAYDKTTEVLKEHKEGLE  771

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEP  335
             +A LLL KEV+H ED+ ++LG RPF   EP
Sbjct  772  AVAALLLSKEVIHAEDIEKILGPRPFGIPEP  802



>ref|XP_638674.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL65313.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
Length=764

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F++A+DRVIGGLEKKNKV+S  E+RTVAYHE+GHAV  WFL+H  PLLKV+IVPRG AAL
Sbjct  537  FDAAVDRVIGGLEKKNKVLSPTEKRTVAYHEAGHAVVSWFLKHCHPLLKVSIVPRGVAAL  596

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L  +EQ+FDM CM LGGR +EQ+  G I+TGAQ+DLEK+TKM Y+QV++
Sbjct  597  GYAQYLPKEQFLQNQEQIFDMMCMALGGRVAEQLTFGTITTGAQDDLEKITKMAYSQVSI  656

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++K+G LS+   ++  +++KPYS +TA ++D EVR+ +  AY+ T Q+++EH+E + 
Sbjct  657  YGMNEKIGPLSYQKGQDGSDLTKPYSEETAEVMDEEVRKLLKSAYDRTTQVLQEHREGLI  716

Query  427  QIAELLLEKEVLHQEDLVRVLGERPF--KSSEPTNYD  323
             +A LLLEKEV+H E++  VLG RPF  K+ EP N +
Sbjct  717  SVANLLLEKEVIHFEEVEAVLGPRPFNNKTEEPKNIN  753



>ref|WP_013664355.1| peptidase M41 [Sphingobacterium sp. 21]
 gb|ADZ77627.1| ATP-dependent metalloprotease FtsH [Sphingobacterium sp. 21]
Length=707

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 167/220 (76%), Gaps = 3/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  449  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  508

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  GKISTGAQNDLE++TK+ YA VAV
Sbjct  509  GYAQYLPKEQFLYTTEQLIDGMCMTMGGRVAEDLTFGKISTGAQNDLERITKLAYAMVAV  568

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG +SF  ++ + +  KPYS KTA +ID EVR+ I+  YE T QL+ E  + + 
Sbjct  569  YGMNNKVGNISFNDSQES-QFQKPYSEKTAELIDEEVRKLISDVYEKTRQLLSEKSDGLK  627

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             +AE LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  628  ALAEKLLEKEILFQSDLEEILGKRPFDNR--TTYDEFVNG  665



>ref|WP_008241678.1| peptidase M41 [Pedobacter sp. BAL39]
 gb|EDM36319.1| cell division protein, ATP-dependent metalloprotease [Pedobacter 
sp. BAL39]
Length=697

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 168/220 (76%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  447  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  506

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMTLGGR +E +  GKISTGAQNDLE++TK++YA V +
Sbjct  507  GYAQYLPKEQFLYTTEQLTDGMCMTLGGRVAEDITFGKISTGAQNDLERITKLSYAMVTI  566

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +  +G +SF   +N +  +KPYS KT+ +ID EVR+ I +AYE T QL+ + +E + 
Sbjct  567  YGMNSTIGNVSFHDPQNEYNFNKPYSEKTSEMIDVEVRKLIEEAYEKTKQLLLDKREGLE  626

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            ++A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  627  KLAQKLLEKEILFQADLEEILGKRPFDNR--TTYDEFVNG  664



>ref|WP_037533932.1| peptidase M41 [Sphingobacterium thalpophilum]
Length=695

 Score =   273 bits (699),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 167/220 (76%), Gaps = 3/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  441  FQDAVDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  500

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++T+++YA +A+
Sbjct  501  GYAQYLPREQFLYTTEQLIDSLCMTMGGRVAEDITFGRISTGAQNDLERITQLSYAMIAI  560

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +DKVG +SF  +  A    KPYS+KTA +ID EVR  I   Y  T QL+ E +E + 
Sbjct  561  YGMNDKVGNVSFRDSSEA-SFQKPYSDKTAELIDAEVRNLINDVYARTKQLLLEKREGLI  619

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF++   T YD F +G
Sbjct  620  KIAEKLLEKEILFQSDLEEILGKRPFETK--TTYDEFVNG  657



>ref|WP_012780210.1| peptidase M41 [Pedobacter heparinus]
 gb|ACU02256.1| ATP-dependent metalloprotease FtsH [Pedobacter heparinus DSM 
2366]
Length=696

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 176/248 (71%), Gaps = 2/248 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  446  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  505

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +
Sbjct  506  GYAQYLPKEQFLYTTEQLTDGMCMTMGGRVAEDIVFGKISTGAQNDLERITKLAYAMVTI  565

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +  +G +SF   +N +  +KPYS KT+ +IDNEVR  I++ Y  T  L+ + +E + 
Sbjct  566  YGMNSTIGNVSFHDPQNEYNFNKPYSEKTSEMIDNEVRILISEVYTRTKSLLTDKREGLE  625

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  248
            ++A+ L+EKE+L Q DL  +LG+RPF +   T YD F +G  + K        +  S   
Sbjct  626  KLAQKLIEKEILFQADLEEILGKRPFDNR--TTYDEFVNGTGDQKPAAEGLLHDGVSQPA  683

Query  247  DDSSPLQP  224
            D ++P+ P
Sbjct  684  DPATPITP  691



>ref|WP_039053642.1| peptidase M41, partial [Sphingobacterium sp. T2]
Length=652

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 168/220 (76%), Gaps = 3/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  436  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  495

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VAV
Sbjct  496  GYAQYLPKEQFLYTTEQLIDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAV  555

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG +SF  +  + +  KPYS +TA +ID EVR+ IA  Y+ T +L+ E +E + 
Sbjct  556  YGMNEKVGNVSFNDSSES-QFHKPYSERTAELIDEEVRQLIANVYKRTKELLLEKQEGLI  614

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF  S  T YD F +G
Sbjct  615  KIAEKLLEKEILFQSDLEEILGKRPF--SHRTTYDEFVNG  652



>gb|EQB80316.1| hypothetical protein L950_08340 [Sphingobacterium sp. IITKGP-BTPF85]
Length=601

 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  349  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  408

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+
Sbjct  409  GYAQYLPREQFLYTTEQLVDSLCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAI  468

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +DKVG +SF      F   KPYS+KTA +ID+EVR  I   Y  T QL+ + +E + 
Sbjct  469  YGMNDKVGNVSFRDGSEQFH--KPYSDKTAELIDSEVRNLITDVYARTKQLLLDKQEGLV  526

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             IAE LLEKE+L Q DL  +LG+RPF +   T YD F
Sbjct  527  AIAEKLLEKEILFQSDLEEILGKRPFDTK--TTYDEF  561



>ref|WP_014682322.1| peptidase M41 [Solitalea canadensis]
 gb|AFD09100.1| ATP-dependent metalloprotease FtsH [Solitalea canadensis DSM 
3403]
Length=692

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  445  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  504

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +
Sbjct  505  GYAQYLPKEQYLYTTEQLTDGMCMTMGGRVAEDIIFGKISTGAQNDLERITKLAYAMVTI  564

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG +SF   +N +  SKPYS KT+ +ID+EVR+ I   Y  T  L+ E +  + 
Sbjct  565  YGMNEKVGNVSFNDQQNEYGFSKPYSEKTSELIDHEVRDLINNIYARTKDLLTEKRSGLE  624

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             +A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  625  ALAQKLLEKEILFQSDLEEILGKRPFDTR--TTYDEFVNG  662



