BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5549

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349290.1|  PREDICTED: uncharacterized protein LOC102579219    375   1e-125   Solanum tuberosum [potatoes]
ref|XP_004230423.1|  PREDICTED: uncharacterized protein LOC101259085    371   5e-124   Solanum lycopersicum
ref|XP_011092268.1|  PREDICTED: uncharacterized protein LOC105172507    371   7e-123   Sesamum indicum [beniseed]
ref|XP_007022850.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    362   2e-120   Theobroma cacao [chocolate]
gb|KJB08617.1|  hypothetical protein B456_001G093200                    361   4e-120   Gossypium raimondii
ref|XP_002268014.1|  PREDICTED: uncharacterized protein LOC100250508    356   2e-118   Vitis vinifera
emb|CBI29648.3|  unnamed protein product                                356   4e-118   Vitis vinifera
ref|XP_012066729.1|  PREDICTED: uncharacterized protein LOC105629705    355   5e-118   Jatropha curcas
ref|XP_002528868.1|  conserved hypothetical protein                     351   1e-117   
ref|XP_008452226.1|  PREDICTED: uncharacterized protein LOC103493...    353   3e-117   Cucumis melo [Oriental melon]
ref|XP_011047853.1|  PREDICTED: uncharacterized protein LOC105142093    353   3e-117   Populus euphratica
ref|XP_008452225.1|  PREDICTED: uncharacterized protein LOC103493...    353   3e-117   Cucumis melo [Oriental melon]
ref|XP_006385195.1|  hypothetical protein POPTR_0003s00960g             353   3e-117   Populus trichocarpa [western balsam poplar]
gb|KFK43315.1|  hypothetical protein AALP_AA1G108500                    352   2e-116   Arabis alpina [alpine rockcress]
ref|XP_010065247.1|  PREDICTED: uncharacterized protein LOC104452469    351   3e-116   Eucalyptus grandis [rose gum]
ref|XP_009800325.1|  PREDICTED: uncharacterized protein LOC104246...    350   6e-116   Nicotiana sylvestris
ref|XP_009601484.1|  PREDICTED: uncharacterized protein LOC104096770    350   1e-115   Nicotiana tomentosiformis
gb|KHN39690.1|  hypothetical protein glysoja_020768                     345   1e-115   Glycine soja [wild soybean]
ref|XP_006417483.1|  hypothetical protein EUTSA_v10007760mg             350   1e-115   Eutrema salsugineum [saltwater cress]
ref|XP_007148589.1|  hypothetical protein PHAVU_006G221200g             349   2e-115   Phaseolus vulgaris [French bean]
ref|XP_010273586.1|  PREDICTED: uncharacterized protein LOC104609074    350   2e-115   Nelumbo nucifera [Indian lotus]
ref|XP_002892557.1|  predicted protein                                  349   3e-115   Arabidopsis lyrata subsp. lyrata
ref|NP_172499.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    349   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490870.1|  PREDICTED: uncharacterized protein LOC104768...    349   4e-115   Camelina sativa [gold-of-pleasure]
ref|XP_011650577.1|  PREDICTED: uncharacterized protein LOC101215...    347   6e-115   Cucumis sativus [cucumbers]
ref|XP_011650576.1|  PREDICTED: uncharacterized protein LOC101215...    347   9e-115   Cucumis sativus [cucumbers]
ref|XP_010490863.1|  PREDICTED: uncharacterized protein LOC104768...    348   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010458365.1|  PREDICTED: uncharacterized protein LOC104739637    348   1e-114   Camelina sativa [gold-of-pleasure]
emb|CDX93443.1|  BnaA06g06050D                                          346   2e-114   
ref|XP_009791972.1|  PREDICTED: uncharacterized protein LOC104239130    347   2e-114   Nicotiana sylvestris
ref|XP_006303228.1|  hypothetical protein CARUB_v10012092mg             347   2e-114   Capsella rubella
ref|XP_009148352.1|  PREDICTED: uncharacterized protein LOC103871798    347   2e-114   Brassica rapa
ref|XP_006598780.1|  PREDICTED: uncharacterized protein LOC100796...    346   2e-114   Glycine max [soybeans]
ref|XP_010475888.1|  PREDICTED: uncharacterized protein LOC104755237    347   3e-114   Camelina sativa [gold-of-pleasure]
emb|CDY31036.1|  BnaA08g25860D                                          345   3e-114   Brassica napus [oilseed rape]
gb|ABE91847.1|  Protein of unknown function DUF266, plant               347   4e-114   Medicago truncatula
emb|CDX94911.1|  BnaC05g07600D                                          345   4e-114   
ref|XP_009800326.1|  PREDICTED: uncharacterized protein LOC104246...    345   4e-114   Nicotiana sylvestris
ref|XP_009144462.1|  PREDICTED: uncharacterized protein LOC103868...    345   7e-114   Brassica rapa
ref|XP_004503748.1|  PREDICTED: uncharacterized protein LOC101509...    346   9e-114   Cicer arietinum [garbanzo]
emb|CDY20644.1|  BnaC08g14140D                                          344   1e-113   Brassica napus [oilseed rape]
ref|XP_008218660.1|  PREDICTED: uncharacterized protein LOC103318965    343   2e-113   
gb|KHN11046.1|  hypothetical protein glysoja_044070                     339   7e-113   Glycine soja [wild soybean]
ref|XP_007221893.1|  hypothetical protein PRUPE_ppa016090mg             342   1e-112   Prunus persica
ref|XP_010682059.1|  PREDICTED: uncharacterized protein LOC104896962    342   2e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004503749.1|  PREDICTED: uncharacterized protein LOC101509...    340   3e-112   Cicer arietinum [garbanzo]
ref|XP_003540132.1|  PREDICTED: uncharacterized protein LOC100793763    339   7e-112   
emb|CAN60261.1|  hypothetical protein VITISV_020168                     340   1e-111   Vitis vinifera
ref|XP_008357658.1|  PREDICTED: uncharacterized protein LOC103421405    339   1e-111   
ref|XP_011028389.1|  PREDICTED: uncharacterized protein LOC105128426    339   2e-111   Populus euphratica
ref|XP_006385074.1|  hypothetical protein POPTR_0004s23660g             338   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009355369.1|  PREDICTED: uncharacterized protein LOC103946396    338   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_009414639.1|  PREDICTED: uncharacterized protein LOC103995706    338   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006431491.1|  hypothetical protein CICLE_v10001419mg             337   8e-111   Citrus clementina [clementine]
ref|XP_009144461.1|  PREDICTED: uncharacterized protein LOC103868...    338   9e-111   Brassica rapa
ref|XP_009399147.1|  PREDICTED: uncharacterized protein LOC103983624    337   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU18530.1|  unknown                                                 335   3e-110   Glycine max [soybeans]
gb|EPS73540.1|  hypothetical protein M569_01216                         337   6e-110   Genlisea aurea
ref|XP_010927836.1|  PREDICTED: uncharacterized protein LOC105049787    334   1e-109   
ref|XP_009410706.1|  PREDICTED: uncharacterized protein LOC103992641    334   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO42566.1|  hypothetical protein CISIN_1g039454mg                   327   2e-109   Citrus sinensis [apfelsine]
gb|EYU33292.1|  hypothetical protein MIMGU_mgv1a007588mg                334   2e-109   Erythranthe guttata [common monkey flower]
ref|XP_010682058.1|  PREDICTED: uncharacterized protein LOC104896961    334   4e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010553652.1|  PREDICTED: uncharacterized protein LOC104823674    332   9e-109   Tarenaya hassleriana [spider flower]
ref|XP_008812747.1|  PREDICTED: uncharacterized protein LOC103723571    332   1e-108   
ref|XP_006836850.1|  PREDICTED: uncharacterized protein LOC18427741     332   1e-108   Amborella trichopoda
ref|XP_006470991.1|  PREDICTED: uncharacterized protein LOC102625...    331   2e-108   Citrus sinensis [apfelsine]
ref|XP_004301567.1|  PREDICTED: uncharacterized protein LOC101308879    331   3e-108   Fragaria vesca subsp. vesca
ref|XP_006659748.1|  PREDICTED: uncharacterized protein LOC102714034    329   6e-108   Oryza brachyantha
ref|XP_010907977.1|  PREDICTED: uncharacterized protein LOC105034483    329   8e-108   Elaeis guineensis
ref|XP_006470990.1|  PREDICTED: uncharacterized protein LOC102625...    330   1e-107   Citrus sinensis [apfelsine]
emb|CDO97644.1|  unnamed protein product                                329   1e-107   Coffea canephora [robusta coffee]
ref|XP_008775897.1|  PREDICTED: uncharacterized protein LOC103696141    328   4e-107   Phoenix dactylifera
ref|XP_010099779.1|  hypothetical protein L484_010966                   324   1e-105   Morus notabilis
gb|EAZ41277.1|  hypothetical protein OsJ_25784                          320   1e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411881.1|  PREDICTED: uncharacterized protein LOC103993515    323   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002444900.1|  hypothetical protein SORBIDRAFT_07g001090          323   7e-105   Sorghum bicolor [broomcorn]
ref|NP_001060819.1|  Os08g0110400                                       321   3e-104   
gb|EAZ05353.1|  hypothetical protein OsI_27557                          321   4e-104   Oryza sativa Indica Group [Indian rice]
gb|EMS61782.1|  hypothetical protein TRIUR3_23279                       317   4e-104   Triticum urartu
ref|XP_004972466.1|  PREDICTED: uncharacterized protein LOC101769924    320   9e-104   Setaria italica
ref|XP_003573284.1|  PREDICTED: uncharacterized protein LOC100833185    320   1e-103   Brachypodium distachyon [annual false brome]
ref|NP_001143222.1|  uncharacterized protein LOC100275738               318   4e-103   Zea mays [maize]
ref|NP_001143215.1|  uncharacterized protein LOC100275720               318   6e-103   
emb|CAH67921.1|  OSIGBa0138E08-OSIGBa0161L23.2                          303   2e-97    Oryza sativa [red rice]
ref|NP_001052347.1|  Os04g0272400                                       303   2e-97    
ref|XP_008786442.1|  PREDICTED: uncharacterized protein LOC103704784    296   6e-96    
ref|XP_009341368.1|  PREDICTED: uncharacterized protein LOC103933398    297   2e-95    Pyrus x bretschneideri [bai li]
ref|XP_003567325.1|  PREDICTED: uncharacterized protein LOC100845991    297   5e-95    Brachypodium distachyon [annual false brome]
ref|XP_009415010.1|  PREDICTED: uncharacterized protein LOC103995962    296   8e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006645101.1|  PREDICTED: uncharacterized protein LOC102713419    294   4e-94    Oryza brachyantha
ref|XP_010227722.1|  PREDICTED: uncharacterized protein LOC104581568    293   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_008786440.1|  PREDICTED: uncharacterized protein LOC103704...    287   9e-93    Phoenix dactylifera
dbj|BAK04145.1|  predicted protein                                      290   3e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55277.1|  hypothetical protein TRIUR3_33067                       291   5e-92    Triticum urartu
ref|XP_008786439.1|  PREDICTED: uncharacterized protein LOC103704...    287   2e-91    Phoenix dactylifera
ref|XP_010942042.1|  PREDICTED: uncharacterized protein LOC105060...    284   3e-91    
ref|XP_006355313.1|  PREDICTED: uncharacterized protein LOC102601627    286   5e-91    Solanum tuberosum [potatoes]
gb|KDP29447.1|  hypothetical protein JCGZ_18368                         285   7e-91    Jatropha curcas
ref|XP_010453221.1|  PREDICTED: uncharacterized protein LOC104735185    286   9e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010942037.1|  PREDICTED: uncharacterized protein LOC105060...    286   9e-91    Elaeis guineensis
ref|XP_012082166.1|  PREDICTED: uncharacterized protein LOC105642088    285   1e-90    Jatropha curcas
ref|NP_001044966.1|  Os01g0875800                                       285   1e-90    
ref|XP_006394845.1|  hypothetical protein EUTSA_v10004382mg             285   1e-90    Eutrema salsugineum [saltwater cress]
dbj|BAD82090.1|  unknown protein                                        285   2e-90    Oryza sativa Japonica Group [Japonica rice]
gb|ERN15387.1|  hypothetical protein AMTR_s00036p00191120               283   2e-90    Amborella trichopoda
ref|XP_002871492.1|  hypothetical protein ARALYDRAFT_909140             285   2e-90    Arabidopsis lyrata subsp. lyrata
emb|CBI26990.3|  unnamed protein product                                281   2e-90    Vitis vinifera
gb|EAY76682.1|  hypothetical protein OsI_04637                          284   3e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_009601239.1|  PREDICTED: uncharacterized protein LOC104096562    284   3e-90    Nicotiana tomentosiformis
ref|XP_008796992.1|  PREDICTED: uncharacterized protein LOC103712290    284   4e-90    Phoenix dactylifera