>dbj|BAF01982.1| hypothetical protein [Arabidopsis thaliana]
Length=173

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = -2

Query  733  FDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENA  554
            F+MTCMTLGGRA+EQV++G+ISTGAQNDLEKVTK+TYAQVAVYGFSDK+GLLSFP  E+ 
Sbjct  1    FNMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKLTYAQVAVYGFSDKIGLLSFPQREDE  60

Query  553  FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKEVLHQEDLV  374
            F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEKEVLHQ+DL 
Sbjct  61   F--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLT  118

Query  373  RVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  212
            +VLGERPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  119  KVLGERPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVEDDGIPPLEPQVVP  172



>gb|EFA84387.1| peptidase M41 [Polysphondylium pallidum PN500]
Length=803

 Score =   273 bits (699),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F++AIDRVIGGLEKKNKV+S  E++TVAYHE+GHAV  WFLEH  PLLKV+IVPRG AAL
Sbjct  572  FDAAIDRVIGGLEKKNKVLSPQEKKTVAYHEAGHAVVSWFLEHCNPLLKVSIVPRGVAAL  631

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L TKEQ+FD  CM LGGR +EQ++ G I+TGAQ+DLEK+TKM Y+QV +
Sbjct  632  GYAQYLPKEEFLNTKEQIFDKMCMALGGRVAEQLVFGTITTGAQDDLEKITKMAYSQVGL  691

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG LS+P  +++ +++KPYS++TA IID EVR  +  AY  T +++E HKE + 
Sbjct  692  YGMNEKVGPLSYPRKDSS-DLTKPYSDETAEIIDQEVRLLLQSAYNKTQEVLEAHKEGLE  750

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSS  341
            ++A LLLEKEV+H ED+ ++LG RPF ++
Sbjct  751  KVALLLLEKEVIHAEDIEQILGPRPFANT  779



>ref|WP_021069372.1| peptidase M41 [Sphingobacterium paucimobilis]
 gb|ERJ57782.1| peptidase M41 [Sphingobacterium paucimobilis HER1398]
 gb|ERJ60233.1| peptidase M41 [Sphingobacterium paucimobilis HER1398]
Length=692

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  439  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  498

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  499  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  558

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF  +    +  KPYS++TA +ID EVR  +A  YE T QL+ + ++ + 
Sbjct  559  YGMNHKVGNVSFRDSSGESQFQKPYSDQTAELIDEEVRVLVAAVYERTRQLLLDKQDGLI  618

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF  S  T YD F +G
Sbjct  619  RIAEKLLEKEILFQADLEEILGKRPF--SNRTTYDEFVNG  656



>ref|WP_010600005.1| peptidase M41 [Pedobacter agri]
Length=701

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 168/220 (76%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  449  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  508

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  GKISTGAQNDLE++TK++YA V++
Sbjct  509  GYAQYLPKEQFLYTTEQLIDGMCMTMGGRVAEDITFGKISTGAQNDLERITKLSYAMVSI  568

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++ VG +SF   +N +  +KPYS+KT+ +ID EVR+ I   Y  T QL+ + ++ + 
Sbjct  569  YGMNEAVGNVSFHDPQNEYNFNKPYSDKTSELIDVEVRKLIGDVYIKTKQLLLDKQDGLE  628

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            ++A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  629  KLAQKLLEKEILFQADLEEILGKRPFDTR--TTYDEFVNG  666



>gb|AFM03376.1| membrane protease FtsH catalytic subunit [Flexibacter litoralis 
DSM 6794]
Length=674

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 170/222 (77%), Gaps = 3/222 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNK+IS  E+  VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  443  FESAIDRVIGGLEKKNKIISPEEKEIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAAL  502

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CM LGGRA+E ++ GKISTGA +DLE++TKM Y+ V+V
Sbjct  503  GYAQYLPKEQFLYTIEQLTDEMCMALGGRAAEDIIFGKISTGALSDLERITKMAYSMVSV  562

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + K+G +SF   + +    KPYS  TA IID EV+E + +AY  T +L+ EHK+ + 
Sbjct  563  YGMNPKIGNVSFYDAQRSDFAGKPYSEATAQIIDEEVKEMVERAYTFTKELLTEHKDALE  622

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF-KDGF  305
             IA+ LLEKEVL Q DL R++G+RPF   +PTNY++  K+GF
Sbjct  623  TIAQELLEKEVLFQIDLERLIGKRPF--DKPTNYEKHTKNGF  662



>ref|WP_040539886.1| peptidase M41 [Pedobacter arcticus]
Length=695

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  446  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  505

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  GKISTGAQNDLE++TK+ YA V +
Sbjct  506  GYAQYLPKEQFLYTTEQLSDGMCMTMGGRVAEDITFGKISTGAQNDLERITKLAYAMVTL  565

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG S+KVG +SF      +  SKPYS+KTA +ID+EVRE I+  Y+ T  L+ E ++ + 
Sbjct  566  YGMSEKVGNVSFNDQGGEYNFSKPYSDKTAELIDSEVRELISGVYQKTKDLLIEKRDGLE  625

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             +A  LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  626  ALAVKLLEKEILFQSDLEEILGKRPFDNR--TTYDEFVNG  663



>gb|ETZ19316.1| peptidase M41 [Pedobacter sp. V48]
Length=696

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 169/220 (77%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  446  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  505

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +
Sbjct  506  GYAQYLPKEQFLYTTEQLTDGMCMTMGGRVAEDIVFGKISTGAQNDLERITKLSYAMVTI  565

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +  +G +SF   +N +  +KPYS KT+ +ID+EVR  I++ Y+ T QL+ + ++ + 
Sbjct  566  YGMNSTIGNVSFHDPQNEYNFNKPYSEKTSEMIDHEVRILISQVYDRTKQLLTDKRDGLE  625

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            ++A+ L+EKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  626  KLAQKLIEKEILFQADLEEILGKRPFDNR--TTYDEFVNG  663



>ref|XP_002741203.1| PREDICTED: AFG3-like protein 2, partial [Saccoglossus kowalevskii]
Length=560

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 171/221 (77%), Gaps = 4/221 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AI+RVIGGLEKK +V+   E++TVAYHE+GHAVAGWFLEHA+PLLKV+I+PRG   L
Sbjct  293  FEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-L  351

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L +KEQL D  CMTLGGR SE+++ G+I+TGAQ+DL+KVT+  YAQV  
Sbjct  352  GYAQYLPKEQYLYSKEQLLDRMCMTLGGRVSEELVFGRITTGAQDDLKKVTQTAYAQVVQ  411

Query  607  YGFSDKVGLLSFP-PNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            +G S+KVG +SF  P +    M KPYS +TA +IDNEVR  I  AY+ TV L++ H+E++
Sbjct  412  FGMSEKVGNVSFDMPQQGEMVMDKPYSEQTAQLIDNEVRSIIRSAYDRTVSLLQNHRENI  471

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             ++A+ LL KEVL +ED+V +LGERPF  +E + Y++F +G
Sbjct  472  EKVAQRLLNKEVLSKEDMVELLGERPF--AEKSTYEQFVEG  510



>ref|WP_037497088.1| peptidase M41 [Sphingobacterium sp. ACCC 05744]
 gb|KGE14923.1| ATP-dependent metalloprotease FtsH [Sphingobacterium sp. ACCC 
05744]
Length=690

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLE+A+PL+KV+IVPRG AAL
Sbjct  438  FQDAIDRVIGGLEKKNKIISPDEKKIVAYHEAGHAIAGWFLEYADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  498  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +DKVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T QL+ + ++ + 
Sbjct  558  YGMNDKVGNVSFRDSSGDSQFQKPYSDQTAELIDEEVRTLISAVYERTKQLLIDKQDGLV  617

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F
Sbjct  618  KIAEKLLEKEILFQSDLEEILGKRPFDNR--TTYDEF  652



>ref|WP_037460377.1| peptidase M41, partial [Sphingobacterium spiritivorum]
Length=655

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  438  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  498  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 
Sbjct  558  YGMNHKVGNISFRDSSGESQFQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLI  617

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  618  KIAEKLLEKEILFQSDLEEILGKRPFVNR--TTYDEFVNG  655



>ref|WP_009033571.1| peptidase M41 [Indibacter alkaliphilus]
 gb|EOZ95809.1| Cell division protein FtsH [Indibacter alkaliphilus LW1]
Length=695

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 189/261 (72%), Gaps = 13/261 (5%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE++TKM Y+ V+V
Sbjct  492  GYAQYLPKEQFLYQTEQLIDEMCMTLGGRAAEEIIFGKISTGALSDLERITKMAYSIVSV  551

Query  607  YGFSDKVGLLSFPPNENA-FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG ++K+G +SF  ++++ + M+KPYS KT+  ID+EVR+ I+ AYE T  L+ E ++ +
Sbjct  552  YGMNEKIGNVSFYDSKSSEYRMTKPYSEKTSETIDDEVRKLISFAYEKTKVLLTERRDEL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFK----------DGFVEDKETEA  281
              +A+ LLEKE+L Q DL +++G+RPF   + T Y+ F           D  ++DK+  A
Sbjct  612  EVLAKELLEKEILFQSDLEKLIGKRPF--GKETTYEAFTKKDQKKKSIPDAEIKDKQNNA  669

Query  280  KDTAENKSTKDDDSSPLQPEV  218
            +DT       +D +SP + +V
Sbjct  670  EDTKSEDGKPEDPNSPKEQQV  690



>ref|WP_039990218.1| peptidase M41, partial [Sphingobacterium spiritivorum]
Length=655

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  438  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  498  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 
Sbjct  558  YGMNHKVGNISFRDSSGESQFQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLI  617

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  618  KIAEKLLEKEILFQSDLEEILGKRPFVNR--TTYDEFVNG  655



>ref|WP_028295325.1| peptidase M41 [Olivibacter sitiensis]
Length=694

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 175/256 (68%), Gaps = 14/256 (5%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  440  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  499

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  GKISTGAQNDLE++TK+ YA V V
Sbjct  500  GYAQYLPKEQFLYTTEQLLDGMCMTMGGRVAEDITFGKISTGAQNDLERITKLAYAMVTV  559

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG +SF  ++ + +  KPYS KTA +ID EVR  I   Y  T  L+ + +E + 
Sbjct  560  YGMNNKVGNISFNDSQES-QFHKPYSEKTAELIDGEVRGLIEDVYAKTKALLTDKQEGLK  618

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE------  266
             +AE LLEKE+L Q DL ++LG+RPF     T YD F +G   D   + K  AE      
Sbjct  619  ALAEKLLEKEILFQSDLEQILGKRPFDHR--TTYDEFVNG--NDDAADQKPAAEGLIHDG  674

Query  265  ---NKSTKDDDSSPLQ  227
               N  T D  +SP Q
Sbjct  675  VGDNSGTFDPKASPDQ  690



>ref|WP_041264331.1| peptidase M41, partial [Flexibacter litoralis]
Length=658

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FESAIDRVIGGLEKKNK+IS  E+  VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  443  FESAIDRVIGGLEKKNKIISPEEKEIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAAL  502

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CM LGGRA+E ++ GKISTGA +DLE++TKM Y+ V+V
Sbjct  503  GYAQYLPKEQFLYTIEQLTDEMCMALGGRAAEDIIFGKISTGALSDLERITKMAYSMVSV  562

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + K+G +SF   + +    KPYS  TA IID EV+E + +AY  T +L+ EHK+ + 
Sbjct  563  YGMNPKIGNVSFYDAQRSDFAGKPYSEATAQIIDEEVKEMVERAYTFTKELLTEHKDALE  622

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDR  320
             IA+ LLEKEVL Q DL R++G+RPF   +PTNY++
Sbjct  623  TIAQELLEKEVLFQIDLERLIGKRPF--DKPTNYEK  656



>gb|EFK59817.1| ATP-dependent metallopeptidase HflB [Sphingobacterium spiritivorum 
ATCC 33861]
Length=689

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  438  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  498  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 
Sbjct  558  YGMNHKVGNISFRDSSGESQFQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLI  617

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  618  KIAEKLLEKEILFQSDLEEILGKRPFVNR--TTYDEFVNG  655



>gb|EEI91234.1| ATP-dependent metallopeptidase HflB [Sphingobacterium spiritivorum 
ATCC 33300]
Length=690

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  438  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  498  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF  +    +  KPYS++TA +ID EVR  I+  YE T +L+  ++E + 
Sbjct  558  YGMNHKVGNISFRDSSGESQFQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLI  617

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            +IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  618  KIAEKLLEKEILFQSDLEEILGKRPFVNR--TTYDEFVNG  655



>ref|XP_004362632.1| peptidase M41 [Dictyostelium fasciculatum]
 gb|EGG24781.1| peptidase M41 [Dictyostelium fasciculatum]
Length=1234

 Score =   275 bits (703),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -2

Query  967   FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
             F+ AIDRVIGGLEKKNKV+S +E++TVAYHE+GHAV  WFLEH  PLLKV+IVPRG AAL
Sbjct  981   FDQAIDRVIGGLEKKNKVLSPVEKKTVAYHEAGHAVVSWFLEHCSPLLKVSIVPRGMAAL  1040

Query  787   GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
             G+AQY+P E  L TKEQ+FD  CM LGGR +EQ+  G I+TGAQ+DLEKVTKM Y+Q+ +
Sbjct  1041  GYAQYLPKEEFLHTKEQIFDKMCMALGGRVAEQLTFGTITTGAQDDLEKVTKMAYSQIGI  1100

Query  607   YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
             YG +DKVG +S+P  +N+ + +KPYS +TA ++D EVR  +  AYE TVQ++E+H++ + 
Sbjct  1101  YGMNDKVGCVSYPRKDNS-DFTKPYSEQTAEMMDEEVRILLNSAYEKTVQVLEQHRDGLE  1159

Query  427   QIAELLLEKEVLHQEDLVRVLGERPF  350
             ++A LLLEKEV+H +D+  +LG RPF
Sbjct  1160  KVATLLLEKEVIHSDDIKTLLGPRPF  1185



>ref|WP_009053651.1| peptidase M41 [Nitritalea halalkaliphila]
 gb|EIM78320.1| ATP-dependent metalloprotease FtsH [Nitritalea halalkaliphila 
LW7]
Length=684

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 179/246 (73%), Gaps = 4/246 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAIDRVIGGLEKKNKIISPDEKRIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE+VTKM Y+ V+V
Sbjct  492  GYAQYLPREQFLYQTEQLMDEMCMTLGGRAAEELIFGKISTGALSDLERVTKMAYSIVSV  551