ref|XP_010916432.1|  PREDICTED: uncharacterized protein LOC105041249    284   4e-90    Elaeis guineensis
ref|XP_006842356.2|  PREDICTED: uncharacterized protein LOC18432183     282   5e-90    
gb|ADE76813.1|  unknown                                                 282   5e-90    Picea sitchensis
ref|XP_010930512.1|  PREDICTED: uncharacterized protein LOC105051676    283   6e-90    
emb|CDM85189.1|  unnamed protein product                                283   9e-90    Triticum aestivum [Canadian hard winter wheat]
gb|ERN04031.1|  hypothetical protein AMTR_s00079p00179880               283   9e-90    Amborella trichopoda
ref|XP_006853920.2|  PREDICTED: uncharacterized protein LOC18443676     283   1e-89    Amborella trichopoda
ref|XP_008377912.1|  PREDICTED: uncharacterized protein LOC103440993    277   1e-89    
ref|XP_006286517.1|  hypothetical protein CARUB_v10001158mg             283   1e-89    Capsella rubella
ref|XP_010491917.1|  PREDICTED: uncharacterized protein LOC104769408    283   1e-89    Camelina sativa [gold-of-pleasure]
dbj|BAB86235.1|  P0648C09.24                                            286   1e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010519868.1|  PREDICTED: uncharacterized protein LOC104799181    283   1e-89    Tarenaya hassleriana [spider flower]
ref|XP_004245124.1|  PREDICTED: uncharacterized protein LOC101267146    283   1e-89    Solanum lycopersicum
ref|XP_011081713.1|  PREDICTED: uncharacterized protein LOC105164695    283   1e-89    Sesamum indicum [beniseed]
ref|XP_010912680.1|  PREDICTED: uncharacterized protein LOC105038537    283   1e-89    Elaeis guineensis
ref|XP_006399687.1|  hypothetical protein EUTSA_v10013787mg             282   2e-89    Eutrema salsugineum [saltwater cress]
ref|NP_196734.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    282   2e-89    Arabidopsis thaliana [mouse-ear cress]
gb|ACF84653.1|  unknown                                                 279   2e-89    Zea mays [maize]
ref|XP_010108861.1|  hypothetical protein L484_027054                   283   2e-89    Morus notabilis
ref|XP_010648315.1|  PREDICTED: uncharacterized protein LOC100249300    282   2e-89    Vitis vinifera
ref|XP_009337144.1|  PREDICTED: uncharacterized protein LOC103929645    282   3e-89    
ref|XP_004959909.1|  PREDICTED: uncharacterized protein LOC101775358    283   3e-89    Setaria italica
ref|XP_008795296.1|  PREDICTED: uncharacterized protein LOC103711078    281   4e-89    Phoenix dactylifera
ref|XP_002279551.2|  PREDICTED: uncharacterized protein LOC100250702    282   5e-89    Vitis vinifera
ref|XP_009131226.1|  PREDICTED: uncharacterized protein LOC103855927    280   9e-89    Brassica rapa
emb|CAN70606.1|  hypothetical protein VITISV_040196                     280   1e-88    Vitis vinifera
ref|XP_002872192.1|  hypothetical protein ARALYDRAFT_910666             280   1e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_009772023.1|  PREDICTED: uncharacterized protein LOC104222493    280   1e-88    Nicotiana sylvestris
ref|XP_010419754.1|  PREDICTED: uncharacterized protein LOC104705440    280   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_002872191.1|  hypothetical protein ARALYDRAFT_351610             280   2e-88    Arabidopsis lyrata subsp. lyrata
ref|XP_009357077.1|  PREDICTED: uncharacterized protein LOC103947833    280   2e-88    Pyrus x bretschneideri [bai li]
ref|XP_008339646.1|  PREDICTED: uncharacterized protein LOC103402673    280   2e-88    
ref|XP_004141306.1|  PREDICTED: uncharacterized protein LOC101205668    279   3e-88    Cucumis sativus [cucumbers]
ref|NP_001173628.1|  Os03g0731050                                       274   3e-88    
gb|KJB18563.1|  hypothetical protein B456_003G060300                    279   3e-88    Gossypium raimondii
ref|XP_010265065.1|  PREDICTED: uncharacterized protein LOC104602904    280   3e-88    Nelumbo nucifera [Indian lotus]
gb|KFK25431.1|  hypothetical protein AALP_AA8G114400                    279   3e-88    Arabis alpina [alpine rockcress]
ref|XP_007222675.1|  hypothetical protein PRUPE_ppa008602mg             277   4e-88    
ref|XP_009763004.1|  PREDICTED: uncharacterized protein LOC104214...    273   4e-88    Nicotiana sylvestris
ref|XP_008452696.1|  PREDICTED: uncharacterized protein LOC103493641    279   4e-88    Cucumis melo [Oriental melon]
ref|XP_002466519.1|  hypothetical protein SORBIDRAFT_01g009210          279   4e-88    Sorghum bicolor [broomcorn]
ref|XP_011007501.1|  PREDICTED: uncharacterized protein LOC105113...    280   5e-88    Populus euphratica
ref|XP_007222895.1|  hypothetical protein PRUPE_ppa006723mg             279   5e-88    Prunus persica
ref|XP_010033803.1|  PREDICTED: uncharacterized protein LOC104423043    278   6e-88    Eucalyptus grandis [rose gum]
gb|KJB70318.1|  hypothetical protein B456_011G068900                    278   6e-88    Gossypium raimondii
emb|CBI33634.3|  unnamed protein product                                275   8e-88    Vitis vinifera
gb|KHG10617.1|  Putative non-structural 4                               278   8e-88    Gossypium arboreum [tree cotton]
ref|XP_002315929.2|  hypothetical protein POPTR_0010s13160g             279   9e-88    
ref|XP_010941940.1|  PREDICTED: uncharacterized protein LOC105060052    278   1e-87    Elaeis guineensis
ref|XP_009403975.1|  PREDICTED: uncharacterized protein LOC103987406    278   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007024391.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    278   1e-87    
ref|XP_004291015.1|  PREDICTED: uncharacterized protein LOC101301742    278   1e-87    Fragaria vesca subsp. vesca
ref|NP_001143735.1|  uncharacterized protein LOC100276489               279   1e-87    
ref|XP_008672591.1|  PREDICTED: uncharacterized protein LOC100276...    279   1e-87    
gb|ACL54529.1|  unknown                                                 279   1e-87    Zea mays [maize]
ref|XP_010097098.1|  hypothetical protein L484_019537                   277   2e-87    Morus notabilis
ref|XP_009361651.1|  PREDICTED: uncharacterized protein LOC103951891    277   2e-87    
ref|XP_004981886.1|  PREDICTED: uncharacterized protein LOC101780921    277   2e-87    Setaria italica
ref|XP_011019540.1|  PREDICTED: uncharacterized protein LOC105122240    277   2e-87    Populus euphratica
gb|AFW60050.1|  hypothetical protein ZEAMMB73_108408                    278   3e-87    
ref|XP_008663766.1|  PREDICTED: uncharacterized protein LOC103642231    278   3e-87    
ref|XP_002458851.1|  hypothetical protein SORBIDRAFT_03g041470          276   4e-87    Sorghum bicolor [broomcorn]
ref|XP_008220437.1|  PREDICTED: uncharacterized protein LOC103320525    276   4e-87    Prunus mume [ume]
ref|XP_006485819.1|  PREDICTED: uncharacterized protein LOC102611796    277   5e-87    Citrus sinensis [apfelsine]
ref|XP_006466159.1|  PREDICTED: uncharacterized protein LOC102619633    276   5e-87    
ref|NP_197969.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    276   5e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KJB54739.1|  hypothetical protein B456_009G047200                    276   5e-87    Gossypium raimondii
gb|ABK28713.1|  unknown                                                 276   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009778079.1|  PREDICTED: uncharacterized protein LOC104227520    276   6e-87    Nicotiana sylvestris
ref|XP_004300973.1|  PREDICTED: uncharacterized protein LOC101293399    276   6e-87    Fragaria vesca subsp. vesca
ref|XP_006842358.2|  PREDICTED: uncharacterized protein LOC18432185     270   7e-87    Amborella trichopoda
ref|XP_002280674.1|  PREDICTED: uncharacterized protein LOC100244641    276   7e-87    Vitis vinifera
ref|XP_008243270.1|  PREDICTED: uncharacterized protein LOC103341513    276   7e-87    Prunus mume [ume]
gb|KDO58674.1|  hypothetical protein CISIN_1g040146mg                   275   8e-87    Citrus sinensis [apfelsine]
ref|XP_009763003.1|  PREDICTED: uncharacterized protein LOC104214...    276   8e-87    Nicotiana sylvestris
ref|XP_012069039.1|  PREDICTED: uncharacterized protein LOC105631509    275   8e-87    
ref|XP_008393665.1|  PREDICTED: uncharacterized protein LOC103455...    275   9e-87    
ref|XP_008393663.1|  PREDICTED: uncharacterized protein LOC103455...    275   9e-87    
ref|XP_010244357.1|  PREDICTED: uncharacterized protein LOC104588211    275   9e-87    
ref|XP_010318628.1|  PREDICTED: uncharacterized protein LOC101267...    272   9e-87    
gb|AFO66494.1|  hypothetical protein                                    275   9e-87    Brassica napus [oilseed rape]
gb|KHG11266.1|  Insulin-degrading enzyme                                275   9e-87    Gossypium arboreum [tree cotton]
gb|KJB65609.1|  hypothetical protein B456_010G103300                    275   1e-86    Gossypium raimondii
ref|XP_007044267.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    275   1e-86    
ref|XP_007044265.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    275   1e-86    Theobroma cacao [chocolate]
ref|XP_011007493.1|  PREDICTED: uncharacterized protein LOC105113...    276   1e-86    Populus euphratica
ref|XP_010999299.1|  PREDICTED: uncharacterized protein LOC105107168    275   1e-86    Populus euphratica
ref|XP_009151114.1|  PREDICTED: uncharacterized protein LOC103874440    275   2e-86    Brassica rapa
ref|XP_007226202.1|  hypothetical protein PRUPE_ppa016185mg             275   2e-86    Prunus persica
emb|CDX69735.1|  BnaA10g20840D                                          275   2e-86    
gb|AAD40142.1|AF149413_23  contains similarity to several Arabido...    276   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008806040.1|  PREDICTED: uncharacterized protein LOC103718829    275   2e-86    Phoenix dactylifera
ref|XP_010049161.1|  PREDICTED: uncharacterized protein LOC104437817    275   2e-86    Eucalyptus grandis [rose gum]
gb|EEE59868.1|  hypothetical protein OsJ_12453                          275   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006344151.1|  PREDICTED: uncharacterized protein LOC102582712    272   2e-86    
ref|XP_002515894.1|  conserved hypothetical protein                     274   2e-86    Ricinus communis
ref|NP_001169393.1|  uncharacterized protein LOC100383262               275   2e-86    Zea mays [maize]
ref|XP_002516477.1|  conserved hypothetical protein                     274   3e-86    
ref|XP_010267069.1|  PREDICTED: uncharacterized protein LOC104604...    274   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_006651782.1|  PREDICTED: uncharacterized protein LOC102702183    272   3e-86    
ref|XP_009624653.1|  PREDICTED: uncharacterized protein LOC104115679    275   3e-86    Nicotiana tomentosiformis
gb|KHG05757.1|  hypothetical protein F383_31190                         274   3e-86    Gossypium arboreum [tree cotton]
gb|AAT77886.1|  expressed protein                                       274   3e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002309520.1|  hypothetical protein POPTR_0006s24970g             274   4e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010265068.1|  PREDICTED: uncharacterized protein LOC104602905    274   4e-86    Nelumbo nucifera [Indian lotus]
ref|XP_008812373.1|  PREDICTED: uncharacterized protein LOC103723273    274   4e-86    Phoenix dactylifera
ref|XP_006442617.1|  hypothetical protein CICLE_v10020320mg             275   5e-86    Citrus clementina [clementine]
ref|XP_007217120.1|  hypothetical protein PRUPE_ppa015089m1g            267   6e-86    
ref|XP_008244554.1|  PREDICTED: uncharacterized protein LOC103342693    271   6e-86    Prunus mume [ume]
gb|KEH39949.1|  core-2/I-branching enzyme                               273   6e-86    Medicago truncatula
ref|XP_004986256.1|  PREDICTED: uncharacterized protein LOC101760830    274   6e-86    
ref|XP_006369242.1|  hypothetical protein POPTR_0001s20050g             273   7e-86    Populus trichocarpa [western balsam poplar]
emb|CDX97141.1|  BnaC09g44840D                                          273   7e-86    
ref|XP_004238913.2|  PREDICTED: uncharacterized protein LOC101249916    272   8e-86    Solanum lycopersicum
emb|CDX97139.1|  BnaC09g44860D                                          273   9e-86    
ref|XP_006353820.1|  PREDICTED: uncharacterized protein LOC102581987    271   9e-86    Solanum tuberosum [potatoes]
ref|XP_010099264.1|  hypothetical protein L484_015454                   273   1e-85    Morus notabilis