Query  607  YGFSDKVGLLSFPPNENA-FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  ++ + + M KPYS+KTA  ID EVR+ I   YE T  L++E  E +
Sbjct  552  YGMNDKIGNVSFYDSKGSEYRMQKPYSDKTAETIDEEVRKLITLCYERTKVLLQERMEEL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVE-DKETEAKDTAENKST  254
             ++A+ LL+KE+L Q DL+ ++G+RPF   + T Y+ F     E D++ E K      ST
Sbjct  612  EKLAQELLKKEILFQTDLIALIGKRPF--DKETTYEAFTKKVDENDRKREEKQQTPQAST  669

Query  253  KDDDSS  236
             + D +
Sbjct  670  GNSDET  675



>ref|WP_036676326.1| peptidase M41 [Pedobacter sp. R20-19]
Length=702

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 166/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E+R VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  450  FQDAIDRVIGGLEKKNKIISPEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  509

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA V++
Sbjct  510  GYAQYLPKEQFLYTTEQLTDGMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVSI  569

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++ VG +SF   +N +  +KPYS KT+ +ID EVR+ I   Y  T QL+ + +E + 
Sbjct  570  YGMNEAVGNVSFHDPQNEYNFNKPYSEKTSELIDVEVRKLIGDVYIKTKQLLIDKQEGLE  629

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
            ++A+ LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  630  KLAQKLLEKEILFQADLEEILGKRPFDTR--TTYDEFVNG  667



>ref|WP_038701774.1| peptidase M41 [Sphingobacterium sp. ML3W]
 gb|AIM39226.1| peptidase M41 [Sphingobacterium sp. ML3W]
Length=690

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 164/217 (76%), Gaps = 4/217 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGW+LEHA+PL+KV+IVPRG AAL
Sbjct  438  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWYLEHADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+
Sbjct  498  GYAQYLPREQFLYTTEQLVDSLCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAI  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG +DKVG +SF   + + +  KPYS+KTA +ID+EVR  I   Y  T QL+ + ++ + 
Sbjct  558  YGMNDKVGNVSF--RDGSEQFHKPYSDKTAELIDSEVRNLITDVYARTKQLLLDKQDGLV  615

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             IAE LLEKE+L Q DL  +LG+RPF +   T YD F
Sbjct  616  AIAEKLLEKEILFQSDLEEILGKRPFDTK--TTYDEF  650



>ref|WP_033563684.1| peptidase M41 [Sphingobacteriaceae bacterium DW12]
Length=688

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 165/220 (75%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  437  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  496

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AV
Sbjct  497  GYAQYLPKEQFLYTTEQLLDSMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAV  556

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF  +    +  KPYS++TA +ID+EVR  ++  Y+ T +L+ E ++ + 
Sbjct  557  YGMNHKVGNVSFRDSSGESQFQKPYSDQTAELIDDEVRTLVSAVYDRTKELLLEKQDGLV  616

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             IAE LLEKE+L Q DL  +LG+RPF +   T YD F +G
Sbjct  617  AIAEKLLEKEILFQSDLEEILGKRPFANR--TAYDEFVNG  654



>ref|WP_026968576.1| peptidase M41 [Algoriphagus terrigena]
Length=688

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 181/253 (72%), Gaps = 5/253 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRA+EQ++ GKISTGA +DLE++TK+ Y+ V+V
Sbjct  492  GYAQYLPKEQFLYQTEQLMDEMCMTLGGRAAEQIIFGKISTGALSDLERITKLAYSIVSV  551

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG ++K+G +SF     + ++M+KPYS  TA +ID EV   I  AYE T+ L+ EH+EH+
Sbjct  552  YGMNEKIGNVSFYDSKSDGYKMTKPYSEATAEMIDQEVSSLIQNAYERTLDLLNEHREHL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
              +A+ LLEKE+L Q DL  ++G+RPF  ++ T Y  F +   E K  E    A  +   
Sbjct  612  EVLAKELLEKEILFQADLESLIGKRPF--AKETTYQAFTNKKKEPKVPEL--IAGEEEVP  667

Query  250  DDDSSPLQPEVVP  212
            ++ S PL  + +P
Sbjct  668  EESSDPLTSKPIP  680



>ref|WP_026902710.1| peptidase M41 [Pedobacter glucosidilyticus]
Length=694

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 163/220 (74%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  445  FQDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  504

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +
Sbjct  505  GYAQYLPKEQFLYTTEQLSDGLCMTMGGRVAEDIIFGKISTGAQNDLERITKLAYAMVTI  564

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF    N +  SKPYS+KTA +ID EVR  I   Y  T +L+ E +E + 
Sbjct  565  YGMNPKVGNVSFHDPNNEYNFSKPYSDKTAELIDIEVRLLIEGIYNRTKELLTEKREGLE  624

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             +A+ LLEKE+L Q DL  +LG+RPF     T YD F +G
Sbjct  625  LLAQKLLEKEILFQSDLEEILGKRPFDHR--TTYDEFVNG  662



>ref|WP_045755148.1| peptidase M41 [Sphingobacterium sp. PM2-P1-29]
 emb|CDT09988.1| ATP-dependent zinc metalloprotease FtsH [Sphingobacterium sp. 
PM2-P1-29]
Length=690

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 4/217 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  438  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  497

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+
Sbjct  498  GYAQYLPREQFLYTTEQLVDSLCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAI  557

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG +SF   + + +  KPYS+KTA +ID+EVR  I   Y  T QL+ E ++ + 
Sbjct  558  YGMNEKVGNVSF--RDGSEQFHKPYSDKTAELIDSEVRNLITDVYTRTKQLLLEKQDGLI  615

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             IAE LLEKE+L Q DL  +LG+RPF +   T YD F
Sbjct  616  AIAEKLLEKEILFQSDLEEILGKRPFDTK--TTYDEF  650



>gb|EIE80123.1| hypothetical protein RO3G_04828 [Rhizopus delemar RA 99-880]
Length=645

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 181/245 (74%), Gaps = 10/245 (4%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AI+RVI GLEKK++V+S  E++TVAYHE+GHA+AGW+L++A+PLLKV+++PRG+AAL
Sbjct  404  FEDAIERVIAGLEKKSRVLSPEEKKTVAYHEAGHAIAGWYLQYADPLLKVSVIPRGSAAL  463

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P +  L +++QL D  CMTLGGR SEQ+    I+TGAQ+DL+KVTKM YAQ+  
Sbjct  464  GYAQYLPKDQYLYSRKQLLDRMCMTLGGRVSEQIFFKTITTGAQDDLQKVTKMAYAQITA  523

Query  607  YGFSDKVGLLSF--PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEH  434
            YG ++K+G LSF  P NEN+F+  KP+S +T  +IDNE R  +++AY+ T+QL+ E K  
Sbjct  524  YGMNEKIGPLSFSDPQNENSFQ--KPFSEQTGTMIDNEARALVSEAYDRTLQLLTEKKND  581

Query  433  VAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKST  254
            + ++A+LLL KEVL +ED+  +LG+RPF  +E T YD     +V  K ++     +    
Sbjct  582  IEKVAQLLLSKEVLTREDMENLLGKRPF--NEVTVYDE----YVRRKPSDTSAPPDFSKP  635

Query  253  KDDDS  239
             DDDS
Sbjct  636  SDDDS  640



>ref|WP_044224255.1| peptidase M41 [Flammeovirga pacifica]
Length=686

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 178/236 (75%), Gaps = 5/236 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F +AIDRVIGGLEKKNK+ISK E++ VAYHE+GHAV GWFLEHA PL+KV+IVPRG AAL
Sbjct  430  FMAAIDRVIGGLEKKNKIISKEEKKIVAYHEAGHAVTGWFLEHANPLVKVSIVPRGVAAL  489

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T E++ D  CMTLGGRA+E+++ G+ISTGA +DLE+ TKM Y+ V++
Sbjct  490  GYAQYLPKEQYLNTTEEMMDEICMTLGGRAAEEIIFGRISTGALSDLERTTKMAYSMVSI  549

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +D++G +SF  PN + +  S+PYS   A  ID+EV++ I KAY+ T+ L+ EH + +
Sbjct  550  YGMNDQIGHISFYDPNRSEYS-SRPYSEALAEKIDDEVKKLIEKAYQRTLGLLREHGDAL  608

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDK-ETEAKDTAE  266
              +A+ LLEKEVL+Q DLV+++GERPF   + T Y  F +   E+K E EAK  AE
Sbjct  609  EALAQQLLEKEVLYQSDLVKLIGERPF--DKKTIYQEFTEVAEENKAEVEAKQLAE  662



>ref|XP_002410299.1| ATPase, putative [Ixodes scapularis]
 gb|EEC12875.1| ATPase, putative [Ixodes scapularis]
Length=368

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 175/245 (71%), Gaps = 7/245 (3%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AI+RV+ G+EKK  V+   E++TVAYHE+GHAVAGWFLEHA+PLLKV+I+PRG   L
Sbjct  108  FEQAIERVVAGMEKKTNVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-L  166

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T +QLFD  CMTLGGR SEQ+  GKI+TGAQ+DL+KVT+  YAQV  
Sbjct  167  GYAQYLPKEQYLYTTQQLFDRMCMTLGGRVSEQIFFGKITTGAQDDLKKVTQSAYAQVVQ  226

Query  607  YGFSDKVGLLSFP-PNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            +G ++KVG LSF  P      + KPYS +TA +ID+EVR+ + +AY+ T+ L+ EHK  V
Sbjct  227  FGMNEKVGNLSFDMPQPGDMVLDKPYSEETAQMIDSEVRKMVQQAYDHTMTLLTEHKADV  286

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG---FVEDKETEAKDTAENK  260
             +IA+ LLEKE+L +ED++ +LG+RPF   E + Y+ F +G   F ED        + NK
Sbjct  287  EKIAKRLLEKEILSREDMIELLGKRPF--PEKSTYEEFVEGTGSFEEDTTLPKGLESWNK  344

Query  259  STKDD  245
              +D+
Sbjct  345  GPEDE  349



>ref|WP_039450881.1| peptidase M41 [Pedobacter glucosidilyticus]
 gb|KHJ38295.1| ATP-dependent zinc metalloprotease FtsH 4 [Pedobacter glucosidilyticus]
Length=694

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 162/220 (74%), Gaps = 2/220 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEK+NK+IS  E++ VAYHE+GHA+AGWFLEHA+PL+KV+IVPRG AAL
Sbjct  445  FQDAIDRVIGGLEKRNKIISPEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAAL  504

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMT+GGR +E ++  KISTGAQNDLE++TK+ YA V +
Sbjct  505  GYAQYLPKEQFLYTTEQLSDGLCMTMGGRVAEDIIFNKISTGAQNDLERITKLAYAMVTI  564

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG + KVG +SF    N +  SKPYS+KTA +ID EVR  I   Y  T QL+ E +E + 
Sbjct  565  YGMNPKVGNVSFHDPNNEYNFSKPYSDKTAELIDIEVRLLIEGIYNRTKQLLTEKREGLE  624

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             +A+ LLEKE+L Q DL  +LG+RPF     T YD F +G
Sbjct  625  LLAQKLLEKEILFQSDLEEILGKRPFDHR--TTYDEFVNG  662



>ref|XP_003979383.1| PREDICTED: AFG3-like protein 2 [Takifugu rubripes]
Length=332

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AI+RVIGGLEKK +V+   E++TVAYHE+GHAVAGWFLEHA+PLLKV+I+PRG   L
Sbjct  73   FEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-L  131

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L TKEQL D  CMTLGGR SE++  G+I+TGAQ+DL KVT+  YAQ+  
Sbjct  132  GYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQ  191

Query  607  YGFSDKVGLLSFP-PNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            +G + KVG +SF  P +    + KPYS  TA +ID EVR  I++AY+ T+QL++E K  V
Sbjct  192  FGMNPKVGQVSFDLPRQGEMVLEKPYSEATARLIDTEVRALISEAYQRTLQLLKEKKAEV  251

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDG  308
             ++A  LLEKEVL + D+V +LG+RPF  +E + Y+ F +G
Sbjct  252  EKVALRLLEKEVLDKNDMVELLGKRPF--AEKSTYEEFVEG  290



>ref|WP_026951332.1| peptidase M41 [Algoriphagus mannitolivorans]
Length=692

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/253 (52%), Positives = 184/253 (73%), Gaps = 5/253 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  435  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  494

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE++TK+ Y+ V+V
Sbjct  495  GYAQYLPKEQFLYQTEQLIDEMCMTLGGRAAEEIVFGKISTGALSDLERITKLAYSIVSV  554

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG ++K+G +SF     + ++M+KPYS  TA +ID EV + I  AY+ T+ L+ EH+EH+
Sbjct  555  YGMNEKLGNISFYDSKSDGYKMTKPYSEATAEMIDQEVSKLIQFAYQRTLDLLREHREHL  614

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
              +A+ LLEKE+L Q DL +++G+RPF  ++ T Y  + +   +DK    +  A  +  K
Sbjct  615  EILAKELLEKEILFQSDLEKLIGKRPF--AKETTYQAYTNK--KDKVKGPELVAGEEEAK  670

Query  250  DDDSSPLQPEVVP  212
             + S PL  + +P
Sbjct  671  PESSDPLTSDPIP  683



>gb|ESA05195.1| hypothetical protein GLOINDRAFT_66340 [Rhizophagus irregularis 
DAOM 181602]
Length=647

 Score =   265 bits (677),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 174/242 (72%), Gaps = 6/242 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRV+ GLE+K++V+S  E++TVAYHE+GHAVAGWFLEHA+PLLKVTI+PRG AAL
Sbjct  410  FEQAIDRVVAGLERKSRVLSPEEKKTVAYHEAGHAVAGWFLEHADPLLKVTIIPRGVAAL  469

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P +  L +  QL D  CMTLGGR SEQ+    I+TGA +DL++VTK+ YAQV  
Sbjct  470  GYAQYLPKDQYLYSTAQLLDRMCMTLGGRVSEQIFFNIITTGAHDDLQRVTKLAYAQVTT  529

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +  VG LSF  PN+N  +  KPYS +TA +ID EVR+ +A AYE TV+L+ + K  V
Sbjct  530  YGMNPNVGPLSFNSPNDNEPQFQKPYSEETAKMIDEEVRKLVASAYERTVKLLTDKKNDV  589

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
             ++A+LLL KEVL+++D++ +LG+RPF   E  NY+ +   F   + T    +AE   + 
Sbjct  590  EKVAQLLLSKEVLNRDDMISLLGKRPF--VEKNNYEEY---FNPKENTPPPPSAEQSQSS  644

Query  250  DD  245
             +
Sbjct  645  SN  646



>ref|XP_001744500.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90449.1| predicted protein [Monosiga brevicollis MX1]
Length=637

 Score =   264 bits (675),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 184/253 (73%), Gaps = 12/253 (5%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AI+RVI GLEKK +V+S+ E+RTVAYHE+GHAV GW+LEHA+PLLKV+I+PRG+AAL
Sbjct  374  FEQAIERVIAGLEKKTRVLSQEEKRTVAYHEAGHAVCGWYLEHADPLLKVSIIPRGSAAL  433