ref|XP_009356238.1|  PREDICTED: uncharacterized protein LOC103947108    273   1e-85    Pyrus x bretschneideri [bai li]
ref|XP_002447391.1|  hypothetical protein SORBIDRAFT_06g034240          274   2e-85    Sorghum bicolor [broomcorn]
ref|XP_010936142.1|  PREDICTED: uncharacterized protein LOC105055840    272   2e-85    Elaeis guineensis
ref|XP_010926004.1|  PREDICTED: uncharacterized protein LOC105048408    273   2e-85    Elaeis guineensis
gb|AAM63616.1|  unknown                                                 271   2e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CDX78439.1|  BnaA03g03510D                                          272   2e-85    
gb|EMT03400.1|  hypothetical protein F775_00930                         268   2e-85    
ref|XP_011081610.1|  PREDICTED: uncharacterized protein LOC105164614    272   2e-85    Sesamum indicum [beniseed]
gb|KDP29448.1|  hypothetical protein JCGZ_18369                         267   2e-85    Jatropha curcas
ref|NP_566682.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    271   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344746.1|  PREDICTED: uncharacterized protein LOC103936628    277   3e-85    
ref|XP_004236422.2|  PREDICTED: uncharacterized protein LOC101267...    273   3e-85    Solanum lycopersicum
ref|XP_006450782.1|  hypothetical protein CICLE_v10008613mg             271   3e-85    
ref|XP_010230469.1|  PREDICTED: uncharacterized protein LOC100843610    271   3e-85    
ref|XP_012077329.1|  PREDICTED: uncharacterized protein LOC105638179    271   3e-85    Jatropha curcas
ref|XP_009345696.1|  PREDICTED: uncharacterized protein LOC103937474    272   3e-85    Pyrus x bretschneideri [bai li]
ref|XP_006426464.1|  hypothetical protein CICLE_v100272021mg            265   3e-85    
ref|XP_011072929.1|  PREDICTED: uncharacterized protein LOC105158025    273   4e-85    Sesamum indicum [beniseed]
ref|XP_006357367.1|  PREDICTED: uncharacterized protein LOC102582902    271   4e-85    Solanum tuberosum [potatoes]
ref|XP_010536211.1|  PREDICTED: uncharacterized protein LOC104811254    271   4e-85    Tarenaya hassleriana [spider flower]
ref|XP_009625225.1|  PREDICTED: uncharacterized protein LOC104116132    271   4e-85    Nicotiana tomentosiformis
ref|XP_010264609.1|  PREDICTED: uncharacterized protein LOC104602574    271   5e-85    Nelumbo nucifera [Indian lotus]
emb|CDX70416.1|  BnaC03g05000D                                          272   6e-85    
gb|KHN37013.1|  hypothetical protein glysoja_009041                     269   6e-85    Glycine soja [wild soybean]
gb|KCW83891.1|  hypothetical protein EUGRSUZ_B00742                     268   6e-85    Eucalyptus grandis [rose gum]
ref|XP_002524909.1|  conserved hypothetical protein                     271   7e-85    Ricinus communis
ref|XP_002276490.2|  PREDICTED: uncharacterized protein LOC100266878    270   8e-85    Vitis vinifera
ref|XP_002883297.1|  hypothetical protein ARALYDRAFT_479651             270   9e-85    
ref|XP_006299117.1|  hypothetical protein CARUB_v10015258mg             270   1e-84    Capsella rubella
ref|XP_011076478.1|  PREDICTED: uncharacterized protein LOC105160693    270   1e-84    Sesamum indicum [beniseed]
ref|XP_008244747.1|  PREDICTED: uncharacterized protein LOC103342870    270   1e-84    
ref|XP_011469419.1|  PREDICTED: uncharacterized protein LOC105352951    271   1e-84    Fragaria vesca subsp. vesca
ref|XP_007012231.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    270   1e-84    
emb|CDY56916.1|  BnaCnng31370D                                          270   1e-84    Brassica napus [oilseed rape]
ref|XP_007215514.1|  hypothetical protein PRUPE_ppa007018mg             270   1e-84    Prunus persica
ref|XP_003550286.1|  PREDICTED: uncharacterized protein LOC100785919    270   1e-84    Glycine max [soybeans]
gb|KHN20747.1|  hypothetical protein glysoja_019064                     267   1e-84    Glycine soja [wild soybean]
gb|KJB31441.1|  hypothetical protein B456_005G192100                    270   1e-84    Gossypium raimondii
ref|XP_009367505.1|  PREDICTED: uncharacterized protein LOC103957137    270   2e-84    
ref|XP_008812111.1|  PREDICTED: uncharacterized protein LOC103723082    270   2e-84    
ref|XP_004498923.1|  PREDICTED: uncharacterized protein LOC101515236    269   2e-84    Cicer arietinum [garbanzo]
ref|XP_002516755.1|  conserved hypothetical protein                     269   2e-84    
dbj|BAK05476.1|  predicted protein                                      270   2e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010094729.1|  hypothetical protein L484_019938                   271   2e-84    Morus notabilis
ref|XP_002466518.1|  hypothetical protein SORBIDRAFT_01g009200          269   2e-84    
ref|XP_008790242.1|  PREDICTED: uncharacterized protein LOC103707505    269   2e-84    Phoenix dactylifera
ref|XP_010062561.1|  PREDICTED: uncharacterized protein LOC104449935    269   2e-84    
ref|XP_004252429.1|  PREDICTED: uncharacterized protein LOC101255566    267   2e-84    
ref|XP_002466520.1|  hypothetical protein SORBIDRAFT_01g009220          269   2e-84    Sorghum bicolor [broomcorn]
ref|XP_010106109.1|  hypothetical protein L484_003112                   269   3e-84    Morus notabilis
ref|XP_009767015.1|  PREDICTED: uncharacterized protein LOC104218...    266   3e-84    Nicotiana sylvestris
ref|XP_007044266.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    269   3e-84    
ref|XP_010466367.1|  PREDICTED: uncharacterized protein LOC104746558    269   3e-84    
gb|KCW86302.1|  hypothetical protein EUGRSUZ_B02994                     266   3e-84    
ref|XP_012082131.1|  PREDICTED: uncharacterized protein LOC105642058    268   4e-84    
ref|XP_006468735.1|  PREDICTED: uncharacterized protein LOC102627900    269   4e-84    
ref|XP_003524367.1|  PREDICTED: uncharacterized protein LOC100815747    268   4e-84    
ref|XP_009338135.1|  PREDICTED: uncharacterized protein LOC103930517    268   5e-84    
tpg|DAA51164.1|  TPA: hypothetical protein ZEAMMB73_778026              268   5e-84    
gb|KHN21596.1|  hypothetical protein glysoja_023448                     268   5e-84    
ref|XP_010488146.1|  PREDICTED: uncharacterized protein LOC104766030    268   7e-84    
ref|XP_004241946.1|  PREDICTED: uncharacterized protein LOC101261829    267   8e-84    
emb|CDY51451.1|  BnaA05g36680D                                          268   8e-84    
ref|NP_001143764.1|  uncharacterized protein LOC100276526               268   8e-84    
ref|XP_008380827.1|  PREDICTED: uncharacterized protein LOC103443716    268   8e-84    
ref|XP_010669159.1|  PREDICTED: uncharacterized protein LOC104886401    268   8e-84    
ref|XP_009402165.1|  PREDICTED: uncharacterized protein LOC103986...    268   9e-84    
ref|XP_009145490.1|  PREDICTED: uncharacterized protein LOC103869...    266   9e-84    
ref|XP_009615448.1|  PREDICTED: uncharacterized protein LOC104108166    268   1e-83    
gb|KDO59065.1|  hypothetical protein CISIN_1g042794mg                   265   1e-83    
ref|XP_010479681.1|  PREDICTED: uncharacterized protein LOC104758496    268   1e-83    
emb|CDP00652.1|  unnamed protein product                                265   1e-83    
emb|CBI15481.3|  unnamed protein product                                266   1e-83    
ref|XP_011014143.1|  PREDICTED: uncharacterized protein LOC105118003    267   1e-83    
ref|XP_006430742.1|  hypothetical protein CICLE_v10013811mg             265   1e-83    
ref|XP_007160978.1|  hypothetical protein PHAVU_001G033200g             267   2e-83    
gb|KEH44200.1|  core-2/I-branching enzyme                               268   2e-83    
ref|XP_002324745.2|  hypothetical protein POPTR_0018s04680g             266   2e-83    
ref|XP_008391294.1|  PREDICTED: uncharacterized protein LOC103453537    266   2e-83    
emb|CBI15480.3|  unnamed protein product                                263   2e-83    
ref|XP_007208909.1|  hypothetical protein PRUPE_ppa027107mg             264   2e-83    
gb|EYU45841.1|  hypothetical protein MIMGU_mgv1a018710mg                266   2e-83    
ref|XP_010500763.1|  PREDICTED: uncharacterized protein LOC104778093    267   2e-83    
gb|EYU20381.1|  hypothetical protein MIMGU_mgv1a0226482mg               261   2e-83    
ref|XP_006482399.1|  PREDICTED: uncharacterized protein LOC102630459    264   2e-83    
ref|XP_010046585.1|  PREDICTED: uncharacterized protein LOC104435558    267   3e-83    
ref|XP_002276828.1|  PREDICTED: uncharacterized protein LOC100247520    266   3e-83    
ref|XP_009767014.1|  PREDICTED: uncharacterized protein LOC104218...    267   3e-83    
ref|XP_003530022.2|  PREDICTED: uncharacterized protein LOC100791882    266   3e-83    
ref|NP_001130080.1|  uncharacterized protein LOC100191173               266   3e-83    
gb|ACF85887.1|  unknown                                                 266   3e-83    
ref|XP_010045650.1|  PREDICTED: uncharacterized protein LOC104434412    267   3e-83    
ref|XP_008374777.1|  PREDICTED: uncharacterized protein LOC103438016    267   3e-83    
ref|XP_011011841.1|  PREDICTED: uncharacterized protein LOC105116265    266   3e-83    
ref|XP_006341708.1|  PREDICTED: uncharacterized protein LOC102599552    267   4e-83    
emb|CDX97140.1|  BnaC09g44850D                                          267   4e-83    
ref|XP_009348209.1|  PREDICTED: uncharacterized protein LOC103939820    267   4e-83    
ref|XP_009145487.1|  PREDICTED: uncharacterized protein LOC103869...    266   4e-83    
gb|AFO66521.1|  putative clathrin binding protein                       277   4e-83    
ref|XP_002535241.1|  conserved hypothetical protein                     263   4e-83    
ref|XP_011035090.1|  PREDICTED: uncharacterized protein LOC105133011    266   4e-83    
ref|XP_010493855.1|  PREDICTED: uncharacterized protein LOC104771079    266   4e-83    
ref|XP_003545368.1|  PREDICTED: uncharacterized protein LOC100819890    266   5e-83    
ref|XP_009768969.1|  PREDICTED: uncharacterized protein LOC104219898    267   5e-83    
ref|XP_009122883.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin int...    279   6e-83    
ref|XP_008240316.1|  PREDICTED: uncharacterized protein LOC103338837    266   6e-83    
emb|CDO98418.1|  unnamed protein product                                263   6e-83    
ref|XP_009589451.1|  PREDICTED: uncharacterized protein LOC104086812    266   7e-83    
ref|XP_010678016.1|  PREDICTED: uncharacterized protein LOC104893585    265   8e-83    
ref|XP_007033224.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    266   8e-83    
ref|XP_008453432.1|  PREDICTED: uncharacterized protein LOC103494140    262   9e-83    
ref|XP_011007454.1|  PREDICTED: uncharacterized protein LOC105113...    265   1e-82    
ref|XP_006448426.1|  hypothetical protein CICLE_v10015505mg             265   1e-82    
ref|XP_002891661.1|  hypothetical protein ARALYDRAFT_337332             265   1e-82    
ref|XP_006286838.1|  hypothetical protein CARUB_v10003837mg             265   1e-82    
gb|KHF98579.1|  hypothetical protein F383_37748                         261   1e-82    
gb|KGN63836.1|  hypothetical protein Csa_1G024220                       265   1e-82    
ref|XP_002321482.2|  hypothetical protein POPTR_0015s03840g             265   1e-82    
ref|XP_009630467.1|  PREDICTED: uncharacterized protein LOC104120416    265   2e-82    
ref|XP_010421452.1|  PREDICTED: uncharacterized protein LOC104706914    265   2e-82    
ref|XP_011022393.1|  PREDICTED: uncharacterized protein LOC105124187    265   2e-82    
gb|EYU30001.1|  hypothetical protein MIMGU_mgv1a007596mg                265   2e-82    
ref|XP_010663889.1|  PREDICTED: uncharacterized protein LOC100252627    264   2e-82    
ref|XP_002311468.2|  hypothetical protein POPTR_0008s12260g             264   2e-82    
gb|AAG50880.1|AC025294_18  hypothetical protein                         265   2e-82    
ref|NP_175588.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    265   2e-82    
ref|XP_002305172.2|  hypothetical protein POPTR_0004s09690g             263   2e-82    
gb|ERN04033.1|  hypothetical protein AMTR_s00079p00180800               258   2e-82    
ref|XP_009780294.1|  PREDICTED: uncharacterized protein LOC104229...    262   2e-82    
gb|EYU40777.1|  hypothetical protein MIMGU_mgv1a007709mg                264   2e-82    
ref|XP_004299046.1|  PREDICTED: uncharacterized protein LOC101307491    264   3e-82    
ref|XP_011007447.1|  PREDICTED: uncharacterized protein LOC105113...    263   3e-82    
ref|XP_004146835.1|  PREDICTED: uncharacterized protein LOC101208492    264   4e-82    
ref|XP_009415632.1|  PREDICTED: uncharacterized protein LOC103996435    261   4e-82    
ref|XP_007142937.1|  hypothetical protein PHAVU_007G029800g             265   4e-82    
ref|XP_007036566.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    266   4e-82    
gb|EMS50058.1|  hypothetical protein TRIUR3_05627                       259   4e-82    
ref|XP_009780287.1|  PREDICTED: uncharacterized protein LOC104229...    263   5e-82    
ref|XP_004137544.2|  PREDICTED: uncharacterized protein LOC101209845    265   6e-82    
ref|XP_010510112.1|  PREDICTED: uncharacterized protein LOC104786396    263   6e-82    
ref|XP_006469090.1|  PREDICTED: uncharacterized protein LOC102627718    263   6e-82    
emb|CDP02764.1|  unnamed protein product                                259   8e-82    
tpg|DAA47679.1|  TPA: hypothetical protein ZEAMMB73_259148              263   8e-82    
ref|XP_003533360.1|  PREDICTED: uncharacterized protein LOC100803748    265   8e-82    
gb|KHN06677.1|  hypothetical protein glysoja_021223                     263   9e-82    
ref|XP_011100115.1|  PREDICTED: uncharacterized protein LOC105178347    263   9e-82    
ref|XP_009360137.1|  PREDICTED: uncharacterized protein LOC103950632    264   9e-82    
ref|XP_010690090.1|  PREDICTED: uncharacterized protein LOC104903696    263   9e-82    
ref|XP_008447582.1|  PREDICTED: uncharacterized protein LOC103489998    263   9e-82    
ref|XP_002321483.2|  hypothetical protein POPTR_0015s03850g             263   1e-81    
gb|KHG14930.1|  Putative DNA helicase ino80                             261   1e-81    
ref|XP_011095814.1|  PREDICTED: uncharacterized protein LOC105175...    261   1e-81    
ref|NP_001170302.1|  uncharacterized protein LOC100384266               263   1e-81    
gb|KDO76927.1|  hypothetical protein CISIN_1g046575mg                   263   1e-81    
ref|XP_006406285.1|  hypothetical protein EUTSA_v10021956mg             262   1e-81    
gb|KJB61248.1|  hypothetical protein B456_009G347900                    262   2e-81    
gb|EMT12183.1|  hypothetical protein F775_15181                         258   2e-81    
ref|XP_006647208.1|  PREDICTED: uncharacterized protein LOC102715175    263   2e-81    
ref|XP_009131527.1|  PREDICTED: uncharacterized protein LOC103856...    259   2e-81    
ref|XP_009131528.1|  PREDICTED: uncharacterized protein LOC103856...    259   2e-81    
ref|XP_003536674.1|  PREDICTED: uncharacterized protein LOC100810724    262   2e-81    
gb|KFK35824.1|  hypothetical protein AALP_AA4G041900                    262   2e-81    
ref|XP_011095742.1|  PREDICTED: uncharacterized protein LOC105175...    261   3e-81    
emb|CDX78674.1|  BnaA03g05860D                                          262   3e-81    
emb|CDO98417.1|  unnamed protein product                                262   3e-81    
ref|XP_008393326.1|  PREDICTED: uncharacterized protein LOC103455513    263   3e-81    
gb|EMS51218.1|  hypothetical protein TRIUR3_07068                       260   3e-81    
ref|XP_004301820.1|  PREDICTED: uncharacterized protein LOC101311102    262   3e-81    
ref|XP_003614560.1|  hypothetical protein MTR_5g055480                  261   3e-81    
gb|EEC76122.1|  hypothetical protein OsI_13390                          279   3e-81    
ref|XP_009786387.1|  PREDICTED: uncharacterized protein LOC104234513    261   3e-81    
ref|XP_009601960.1|  PREDICTED: uncharacterized protein LOC104097139    261   4e-81    
ref|XP_003555913.1|  PREDICTED: uncharacterized protein LOC100779041    262   4e-81    
gb|EPS59287.1|  hypothetical protein M569_15522                         261   5e-81    
ref|XP_006392995.1|  hypothetical protein EUTSA_v10012322mg             261   5e-81    
ref|XP_011070777.1|  PREDICTED: uncharacterized protein LOC105156363    261   6e-81    
ref|XP_004972519.1|  PREDICTED: uncharacterized protein LOC101756391    262   6e-81    
ref|XP_002315928.1|  hypothetical protein POPTR_0010s13150g             260   6e-81    
ref|XP_002977635.1|  hypothetical protein SELMODRAFT_107168             259   7e-81    
ref|XP_002871706.1|  hypothetical protein ARALYDRAFT_326063             261   8e-81    
ref|XP_010066702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    262   9e-81    
ref|XP_004297621.1|  PREDICTED: uncharacterized protein LOC101304278    260   9e-81    
ref|XP_011072465.1|  PREDICTED: uncharacterized protein LOC105157713    260   9e-81    
gb|EPS68648.1|  hypothetical protein M569_06120                         259   9e-81    
ref|XP_006448428.1|  hypothetical protein CICLE_v10017943mg             261   1e-80    
ref|XP_003532515.1|  PREDICTED: uncharacterized protein LOC100782511    260   1e-80    
gb|KHN16548.1|  hypothetical protein glysoja_002645                     259   1e-80    
emb|CDX70676.1|  BnaC03g07600D                                          260   1e-80    
ref|XP_010094730.1|  hypothetical protein L484_019940                   259   1e-80    
ref|XP_007160392.1|  hypothetical protein PHAVU_002G318000g             260   1e-80    
ref|XP_006344154.1|  PREDICTED: uncharacterized protein LOC102583596    259   2e-80    
ref|XP_006417407.1|  hypothetical protein EUTSA_v10009677mg             259   2e-80    
ref|XP_010524350.1|  PREDICTED: uncharacterized protein LOC104802437    259   2e-80    
emb|CAC01858.1|  putative protein                                       257   2e-80    
ref|XP_009131526.1|  PREDICTED: uncharacterized protein LOC103856...    260   2e-80    
gb|KEH27363.1|  core-2/I-branching enzyme                               259   2e-80    
dbj|BAJ98037.1|  predicted protein                                      262   2e-80    
emb|CDO97949.1|  unnamed protein product                                259   2e-80    
ref|XP_004238911.1|  PREDICTED: uncharacterized protein LOC101249358    259   2e-80    
ref|XP_010693288.1|  PREDICTED: uncharacterized protein LOC104906249    259   2e-80    
ref|XP_006287845.1|  hypothetical protein CARUB_v10001069mg             259   3e-80    
ref|XP_010537457.1|  PREDICTED: uncharacterized protein LOC104812147    259   3e-80    
ref|XP_011008309.1|  PREDICTED: uncharacterized protein LOC105113714    259   3e-80    
ref|XP_010694626.1|  PREDICTED: uncharacterized protein LOC104907403    257   4e-80    
ref|XP_008812383.1|  PREDICTED: uncharacterized protein LOC103723284    258   4e-80    
ref|XP_009767018.1|  PREDICTED: uncharacterized protein LOC104218270    258   6e-80    
ref|NP_197121.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    258   7e-80    
gb|EEC76912.1|  hypothetical protein OsI_15153                          258   8e-80    
gb|KJB08436.1|  hypothetical protein B456_001G081500                    258   8e-80    
ref|XP_004510336.1|  PREDICTED: uncharacterized protein LOC101496152    257   9e-80    
ref|XP_006343019.1|  PREDICTED: uncharacterized protein LOC102599337    257   1e-79    
ref|XP_004236394.1|  PREDICTED: uncharacterized protein LOC101257059    257   1e-79    
ref|XP_009615449.1|  PREDICTED: uncharacterized protein LOC104108167    258   1e-79    
ref|XP_011097225.1|  PREDICTED: uncharacterized protein LOC105176192    254   1e-79    
gb|KJB08433.1|  hypothetical protein B456_001G081300                    257   1e-79    
ref|XP_010415458.1|  PREDICTED: uncharacterized protein LOC104701464    258   1e-79    
ref|XP_002975225.1|  hypothetical protein SELMODRAFT_102845             255   2e-79    
dbj|BAJ98929.1|  predicted protein                                      259   2e-79    
ref|XP_006344302.1|  PREDICTED: uncharacterized protein LOC102604936    256   2e-79    
gb|EYU41282.1|  hypothetical protein MIMGU_mgv1a010939mg                254   2e-79    
gb|ACU18543.1|  unknown                                                 257   2e-79    
gb|EYU44620.1|  hypothetical protein MIMGU_mgv1a022082mg                254   2e-79    
gb|EYU21409.1|  hypothetical protein MIMGU_mgv1a007990mg                256   2e-79    
emb|CDX69465.1|  BnaA10g18140D                                          257   2e-79    
ref|XP_009121508.1|  PREDICTED: uncharacterized protein LOC103846350    257   2e-79    
ref|XP_008459135.1|  PREDICTED: uncharacterized protein LOC103498310    257   2e-79    
ref|XP_006391143.1|  hypothetical protein EUTSA_v10019817mg             257   3e-79    
dbj|BAJ90641.1|  predicted protein                                      257   3e-79    
ref|XP_002442608.1|  hypothetical protein SORBIDRAFT_08g022900          256   3e-79    
ref|XP_004516650.1|  PREDICTED: uncharacterized protein LOC101496316    256   3e-79    
tpg|DAA51165.1|  TPA: hypothetical protein ZEAMMB73_778026              249   4e-79    
ref|XP_010453774.1|  PREDICTED: uncharacterized protein LOC104735642    256   4e-79    
ref|XP_009358798.1|  PREDICTED: uncharacterized protein LOC103949407    254   4e-79    
emb|CDX87842.1|  BnaC06g09040D                                          256   5e-79    
ref|XP_004963311.1|  PREDICTED: uncharacterized protein LOC101780918    256   5e-79    
ref|XP_010681644.1|  PREDICTED: uncharacterized protein LOC104896577    256   5e-79    
gb|EPS62381.1|  hypothetical protein M569_12413                         254   6e-79    
gb|AES76651.2|  core-2/I-branching enzyme                               256   6e-79    
emb|CDY19328.1|  BnaC05g08370D                                          255   6e-79    
ref|XP_011650566.1|  PREDICTED: uncharacterized protein LOC101207079    256   6e-79    
ref|XP_009393005.1|  PREDICTED: uncharacterized protein LOC103978798    255   7e-79    
ref|XP_009144879.1|  PREDICTED: uncharacterized protein LOC103868547    255   7e-79    
ref|XP_003620433.1|  hypothetical protein MTR_6g083830                  256   8e-79    
ref|XP_009413609.1|  PREDICTED: uncharacterized protein LOC103994882    255   9e-79    
ref|XP_010513660.1|  PREDICTED: uncharacterized protein LOC104789704    255   1e-78    
emb|CDY59035.1|  BnaCnng34190D                                          256   1e-78    
ref|XP_010420299.1|  PREDICTED: uncharacterized protein LOC104705...    255   1e-78    
ref|XP_009357886.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    258   1e-78    
emb|CDP08214.1|  unnamed protein product                                251   1e-78    
ref|XP_004497066.1|  PREDICTED: uncharacterized protein LOC101490811    255   1e-78    
emb|CDX81507.1|  BnaC02g18110D                                          255   1e-78    
ref|XP_010916430.1|  PREDICTED: uncharacterized protein LOC105041248    254   1e-78    
gb|EYU44621.1|  hypothetical protein MIMGU_mgv1a022423mg                251   2e-78    
ref|XP_006400149.1|  hypothetical protein EUTSA_v10013684mg             255   2e-78    
ref|XP_008461555.1|  PREDICTED: uncharacterized protein LOC103500127    255   2e-78    
ref|XP_007152746.1|  hypothetical protein PHAVU_004G156000g             256   2e-78    
ref|XP_008645560.1|  PREDICTED: uncharacterized protein LOC103626979    256   2e-78    
emb|CBI15479.3|  unnamed protein product                                251   2e-78    
ref|XP_011097027.1|  PREDICTED: uncharacterized protein LOC105176048    254   2e-78    
ref|XP_007036567.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    255   2e-78    
ref|XP_009105384.1|  PREDICTED: uncharacterized protein LOC103831252    254   3e-78    
ref|XP_010099263.1|  hypothetical protein L484_015453                   253   3e-78    
ref|XP_010470788.1|  PREDICTED: uncharacterized protein LOC104750...    254   4e-78    
ref|XP_007208880.1|  hypothetical protein PRUPE_ppa026447mg             254   4e-78    
ref|XP_008459241.1|  PREDICTED: uncharacterized protein LOC103498396    253   4e-78    
gb|KFK41255.1|  hypothetical protein AALP_AA2G105500                    253   6e-78    
ref|XP_010470787.1|  PREDICTED: uncharacterized protein LOC104750...    255   7e-78    
dbj|BAF00442.1|  hypothetical protein                                   252   8e-78    
ref|XP_004299045.1|  PREDICTED: uncharacterized protein LOC101307203    253   9e-78    
ref|XP_008340286.1|  PREDICTED: uncharacterized protein LOC103403235    253   1e-77    
gb|EMT20181.1|  hypothetical protein F775_15679                         252   1e-77    
ref|XP_006302341.1|  hypothetical protein CARUB_v10020398mg             253   1e-77    