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L + +QL D  CM LGGR SEQ+   +I+TGAQ+DL+KVT++ Y+Q+AV
Sbjct  434  GYAQYLPQERFLFSTQQLLDRMCMMLGGRVSEQIFFERITTGAQDDLQKVTRLAYSQIAV  493

Query  607  YGFSDKVGLLSFP-PNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG + KVG LSF  P++N     KPYS  TA +ID E R  +  A+  T++L+ E ++ V
Sbjct  494  YGMNTKVGNLSFKMPDDNEPAFDKPYSEATAQMIDEEARNLVQTAFTRTLELLTEKRDAV  553

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF-KDGFVEDKETEA--------K  278
             ++A+LLL++EVL ++D+V +LG RPFK  E  +YD+F +D   +D+E +         +
Sbjct  554  EKVAQLLLDREVLSRQDMVDLLGTRPFK--EKHDYDQFMEDAGSDDQEVQLPPGLRNLER  611

Query  277  DTAENKSTKDDDS  239
            ++A+ +  +D DS
Sbjct  612  ESAQKRHDRDADS  624



>ref|WP_009186129.1| peptidase M41 [Cecembia lonarensis]
 gb|EKB48294.1| ATP-dependent zinc metalloprotease FtsH [Cecembia lonarensis 
LW9]
Length=687

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 181/252 (72%), Gaps = 8/252 (3%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE++TKM Y+ V++
Sbjct  492  GYAQYLPKEQFLYQTEQLMDEMCMTLGGRAAEEIIFGKISTGALSDLERITKMAYSMVSI  551

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF     N + M+KPYS  TA  ID EVR+ I+ AYE T +L+ E +  +
Sbjct  552  YGMNDKIGNVSFYDSKSNEYRMTKPYSETTAETIDEEVRKLISIAYERTKKLLTEKRNEL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTA----EN  263
              +++ LLEKE+L Q DL +++G+RPF  ++ T Y+ F    VE+KE   K  +    E+
Sbjct  612  EILSKELLEKEILFQTDLEKLIGKRPF--AKETTYEAFTKK-VEEKEKAQKAASIAKEES  668

Query  262  KSTKDDDSSPLQ  227
             S K  D+   Q
Sbjct  669  DSVKGTDAEKAQ  680



>ref|WP_039137089.1| ATPase AAA, partial [Flavihumibacter solisilvae]
Length=664

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 161/208 (77%), Gaps = 4/208 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ +AYHE+GHA+ GW+LEHA PLLKVTIVPRGTAAL
Sbjct  452  FQDAVDRVIGGLEKKNKIISPDEKKIIAYHEAGHAICGWYLEHAYPLLKVTIVPRGTAAL  511

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY P E  L   +QL D  CMTLGGRA+E +  GKISTGAQNDL+++T+M YA V V
Sbjct  512  GYAQYTPKEQYLYNTDQLMDQICMTLGGRAAEDIFFGKISTGAQNDLQQITRMAYAMVTV  571

Query  607  YGFSDKVGLLSF--PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEH  434
            YG +DKVG +SF  P  EN+F  +KPYS +T+ +ID EVR+ I  AY+ T +L+ E ++ 
Sbjct  572  YGMNDKVGNVSFYDPQQENSF--TKPYSEETSKLIDEEVRKLIDSAYDRTRELLTEKRQQ  629

Query  433  VAQIAELLLEKEVLHQEDLVRVLGERPF  350
            V  +AE LL+KEVL Q D+ +++G+RPF
Sbjct  630  VGILAEKLLDKEVLFQSDVEQLIGKRPF  657



>gb|EMS32972.1| Cell division protein FtsH [Mariniradius saccharolyticus AK6]
Length=701

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 182/247 (74%), Gaps = 6/247 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRASE+++ GKISTGA +DLE+VTKM Y+ V+V
Sbjct  492  GYAQYLPKEQFLYQTEQLVDEMCMTLGGRASEEIIFGKISTGALSDLERVTKMAYSMVSV  551

Query  607  YGFSDKVGLLSFPPNENA-FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  ++ + + M+KPYS  TA  ID EVR+ ++ AYE T +L+   +E +
Sbjct  552  YGMNDKIGNVSFYDSKASDYRMTKPYSETTAETIDEEVRKLVSFAYERTKELLNHKREQL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF--KDGFVEDKETEAKDTAENKS  257
              +A+ LLEKE+L Q DL R++G+RPF  ++ T Y+ F  K   V  KE EA+  AE+  
Sbjct  612  EILAKELLEKEILFQTDLERLIGKRPF--AKETTYEAFTKKTPKVAAKE-EAEPKAESGE  668

Query  256  TKDDDSS  236
                DSS
Sbjct  669  KVPADSS  675



>dbj|GAO41819.1| ATP-dependent zinc metalloprotease FtsH [Flavihumibacter petaseus 
NBRC 106054]
Length=672

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = -2

Query  973  TIFESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTA  794
            T F+ A+DRVIGGLEKKNK+IS  E++ +AYHE+GHA+ GW+LEHA PLLKVTIVPRGTA
Sbjct  450  TDFQDAVDRVIGGLEKKNKIISPDEKKIIAYHEAGHAICGWYLEHAYPLLKVTIVPRGTA  509

Query  793  ALGFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQV  614
            ALG+AQY P E  L   +QL D  CMTLGGRASE++  GKISTGAQNDL+++T+M Y+ V
Sbjct  510  ALGYAQYTPKEQYLYNTDQLMDQICMTLGGRASEEIFFGKISTGAQNDLQQITRMAYSMV  569

Query  613  AVYGFSDKVGLLSF--PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHK  440
             +YG ++KVG +SF  P  EN+F  +KPYS +T+ +ID EVR+ I +AY+ T  L+ E K
Sbjct  570  TIYGMNEKVGNVSFYDPQQENSF--TKPYSEETSKLIDQEVRKLIDQAYDRTKLLLSEKK  627

Query  439  EHVAQIAELLLEKEVLHQEDLVRVLGERPF  350
            E V  +AE LL+KEVL Q D+ +++G+RPF
Sbjct  628  EQVELLAEKLLDKEVLFQSDVEQLIGKRPF  657



>ref|WP_019597947.1| peptidase M41 [Rhodonellum psychrophilum]
 gb|ERM84443.1| peptidase M41 [Rhodonellum psychrophilum GCM71 = DSM 17998]
Length=684

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 179/248 (72%), Gaps = 3/248 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKK K+IS  E+R VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAVDRVIGGLEKKTKIISPEEKRIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRA+E+++ GKISTGA +DLE+VTK+ Y+ V V
Sbjct  492  GYAQYLPKEQFLYQTEQLLDEICMTLGGRAAEEIIFGKISTGALSDLERVTKVAYSMVTV  551

Query  607  YGFSDKVGLLSFPPNE-NAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  ++ N ++M+KPYS  TA  ID EVR+ I++AYE T  L+   K  V
Sbjct  552  YGMNDKIGNVSFYESKGNDYKMTKPYSETTAETIDEEVRKLISQAYERTKALLNSKKAEV  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
              +A+ LLEKE++ Q DL R++G+RPF  ++ T Y+ +        E   K+ A+++  +
Sbjct  612  ETLAQELLEKEIIFQSDLERLIGKRPF--AKETTYEAYTKKVPVKVEVSEKEVAKDEKPE  669