>ref|XP_006349290.1| PREDICTED: uncharacterized protein LOC102579219 [Solanum tuberosum]
Length=397

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 199/221 (90%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ+VEWGSV+LVDAE+RL+ANALLDFSNERFVLLSESCIPVY+FPTVYKYL  S
Sbjct  177  YKRQIPSQHVEWGSVTLVDAEKRLMANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGS  236

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRYN  MKPDIKL +WRKGSQWFEMNR LA+ +VS+TK+Y +F+
Sbjct  237  IHSFVESYDDPSRYGRGRYNRHMKPDIKLPDWRKGSQWFEMNRTLAVRVVSDTKYYDIFR  296

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CYPDEHYIPT+++L HG +NANR+VTYVDWSLGGPHPA+++A NITEGF+Q IR
Sbjct  297  RFCKPACYPDEHYIPTFIRLFHGPLNANRTVTYVDWSLGGPHPAAFSAVNITEGFLQLIR  356

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+C+YN  KT +CYLFARKF PSALEPL  LS KVM F
Sbjct  357  NNGTACAYNSEKTHVCYLFARKFNPSALEPLLNLSSKVMEF  397



>ref|XP_004230423.1| PREDICTED: uncharacterized protein LOC101259085 [Solanum lycopersicum]
Length=406

 Score =   371 bits (953),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ+VEWGSV+LVDAE+RL+ANALLDFSNERFVLLSESCIPVY+FPTVYKYL  S
Sbjct  186  YKRQIPSQHVEWGSVTLVDAEKRLMANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGS  245

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRYN  M+PDIKL +WRKGSQWFEMNR LA+ +VS+TK+Y +F+
Sbjct  246  IHSFVESYDDPSRYGRGRYNRHMRPDIKLPDWRKGSQWFEMNRTLAVRVVSDTKYYDLFE  305

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CYPDEHYIPT ++L HG +NANR+VTYVDWSLGGPHPA+++A NITEGF+Q IR
Sbjct  306  RFCKPACYPDEHYIPTLIRLFHGPLNANRTVTYVDWSLGGPHPAAFSAVNITEGFLQLIR  365

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+C+YN  KT +CYLFARKF PSALEPL  LS KVM +
Sbjct  366  NNGTACAYNSEKTHVCYLFARKFNPSALEPLLNLSSKVMEY  406



>ref|XP_011092268.1| PREDICTED: uncharacterized protein LOC105172507 [Sesamum indicum]
Length=477

 Score =   371 bits (952),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 196/221 (89%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ+VEWGSVSLVDAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYL ES
Sbjct  258  YSRQIPSQHVEWGSVSLVDAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLVES  317

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDPTRYGRGRY+  MKPDI L EWRKGSQWFEM+R LA+ IV++TK+Y +F+
Sbjct  318  AHSFVESYDDPTRYGRGRYSRWMKPDITLSEWRKGSQWFEMHRTLAVKIVADTKYYMLFR  377

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL+  HG +N+NR+VTYVDWS   PHPAS+TAAN+TEGFIQS+R
Sbjct  378  KYCKPSCYPDEHYIPTYLRKFHGALNSNRTVTYVDWSEMAPHPASFTAANVTEGFIQSLR  437

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT CSYN GKT ICYLFARKF PSALEPL   + +VMGF
Sbjct  438  NNGT-CSYNSGKTPICYLFARKFDPSALEPLLSFASQVMGF  477



>ref|XP_007022850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY25472.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=390

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQNVEWG+V L DAERRLLANALLDFSNERFVLLSESCIPVY+FPTVYKYL  S
Sbjct  170  YGRQIPSQNVEWGTVLLADAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T+SF+ESYDDP+RYGRGRY+ +M PDIKL++WRKGSQWFEM+R +AI I+S+TK+Y +F+
Sbjct  230  TYSFVESYDDPSRYGRGRYSRKMLPDIKLYQWRKGSQWFEMHRLVAIYIISDTKYYTLFR  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGPHPA +  ANITEGFIQ+IR
Sbjct  290  KYCRPACYPDEHYIPTFLNMFHGSLNANRSVTWVDWSMGGPHPAMHGGANITEGFIQAIR  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGT CSYN  +T  CYLFARKF PSALE L  LS  VM F
Sbjct  350  KNGTLCSYNEEQTSACYLFARKFAPSALESLLNLSSTVMEF  390



>gb|KJB08617.1| hypothetical protein B456_001G093200 [Gossypium raimondii]
Length=394

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAERRLLANALLDFSNERF+LLSESCIPVY+FPTVYKYL  S
Sbjct  174  YGRQIPSQRVEWGSFLLADAERRLLANALLDFSNERFILLSESCIPVYNFPTVYKYLIGS  233

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T+SF+ESYDDPTRYGRGRYN +M P IKL++WRKGSQWFEM R++A  IVS+TK+Y +FK
Sbjct  234  TYSFVESYDDPTRYGRGRYNRKMLPHIKLYQWRKGSQWFEMQRSVATYIVSDTKYYNLFK  293

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPTYL + HG +NANR++T+VDWS+GGPHPA Y   N+TEGFIQSIR
Sbjct  294  KYCKPACYPDEHYIPTYLNMFHGSLNANRTITWVDWSMGGPHPAKYEGVNVTEGFIQSIR  353

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT CSYN   T +CYLFARKF PSALEPL  LS  VM F
Sbjct  354  NNGTLCSYNDELTSVCYLFARKFAPSALEPLLNLSSTVMNF  394



>ref|XP_002268014.1| PREDICTED: uncharacterized protein LOC100250508 [Vitis vinifera]
Length=379

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI S++VEWG+V+L +AERRLLANALLDFSNERFVLLSESCIP+Y+FP VYKYL  S
Sbjct  156  YKRQIPSKSVEWGTVALAEAERRLLANALLDFSNERFVLLSESCIPIYNFPIVYKYLINS  215

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP+RYGRGRY+  M P+IKL++WRKGSQWFE++R LA+ IV++TK+Y +FK
Sbjct  216  DYSFVESYDDPSRYGRGRYSRNMLPNIKLYQWRKGSQWFELSRELAVNIVADTKYYTLFK  275

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYI T+L + +G +NANRSVT+VDWS+GGPHPA+  AANITEGFIQ++R
Sbjct  276  KYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGPHPATLGAANITEGFIQALR  335

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN  KT +CYLFARKF PSALEPL  L+ KVMGF
Sbjct  336  NNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKVMGF  376



>emb|CBI29648.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI S++VEWG+V+L +AERRLLANALLDFSNERFVLLSESCIP+Y+FP VYKYL  S
Sbjct  186  YKRQIPSKSVEWGTVALAEAERRLLANALLDFSNERFVLLSESCIPIYNFPIVYKYLINS  245

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP+RYGRGRY+  M P+IKL++WRKGSQWFE++R LA+ IV++TK+Y +FK
Sbjct  246  DYSFVESYDDPSRYGRGRYSRNMLPNIKLYQWRKGSQWFELSRELAVNIVADTKYYTLFK  305

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYI T+L + +G +NANRSVT+VDWS+GGPHPA+  AANITEGFIQ++R
Sbjct  306  KYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGPHPATLGAANITEGFIQALR  365

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN  KT +CYLFARKF PSALEPL  L+ KVMGF
Sbjct  366  NNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKVMGF  406



>ref|XP_012066729.1| PREDICTED: uncharacterized protein LOC105629705 [Jatropha curcas]
 gb|KDP42488.1| hypothetical protein JCGZ_00285 [Jatropha curcas]
Length=392

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+NVEWG+V LVDAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYL  S
Sbjct  172  YRRQIPSKNVEWGTVKLVDAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLIGS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+PTRYGRGRYN  M PDI+L++WRKGSQWFE+ RALA+ ++++TK+Y++FK
Sbjct  232  EHSFVESYDEPTRYGRGRYNRNMFPDIQLYQWRKGSQWFEIQRALAVYVLADTKYYSIFK  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGPHPA+Y   N+TE FIQSIR
Sbjct  292  KYCKPACYPDEHYIPTYLNMFHGPLNSNRTVTWVDWSVGGPHPATYWGINVTESFIQSIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +N T CSYN   T +CYLFARKF PSALEPL  L+  VM F
Sbjct  352  NNETQCSYNSEMTSVCYLFARKFHPSALEPLLNLTSTVMEF  392



>ref|XP_002528868.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33542.1| conserved hypothetical protein [Ricinus communis]
Length=282

 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 186/213 (87%), Gaps = 0/213 (0%)
 Frame = -1

Query  781  QNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIES  602
            Q+VEWGSVSLVDAE+RLL+NALLDFSNERFVLLSESCIPVY+FPTVY+YL  S +SF+ES
Sbjct  66   QDVEWGSVSLVDAEKRLLSNALLDFSNERFVLLSESCIPVYNFPTVYRYLIHSEYSFVES  125

Query  601  YDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSC  422
            YDDPTRYGRGRYN +M PDI+L++WRKGSQWFE+ RALA+ +VS+TK+Y++FK+YCRP+C
Sbjct  126  YDDPTRYGRGRYNRKMLPDIRLYQWRKGSQWFEIQRALAVYMVSDTKYYSIFKRYCRPAC  185

Query  421  YPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCS  242
            YPDEHYIPTYL + HG +NANR+VT+VDWS GGPHPA+Y   N+TE FIQSIR+N T CS
Sbjct  186  YPDEHYIPTYLNMFHGSLNANRTVTWVDWSFGGPHPATYMGINVTESFIQSIRNNKTQCS  245

Query  241  YNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
            YN   T +CYLFARKF PSALEPL  L+  V G
Sbjct  246  YNSEMTSVCYLFARKFHPSALEPLLNLTSTVPG  278



>ref|XP_008452226.1| PREDICTED: uncharacterized protein LOC103493307 isoform X2 [Cucumis 
melo]
Length=389

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ V WG+VSL DAERRLLANALLDFSNERFVLLSESCIPVY+F TVY YLT S
Sbjct  169  YRRQIPSQRVSWGTVSLADAERRLLANALLDFSNERFVLLSESCIPVYNFQTVYDYLTNS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE++RALAI IV++TK+Y +FK
Sbjct  229  AHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFELSRALAIYIVADTKYYTLFK  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGPHPA Y  ANITE FI+SIR
Sbjct  289  KFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIR  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  349  NNGTECLYNSEITSVCYLFARKFAPSTLEPLLNLTSSVMKF  389



>ref|XP_011047853.1| PREDICTED: uncharacterized protein LOC105142093 [Populus euphratica]
 ref|XP_011003712.1| PREDICTED: uncharacterized protein LOC105110387 [Populus euphratica]
Length=392

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I S++VEWGSVSLVDAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYL  S
Sbjct  172  YGRMIPSKDVEWGSVSLVDAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLIRS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYD+PTRYGRGRY+ +M PDI L++WRKGSQWFE+ R LA+ IVS+TK+Y +FK
Sbjct  232  EYSFVESYDEPTRYGRGRYSRKMLPDIHLYQWRKGSQWFEIQRDLAVYIVSDTKYYTIFK  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRP CYPDEHYIPTYL + HG +N+NRSVT+VDWS+GGPHPA+Y   NITE FIQSIR
Sbjct  292  KYCRPVCYPDEHYIPTYLNMFHGSLNSNRSVTWVDWSIGGPHPATYGGGNITEDFIQSIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT CSYN   T +CYLFARKF PSAL PL  L+  VM F
Sbjct  352  NNGTQCSYNSEMTSVCYLFARKFAPSALVPLLSLTSTVMEF  392



>ref|XP_008452225.1| PREDICTED: uncharacterized protein LOC103493307 isoform X1 [Cucumis 
melo]
Length=394

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ V WG+VSL DAERRLLANALLDFSNERFVLLSESCIPVY+F TVY YLT S
Sbjct  174  YRRQIPSQRVSWGTVSLADAERRLLANALLDFSNERFVLLSESCIPVYNFQTVYDYLTNS  233

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE++RALAI IV++TK+Y +FK
Sbjct  234  AHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFELSRALAIYIVADTKYYTLFK  293

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGPHPA Y  ANITE FI+SIR
Sbjct  294  KFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIR  353

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  354  NNGTECLYNSEITSVCYLFARKFAPSTLEPLLNLTSSVMKF  394



>ref|XP_006385195.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
 gb|ERP62992.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
Length=392

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I S++VEWGSVSLVDAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYL  S
Sbjct  172  YGRMIPSKDVEWGSVSLVDAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLIRS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYD+PTRYGRGRY+ +M PDI L++WRKGSQWFE+ R LA+ IVS+TK+Y +FK
Sbjct  232  EYSFVESYDEPTRYGRGRYSRKMLPDIHLYQWRKGSQWFEIQRDLAVYIVSDTKYYTIFK  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRP+CYPDEHYIPTYL + HG +N+NRSVT+VDWS+GGPHPA Y   NITE FIQSIR
Sbjct  292  KYCRPACYPDEHYIPTYLNMFHGSLNSNRSVTWVDWSIGGPHPARYGGGNITEDFIQSIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT CSYN   T +CYLFARKF PSAL PL  L+  VM F
Sbjct  352  NNGTQCSYNSEMTSVCYLFARKFAPSALVPLLSLTSTVMEF  392



>gb|KFK43315.1| hypothetical protein AALP_AA1G108500 [Arabis alpina]
Length=409

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  189  YDRQIPSQKVEWGSALLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYTYLINS  248