Query  250  DDDSSPLQ  227
            D   + +Q
Sbjct  670  DPAEAEVQ  677



>ref|WP_020892866.1| Cell division protein FtsH [Cyclobacterium qasimii]
 gb|EPR68329.1| Cell division protein FtsH [Cyclobacterium qasimii M12-11B]
Length=678

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 176/242 (73%), Gaps = 5/242 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  431  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAAL  490

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CM LGGRA+EQ++ GKISTGA +DLE++TKM Y+ V+V
Sbjct  491  GYAQYLPKEQFLYQTEQLIDEMCMALGGRAAEQIIFGKISTGALSDLERITKMAYSIVSV  550

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF     N ++  KPYS  TA  ID EVR+ I  AY  T+ L+++ K+ +
Sbjct  551  YGMNDKIGNVSFYDSKSNDYKFDKPYSENTAQTIDEEVRKLIEFAYTKTLDLLKDKKDEL  610

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
             +IA+ LLEKE+L Q DL +++G+RPF   + T Y++F    V+++ET   +  E     
Sbjct  611  VKIAKELLEKEILFQADLEKLIGKRPF--DKETTYEKFTK--VKEEETALIEVKEETPES  666

Query  250  DD  245
            DD
Sbjct  667  DD  668



>ref|WP_040480273.1| peptidase M41, partial [Mariniradius saccharolyticus]
Length=674

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 178/238 (75%), Gaps = 6/238 (3%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CMTLGGRASE+++ GKISTGA +DLE+VTKM Y+ V+V
Sbjct  492  GYAQYLPKEQFLYQTEQLVDEMCMTLGGRASEEIIFGKISTGALSDLERVTKMAYSMVSV  551

Query  607  YGFSDKVGLLSFPPNENA-FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  ++ + + M+KPYS  TA  ID EVR+ ++ AYE T +L+   +E +
Sbjct  552  YGMNDKIGNVSFYDSKASDYRMTKPYSETTAETIDEEVRKLVSFAYERTKELLNHKREQL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKS  257
              +A+ LLEKE+L Q DL R++G+RPF  ++ T Y+ F     +  +  AK+ AE K+
Sbjct  612  EILAKELLEKEILFQTDLERLIGKRPF--AKETTYEAFTK---KTPKVAAKEEAEPKA  664



>ref|WP_009578256.1| Cell division protein FtsH [Fulvivirga imtechensis]
 gb|ELR73086.1| Cell division protein FtsH [Fulvivirga imtechensis AK7]
Length=687

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/246 (52%), Positives = 176/246 (72%), Gaps = 3/246 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F  AIDRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  430  FHDAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  489

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CM LGGRA+E+++  KISTGA +DLE+VTKM Y+ V+V
Sbjct  490  GYAQYLPKEQFLYQTEQLIDAMCMALGGRAAEEIVFNKISTGALSDLERVTKMAYSIVSV  549

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG + K+G +SF    ++ +  +KPYS  TA  ID EVR+ I  A+E T  L+   ++ +
Sbjct  550  YGMNSKIGNVSFYDSKQSDYNFTKPYSEATAETIDQEVRKLIDDAFERTKDLLSHKRKEL  609

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
              +A+ LLEKE++ Q DL R++G+RPF  S PTNY+ + +G  ++KE   +D +++    
Sbjct  610  EVVAKELLEKEIIFQSDLERLIGKRPF--SHPTNYEAYTNGQKDEKEKRDEDISKSSRGV  667

Query  250  DDDSSP  233
               S+P
Sbjct  668  GQSSAP  673



>ref|WP_039133743.1| ATPase AAA, partial [Flavihumibacter sp. ZG627]
Length=664

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 158/208 (76%), Gaps = 4/208 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ +AYHE+GHA+ GW+LEHA PLLKVTIVPRGTAAL
Sbjct  451  FQDAVDRVIGGLEKKNKIISPDEKKIIAYHEAGHAICGWYLEHAYPLLKVTIVPRGTAAL  510

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY P E  L   +QL D  CMTLGGRA+E +  GKISTGAQNDL+++T+M Y+ V V
Sbjct  511  GYAQYTPKEQYLYNTDQLLDQICMTLGGRAAEDIFFGKISTGAQNDLQQITRMAYSMVTV  570

Query  607  YGFSDKVGLLSF--PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEH  434
            YG +DKVG +SF  P  EN+F  +KPYS +T+ IID EVR  I  AYE T QL+ E K  
Sbjct  571  YGMNDKVGNVSFYDPQQENSF--TKPYSEETSRIIDEEVRNLIDAAYERTKQLLTERKAQ  628

Query  433  VAQIAELLLEKEVLHQEDLVRVLGERPF  350
            V  +AE LL+KEVL Q D+  ++G+RP+
Sbjct  629  VEILAEKLLDKEVLFQSDVEHLIGKRPY  656



>ref|WP_017733337.1| hypothetical protein [Nafulsella turpanensis]
Length=689

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 169/224 (75%), Gaps = 3/224 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  432  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  491

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQLFD  CMTLGGRA+EQ++ GKISTGA +DLE++TK+ Y+ V++
Sbjct  492  GYAQYLPKEQFLYQTEQLFDEMCMTLGGRAAEQIVFGKISTGALSDLERITKLAYSIVSI  551

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG ++K+G +SF    +N +  +KPYS  T+  ID EVR  + KAY+ T+ L+    + +
Sbjct  552  YGMNEKIGNISFYDAKQNDYSFNKPYSEATSETIDQEVRLIVDKAYQHTLDLLRSKIKEL  611

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVE  299
              IA+ LLEKE++ Q DLVR++G RPF+    T Y +F +G +E
Sbjct  612  EIIAKELLEKEIIFQSDLVRLIGPRPFERQ--TTYQKFTNGELE  653



>ref|WP_035465307.1| ATPase AAA, partial [Bacteroidetes bacterium SCGC AAA027-G08]
Length=654

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 158/208 (76%), Gaps = 4/208 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+ISK E+  +AYHE+GHA+ GWFLEHA PLLKVTIVPRGTAAL
Sbjct  441  FQDAIDRVIGGLEKKNKIISKEEKEVIAYHEAGHAICGWFLEHAYPLLKVTIVPRGTAAL  500

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY P E  L T EQL D  CMTLGGRA+EQ+  G+ISTGA NDL+++TKM Y+ V  
Sbjct  501  GYAQYTPKEQYLYTIEQLTDQMCMTLGGRAAEQIFFGRISTGASNDLQQITKMAYSMVTT  560

Query  607  YGFSDKVGLLSF--PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEH  434
            YG ++K+G +SF  P  EN F+  KP+S +T  IID EVR+ I  AY  T+ L++  KE 
Sbjct  561  YGMNEKIGNVSFYDPSQENTFQ--KPFSEETGKIIDEEVRKMIDAAYHRTLDLLQSKKEE  618

Query  433  VAQIAELLLEKEVLHQEDLVRVLGERPF  350
            V ++A+ LL +EVLH+ D+  ++G+RPF
Sbjct  619  VEKVAQALLTREVLHKSDVEELIGDRPF  646



>ref|WP_014021491.1| peptidase M41 [Cyclobacterium marinum]
 gb|AEL27204.1| ATP-dependent metalloprotease FtsH [Cyclobacterium marinum DSM 
745]
Length=678

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 176/243 (72%), Gaps = 6/243 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E++ VAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  431  FQDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAAL  490