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR LAI I+S++K+Y++FK
Sbjct  249  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKLAIYIISDSKYYSLFK  308

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITEGF+QSIR
Sbjct  309  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEGFLQSIR  368

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  369  NNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  409



>ref|XP_010065247.1| PREDICTED: uncharacterized protein LOC104452469 [Eucalyptus grandis]
 gb|KCW62594.1| hypothetical protein EUGRSUZ_G00083 [Eucalyptus grandis]
Length=391

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V WG+V LVDAERRLLANALLDFSNERFVLLSESCIPVY+FPTVYKYLT S
Sbjct  171  YGRQIPSQKVAWGTVQLVDAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYKYLTGS  230

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRY+  M P I+LH+WRKGSQWFEM R LA  IVS+TK+Y++F+
Sbjct  231  DHSFVESYDDPSRYGRGRYSRSMLPYIRLHQWRKGSQWFEMTRNLAAYIVSDTKYYSLFE  290

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPTYL + HG  N+NRSVT+VDWSLGGPHPA++  +NITE FI++IR
Sbjct  291  KYCKPACYPDEHYIPTYLNMFHGSKNSNRSVTWVDWSLGGPHPATFRKSNITEDFIRAIR  350

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +N T C YN GKT +CYLFARKF PSAL PL  LS  VM F
Sbjct  351  NNATRCWYNSGKTSLCYLFARKFDPSALVPLLNLSSIVMEF  391



>ref|XP_009800325.1| PREDICTED: uncharacterized protein LOC104246253 isoform X1 [Nicotiana 
sylvestris]
Length=392

 Score =   350 bits (898),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 2/223 (1%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ VEWGSV+LVDAERRLLANALLDFSNERFVLLS+SCIP+Y FPTVYKYL  S
Sbjct  170  YKRQIPSQQVEWGSVTLVDAERRLLANALLDFSNERFVLLSDSCIPLYSFPTVYKYLIGS  229

Query  622  THSFIESYDDPTRYGRGR--YNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAM  449
             HSF+ESYDDP+ YGRGR  YN  M+PDIKL +WRKGSQWFEMNR LA+ IV +TK+Y +
Sbjct  230  IHSFVESYDDPSSYGRGRGRYNHHMQPDIKLSDWRKGSQWFEMNRKLAVRIVLDTKYYNI  289

Query  448  FKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQS  269
            F+KYC P+CYPDEHYIPTY++L +G  NANR+VTYVDWSLG  HPA+++A NITEGFI+S
Sbjct  290  FRKYCTPTCYPDEHYIPTYIRLFYGPSNANRTVTYVDWSLGASHPATFSAVNITEGFIES  349

Query  268  IRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +R+NG +CSYN  K  ICYLFAR F PSAL+PL  LS KV+ F
Sbjct  350  LRNNGAACSYNSEKAHICYLFARMFDPSALKPLLNLSSKVLKF  392



>ref|XP_009601484.1| PREDICTED: uncharacterized protein LOC104096770 [Nicotiana tomentosiformis]
Length=402

 Score =   350 bits (898),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/221 (77%), Positives = 197/221 (89%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ+VEWGSV+LVDAERRLLANALLDFSNERFVLLSESCIPVY+FPTVYKYL  S
Sbjct  182  YKRQIPSQHVEWGSVTLVDAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGS  241

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRYN RMKPDIKL +WRKGSQWFEMNR LA+ +VS+TK+Y MF+
Sbjct  242  IHSFVESYDDPSRYGRGRYNRRMKPDIKLSDWRKGSQWFEMNRTLAVRVVSDTKYYDMFR  301

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            + C P+CYPDEHYIPT+++L +G +NANR+VTYVDWS+GGPHPA++ A NITEGF+QSIR
Sbjct  302  RLCTPACYPDEHYIPTFIRLFYGPLNANRTVTYVDWSVGGPHPATFGAVNITEGFLQSIR  361

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+CSYN  K+ ICYLFARKF PSALEPL  LS  V+ F
Sbjct  362  NNGTACSYNSEKSHICYLFARKFEPSALEPLLNLSSSVLEF  402



>gb|KHN39690.1| hypothetical protein glysoja_020768 [Glycine soja]
Length=266

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ+V WG+V+L DAERRLLANALLDFSNERFVLLSESCIPVY+FPTVY+YLT S
Sbjct  46   YLRHIPSQDVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYRYLTNS  105

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ESYD+PTRYGRGRY+  M P I+L  WRKGSQWFE+NRALA+ IVS+T +Y++F+
Sbjct  106  SLSFVESYDEPTRYGRGRYSRNMLPHIQLRHWRKGSQWFELNRALAVYIVSDTNYYSLFR  165

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GPHPA+Y  ANIT GFIQSIR
Sbjct  166  KYCKPACYPDEHYIPTFLNMFHGSLNSNRTVTWVDWSMLGPHPATYGRANITAGFIQSIR  225

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  226  NNGSLCRYNSEITSICYLFARKFDPSALEPLLNLSSEVMNF  266



>ref|XP_006417483.1| hypothetical protein EUTSA_v10007760mg [Eutrema salsugineum]
 gb|ESQ35836.1| hypothetical protein EUTSA_v10007760mg [Eutrema salsugineum]
Length=413

 Score =   350 bits (898),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERF+LLSESC+PVY+F TVY YL  S
Sbjct  193  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFILLSESCVPVYNFSTVYSYLINS  252

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S+TK+Y++FK
Sbjct  253  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDTKYYSLFK  312

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGPHPA+Y AANITEGF+QSIR
Sbjct  313  QFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGPHPATYDAANITEGFLQSIR  372

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  373  KNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  413



>ref|XP_007148589.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
 gb|ESW20583.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
Length=392

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ+V WG+V+L DAERRLLANALLDFSNERFVLLSESCIP+Y+FPTVY+YLT+S
Sbjct  172  YARQIPSQDVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPIYNFPTVYRYLTDS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDPTRYGRGRY+  M P I+L  WRKGSQWFE+NR+LA+ I+S+TK+Y +F+
Sbjct  232  AHSFVESYDDPTRYGRGRYSRSMLPHIQLRHWRKGSQWFELNRSLAVYIISDTKYYTLFR  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GPHPAS+  ANIT  FIQ+IR
Sbjct  292  KYCKPACYPDEHYIPTFLNMFHGPLNSNRTVTWVDWSMLGPHPASFGRANITAHFIQAIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  352  NNGSLCRYNSEMTSICYLFARKFDPSALEPLLNLSSQVMNF  392



>ref|XP_010273586.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
 ref|XP_010273587.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
Length=405

 Score =   350 bits (897),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 191/221 (86%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ+V+WGSV+L D ERRLLANALLDFSNERFVLLSESCIPVYDF TVYKYL  S
Sbjct  185  YGRQIPSQDVQWGSVTLSDGERRLLANALLDFSNERFVLLSESCIPVYDFLTVYKYLINS  244

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYDDP+RYGRGRY+ +M PDIKL +WRKGSQWFE+NR LA+ IV++ K+Y++F+
Sbjct  245  AYSFVDSYDDPSRYGRGRYSRKMLPDIKLFQWRKGSQWFELNRTLAVNIVADDKYYSLFR  304

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHY+PT+L + +G MNANRSVT+VDWS GGPHPA++   +ITEGFIQSI+
Sbjct  305  KYCKPSCYPDEHYLPTFLNMFYGSMNANRSVTWVDWSRGGPHPATFGKEDITEGFIQSIK  364

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+CSYN  +T +CYLFARKF PSALEPL  L+  V+ F
Sbjct  365  NNGTTCSYNSEQTLVCYLFARKFAPSALEPLLNLTSTVLRF  405



>ref|XP_002892557.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68816.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  192  YDRQIPSQRVEWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYTYLINS  251

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  252  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  311

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITEGF+QSIR
Sbjct  312  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEGFLQSIR  371

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  372  KNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  412



>ref|NP_172499.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAD32878.1|AC005489_16 F14N23.16 [Arabidopsis thaliana]
 gb|ABK32109.1| At1g10280 [Arabidopsis thaliana]
 gb|AEE28561.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38956.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=412

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  192  YDRQIPSQRVEWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYTYLINS  251

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  252  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  311

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITEGF+QSIR
Sbjct  312  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEGFLQSIR  371

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  372  KNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  412



>ref|XP_010490870.1| PREDICTED: uncharacterized protein LOC104768553 isoform X2 [Camelina 
sativa]
 ref|XP_010490885.1| PREDICTED: uncharacterized protein LOC104768578 [Camelina sativa]
Length=415

 Score =   349 bits (895),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  195  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYNYLINS  254

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  255  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  314

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITE F+QSIR
Sbjct  315  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEEFLQSIR  374

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL+PL  LS  VMGF
Sbjct  375  KNETDCLYNDEPTSLCFLFARKFSPSALDPLMNLSSTVMGF  415



>ref|XP_011650577.1| PREDICTED: uncharacterized protein LOC101215808 isoform X2 [Cucumis 
sativus]
Length=389

 Score =   347 bits (891),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ V WG+VSL DAERRLLANALLDFSN+RFVLLSESCIPVY+F TVY+YL  S
Sbjct  169  YRRQIPSQRVSWGTVSLADAERRLLANALLDFSNDRFVLLSESCIPVYNFQTVYEYLINS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE++RALA+ IV++ K+Y +FK
Sbjct  229  AHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFELSRALAVYIVADIKYYTLFK  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGPHPA Y  ANITE FI+SIR
Sbjct  289  KFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIR  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  349  NNGTECLYNSEITYVCYLFARKFAPSTLEPLLNLTSSVMKF  389



>ref|XP_011650576.1| PREDICTED: uncharacterized protein LOC101215808 isoform X1 [Cucumis 
sativus]
 gb|KGN56275.1| hypothetical protein Csa_3G110720 [Cucumis sativus]
Length=394

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ V WG+VSL DAERRLLANALLDFSN+RFVLLSESCIPVY+F TVY+YL  S
Sbjct  174  YRRQIPSQRVSWGTVSLADAERRLLANALLDFSNDRFVLLSESCIPVYNFQTVYEYLINS  233

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE++RALA+ IV++ K+Y +FK
Sbjct  234  AHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFELSRALAVYIVADIKYYTLFK  293

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGPHPA Y  ANITE FI+SIR
Sbjct  294  KFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGPHPAMYGPANITESFIESIR  353

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  354  NNGTECLYNSEITYVCYLFARKFAPSTLEPLLNLTSSVMKF  394



>ref|XP_010490863.1| PREDICTED: uncharacterized protein LOC104768553 isoform X1 [Camelina 
sativa]
Length=415

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  195  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYNYLINS  254

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  255  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  314

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITE F+QSIR
Sbjct  315  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEEFLQSIR  374

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  375  KNETDCLYNDEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  415



>ref|XP_010458365.1| PREDICTED: uncharacterized protein LOC104739637 [Camelina sativa]
Length=419

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  199  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYSYLINS  258

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  259  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  318