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L   EQL D  CM LGGRA+E+++ GKISTGA +DLE++TKM Y+ V+V
Sbjct  491  GYAQYLPKEQFLYQTEQLIDEMCMALGGRAAEEIIFGKISTGALSDLERITKMAYSIVSV  550

Query  607  YGFSDKVGLLSFPPNENA-FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  ++   ++  KPYS+ TA  ID EVR+ I  AY  T+ L+ E K+ +
Sbjct  551  YGMNDKIGNVSFYDSKGGEYKFDKPYSDNTAQTIDEEVRKLIEFAYSRTLDLLRERKKEL  610

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK  251
              IA+ LLEKE+L Q DL  ++G+RPF   + T Y++F     EDK  EA    +N +T 
Sbjct  611  LIIAKELLEKEILFQADLEELIGKRPF--DKETTYEKFTKLKSEDKAIEA---PKNDATD  665

Query  250  DDD  242
             DD
Sbjct  666  TDD  668



>gb|EXX70583.1| m-AAA protease subunit YTA12 [Rhizophagus irregularis DAOM 197198w]
Length=813

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 166/218 (76%), Gaps = 3/218 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AIDRV+ GLE+K++V+S  E++TVAYHE+GHAVAGWFLEHA+PLLKVTI+PRG AAL
Sbjct  576  FEQAIDRVVAGLERKSRVLSPEEKKTVAYHEAGHAVAGWFLEHADPLLKVTIIPRGVAAL  635

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P +  L +  QL D  CMTLGGR SEQ+    I+TGA +DL++VTK+ YAQV  
Sbjct  636  GYAQYLPKDQYLYSTAQLLDRMCMTLGGRVSEQIFFNIITTGAHDDLQRVTKLAYAQVTT  695

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +  VG LSF  PN+N  +  KPYS +TA +ID EVR+ +A AYE TV+L+ + K  V
Sbjct  696  YGMNPNVGPLSFNSPNDNEPQFQKPYSEETAKMIDEEVRKLVASAYERTVKLLTDKKNDV  755

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
             ++A+LLL KEVL+++D++ +LG+RPF   E  NY+ +
Sbjct  756  EKVAQLLLSKEVLNRDDMISLLGKRPF--VEKNNYEEY  791



>ref|WP_014221908.1| peptidase M41 [Niastella koreensis]
 gb|AEW01997.1| membrane protease FtsH catalytic subunit [Niastella koreensis 
GR20-10]
Length=687

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ A+DRVIGGLEKKNK+IS  E+R +AYHE+GHA+ GWFLEHA PLLKVTIVPRG AAL
Sbjct  447  FQDAVDRVIGGLEKKNKIISPDEKRIIAYHEAGHAICGWFLEHAYPLLKVTIVPRGVAAL  506

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY P E  L   +QL D  CMTLGGRASE +  GKISTGAQNDL+++T++ Y+ V V
Sbjct  507  GYAQYTPKEQYLYNTDQLMDQVCMTLGGRASEDIFFGKISTGAQNDLQQITRIAYSMVTV  566

Query  607  YGFSDKVGLLSF--PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEH  434
            YG ++KVG +SF  P  EN+F  +KPYS +T+ IID EVR+ I  AYE T +L+ E +  
Sbjct  567  YGMNEKVGNVSFYDPAAENSF--TKPYSEETSKIIDEEVRKLIEVAYEKTKELLTEKRTQ  624

Query  433  VAQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYD  323
            V ++AE LLEKEVL Q D+  ++G+RPF   +  + D
Sbjct  625  VEKLAEALLEKEVLFQSDVEALIGKRPFTDKKTLDVD  661



>ref|WP_026999681.1| peptidase M41 [Flexibacter elegans]
Length=676

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F+ AIDRVIGGLEKKNK+I   E+RTVAYHE+GHAVAGWFLEHA+PL+KV+IVPRG AAL
Sbjct  430  FQDAIDRVIGGLEKKNKLILPEEKRTVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAAL  489

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T EQL D  CMTLGGRA+E ++ GKISTGA +DLE++TKM Y+ V++
Sbjct  490  GYAQYLPREQFLYTTEQLLDEMCMTLGGRAAEDIVFGKISTGALSDLERITKMAYSMVSI  549

Query  607  YGFSDKVGLLSFPPNENA-FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  ++ + +  +KPYS+ TA  ID EVR+ I  AYE T  L+ +H+E +
Sbjct  550  YGMNDKIGNVSFYDSKQSDYSFNKPYSDATAQTIDEEVRKLIDTAYERTKALLTQHREAL  609

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPF  350
             ++A+ LL KE+L Q DL  ++G+RPF
Sbjct  610  EKVAQELLSKEILFQTDLENLIGKRPF  636



>emb|CEJ01398.1| Putative Cell division protease ftsH [Rhizopus microsporus]
Length=751

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 170/217 (78%), Gaps = 3/217 (1%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            FE AI+RVI GLEKK++V+S  E++TVAYHE+GHAVAGW+L+HA+PLLKV+++PRG+AAL
Sbjct  515  FEDAIERVIAGLEKKSRVLSPEEKKTVAYHEAGHAVAGWYLKHADPLLKVSVIPRGSAAL  574

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P +  L +KEQL D  CMTLGGR SEQ+    I+TGA +DL+KVTK+ YAQ+  
Sbjct  575  GYAQYLPKDQYLYSKEQLLDRMCMTLGGRVSEQIFFDSITTGAHDDLQKVTKIAYAQITQ  634

Query  607  YGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVA  428
            YG ++KVG LSF  ++N  ++ KPYS +TA +IDNE R  + +AYE T++L+ E K+ + 
Sbjct  635  YGMNEKVGALSF-TDQNEQQLQKPYSEQTATLIDNEARRMVNEAYERTLKLLSEKKQDIE  693

Query  427  QIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRF  317
            ++A LLL+KEVL +ED+ ++LG+RPF   E T YD +
Sbjct  694  KVARLLLDKEVLTREDMEKLLGKRPF--DEHTVYDEY  728



>ref|WP_044213238.1| peptidase M41 [Flammeovirga sp. OC4]
Length=671

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = -2

Query  967  FESAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAAL  788
            F +AIDRVIGGLEKKNK+IS  E++ VAYHE+GHAV GWFLEHA PL+KV+IVPRG AAL
Sbjct  428  FMAAIDRVIGGLEKKNKIISPEEKKIVAYHEAGHAVTGWFLEHANPLVKVSIVPRGVAAL  487

Query  787  GFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAV  608
            G+AQY+P E  L T E++ D  CMTLGGRA+E+++ G+ISTGA +DLE+ TKM Y+ V++
Sbjct  488  GYAQYLPKEQYLNTTEEMLDEICMTLGGRAAEEIIFGRISTGALSDLERTTKMAYSMVSI  547

Query  607  YGFSDKVGLLSF-PPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHV  431
            YG +DK+G +SF  PN + F  S+PYS   A  ID+EV++ I  AY+ T+ L+ EH + +
Sbjct  548  YGMNDKIGNVSFYDPNRSEFS-SRPYSEALAEKIDDEVKKLIDDAYQRTLALLREHGDAL  606

Query  430  AQIAELLLEKEVLHQEDLVRVLGERPFKSSEPTNYDRFKD  311
             ++A+ LLEKEVL+Q DLV+++GERPF   + T Y  F D
Sbjct  607  EKLAQQLLEKEVLYQSDLVKLIGERPF--DKKTIYQEFTD  644



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2434567882489