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITE F+QSIR
Sbjct  319  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEEFLQSIR  378

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  379  KNETDCLYNDEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  419



>emb|CDX93443.1| BnaA06g06050D [Brassica napus]
Length=384

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLL NALLDFSNERF+LLSESC+PVY+F TVY YL  S
Sbjct  164  YDRQIPSQKVEWGSPLLTDAEKRLLGNALLDFSNERFILLSESCVPVYNFSTVYSYLINS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR LAI I+S++K+Y++FK
Sbjct  224  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKLAIYIISDSKYYSLFK  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGPHPA+Y A NITEGF+QSIR
Sbjct  284  QFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIR  343

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  344  KNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  384



>ref|XP_009791972.1| PREDICTED: uncharacterized protein LOC104239130 [Nicotiana sylvestris]
Length=403

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQ+ SQ+VEWGSV+LVDAERRLLANALLDFSNERFVLLSESCIPVY+FPTVYKYL  S
Sbjct  183  YKRQVPSQHVEWGSVTLVDAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYKYLIGS  242

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRYN RMKPDIKL +WRKGSQWFEMNR LA+ +VS+TK+Y +F+
Sbjct  243  IHSFVESYDDPSRYGRGRYNRRMKPDIKLSDWRKGSQWFEMNRTLAVRVVSDTKYYDIFR  302

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            + C P+CYPDEHYIPT+++L +G +NANR+VTYVDWSLGGPHPA+++A NITEGF++SIR
Sbjct  303  RLCTPACYPDEHYIPTFIRLFYGPLNANRTVTYVDWSLGGPHPATFSAVNITEGFLKSIR  362

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+CSYN  KT +C+LFARKF PSALEPL  LS  V+ F
Sbjct  363  NNGTACSYNYEKTHVCHLFARKFEPSALEPLLNLSSNVLEF  403



>ref|XP_006303228.1| hypothetical protein CARUB_v10012092mg [Capsella rubella]
 gb|EOA36126.1| hypothetical protein CARUB_v10012092mg [Capsella rubella]
Length=411

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  191  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFSTVYTYLINS  250

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  251  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  310

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITEGF+ SIR
Sbjct  311  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEGFLLSIR  370

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  371  KNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  411



>ref|XP_009148352.1| PREDICTED: uncharacterized protein LOC103871798 [Brassica rapa]
Length=414

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERF+LLSESC+PVY+F TVY YL  S
Sbjct  194  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFILLSESCVPVYNFSTVYSYLINS  253

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR LAI I+S++K+Y++FK
Sbjct  254  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKLAIYIISDSKYYSLFK  313

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGPHPA+Y A NITEGF+QSIR
Sbjct  314  QFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIR  373

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  374  KNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  414



>ref|XP_006598780.1| PREDICTED: uncharacterized protein LOC100796634 isoform X1 [Glycine 
max]
 ref|XP_006598781.1| PREDICTED: uncharacterized protein LOC100796634 isoform X2 [Glycine 
max]
 ref|XP_006598782.1| PREDICTED: uncharacterized protein LOC100796634 isoform X3 [Glycine 
max]
 ref|XP_006598783.1| PREDICTED: uncharacterized protein LOC100796634 isoform X4 [Glycine 
max]
 ref|XP_006598784.1| PREDICTED: uncharacterized protein LOC100796634 isoform X5 [Glycine 
max]
 ref|XP_006598785.1| PREDICTED: uncharacterized protein LOC100796634 isoform X6 [Glycine 
max]
Length=394

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ+V WG+V+L DAERRLLANALLDFSNERFVLLSESCIPVY+FPTVY+YLT S
Sbjct  174  YLRHIPSQDVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYRYLTNS  233

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ESYD+PTRYGRGRY+  M P I+L  WRKGSQWFE+NRALA+ IVS+T +Y++F+
Sbjct  234  SLSFVESYDEPTRYGRGRYSRNMLPHIQLRHWRKGSQWFELNRALAVYIVSDTNYYSLFR  293

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GPHPA+Y  ANIT GFIQSIR
Sbjct  294  KYCKPACYPDEHYIPTFLNMFHGSLNSNRTVTWVDWSMLGPHPATYGRANITAGFIQSIR  353

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  354  NNGSLCRYNSEITSICYLFARKFDPSALEPLLNLSSEVMNF  394



>ref|XP_010475888.1| PREDICTED: uncharacterized protein LOC104755237 [Camelina sativa]
Length=407

 Score =   347 bits (889),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+R+LANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  187  YDRQIPSQKVEWGSPLLTDAEKRVLANALLDFSNERFVLLSESCVPVYNFSTVYNYLINS  246

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  247  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  306

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGPHPA+Y AANITE F+QSIR
Sbjct  307  QFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGPHPATYAAANITEEFLQSIR  366

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  367  KNETDCLYNDEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  407



>emb|CDY31036.1| BnaA08g25860D [Brassica napus]
Length=377

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQ+ SQ V WGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  157  YNRQVPSQKVAWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFTTVYSYLINS  216

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  217  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  276

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGPHPA+Y A NITEGF+QSIR
Sbjct  277  KFCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIR  336

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  337  KNDTDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  377



>gb|ABE91847.1| Protein of unknown function DUF266, plant [Medicago truncatula]
 gb|ABE91963.1| Protein of unknown function DUF266, plant [Medicago truncatula]
 gb|KEH36410.1| core-2/I-branching enzyme [Medicago truncatula]
Length=438

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 189/221 (86%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ V WG+V+L DAERRLLANALLDFSNERFVLLSESCIPVY+FPTVY+YL +S
Sbjct  218  YRRNIPSQAVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYRYLIDS  277

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRY+  M PDI+L  WRKGSQWFE+NRALA+ IVS+T+++++F+
Sbjct  278  AHSFVESYDDPSRYGRGRYSRNMLPDIQLKHWRKGSQWFELNRALAVYIVSDTQYFSLFR  337

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHY+PT+L + HG +N+NR+VT+VDWS+ GPHPA+Y   NIT GFIQ+IR
Sbjct  338  KYCKPACYPDEHYLPTFLNMFHGSLNSNRTVTWVDWSMLGPHPATYGRDNITVGFIQAIR  397

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  398  NNGSLCPYNSDMTSICYLFARKFDPSALEPLLDLSSEVMNF  438



>emb|CDX94911.1| BnaC05g07600D [Brassica napus]
Length=385

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWGS  L DAE+RLLANALLDFSNERF+LLSESC+PVY+F TVY YL  S
Sbjct  165  YDRQIPSQKVEWGSPLLTDAEKRLLANALLDFSNERFILLSESCVPVYNFSTVYSYLINS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR LAI I+S++K+Y +FK
Sbjct  225  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKLAIYIISDSKYYLLFK  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGPHPA+Y A NITEGF+QSIR
Sbjct  285  LFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIR  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  345  KNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  385



>ref|XP_009800326.1| PREDICTED: uncharacterized protein LOC104246253 isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   345 bits (886),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 3/223 (1%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ VEWGSV+LVDAERRLLANALLDFSNERFVLLS+SCIP+Y FPTVYKYL  S
Sbjct  170  YKRQIPSQ-VEWGSVTLVDAERRLLANALLDFSNERFVLLSDSCIPLYSFPTVYKYLIGS  228

Query  622  THSFIESYDDPTRYGRGR--YNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAM  449
             HSF+ESYDDP+ YGRGR  YN  M+PDIKL +WRKGSQWFEMNR LA+ IV +TK+Y +
Sbjct  229  IHSFVESYDDPSSYGRGRGRYNHHMQPDIKLSDWRKGSQWFEMNRKLAVRIVLDTKYYNI  288

Query  448  FKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQS  269
            F+KYC P+CYPDEHYIPTY++L +G  NANR+VTYVDWSLG  HPA+++A NITEGFI+S
Sbjct  289  FRKYCTPTCYPDEHYIPTYIRLFYGPSNANRTVTYVDWSLGASHPATFSAVNITEGFIES  348

Query  268  IRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +R+NG +CSYN  K  ICYLFAR F PSAL+PL  LS KV+ F
Sbjct  349  LRNNGAACSYNSEKAHICYLFARMFDPSALKPLLNLSSKVLKF  391



>ref|XP_009144462.1| PREDICTED: uncharacterized protein LOC103868108 isoform X2 [Brassica 
rapa]
Length=404

 Score =   345 bits (886),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQ+ SQ V WGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  184  YNRQVPSQKVAWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFTTVYSYLINS  243

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  244  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIISDSKYYSLFK  303

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGPHPA+Y A NITEGF+QSIR
Sbjct  304  KFCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIR  363

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  364  KNDTDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  404



>ref|XP_004503748.1| PREDICTED: uncharacterized protein LOC101509636 isoform X1 [Cicer 
arietinum]
Length=420

 Score =   346 bits (887),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 187/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ V WG+V+L DAERRLLANALLDFSNERFVLLSESCIPVY+FPTVYKYLT S
Sbjct  200  YQRNIPSQAVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYKYLTNS  259

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRY+  M PDI+L  WRKGSQWFE+ RALA+ IVS+T++Y++F+
Sbjct  260  AHSFVESYDDPSRYGRGRYSRSMLPDIQLKHWRKGSQWFELKRALAVYIVSDTRYYSLFR  319

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + H  +N+NR+VT+VDWS+ GPHPA+Y   NIT GFIQ+IR
Sbjct  320  KYCKPACYPDEHYIPTFLNMFHASLNSNRTVTWVDWSMLGPHPATYGRDNITVGFIQAIR  379

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T +CYLFARKF P+ALEPL  LS +VM F
Sbjct  380  NNGSLCGYNSDTTSLCYLFARKFDPTALEPLLNLSSEVMNF  420



>emb|CDY20644.1| BnaC08g14140D [Brassica napus]
Length=390

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQ+ SQ V WGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F TVY YL  S
Sbjct  170  YDRQVPSQKVAWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFTTVYSYLINS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S++K+Y++FK
Sbjct  230  AYSFVDSYDEPTRYGRGRYSRKMLPDIKLHNWRKGSQWFEVNRKIAIYIISDSKYYSLFK  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YCRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGPHPA+Y A NITEGF+QSIR
Sbjct  290  QYCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNITEGFLQSIR  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  350  KNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  390



>ref|XP_008218660.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218661.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218662.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
Length=393

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V WG+V+LVDAERRLL+NALLDFSN+RFVLLSESCIPVY+FPTVYKYL  S
Sbjct  173  YGRQIPSQLVSWGTVTLVDAERRLLSNALLDFSNQRFVLLSESCIPVYNFPTVYKYLIGS  232

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP RYGRGRY+ +M P+I+L++WRKGSQWFE++R LAI IVSETK+Y +F 
Sbjct  233  NHSFVESYDDPGRYGRGRYSRKMLPEIELYQWRKGSQWFELSRTLAIYIVSETKYYTLFS  292

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P+CYPDEHY+PTY  + HG +N+NR+VT+VDWSLGGPHPA+Y   NITE F++SIR
Sbjct  293  RYCMPACYPDEHYMPTYFNMFHGSLNSNRTVTWVDWSLGGPHPATYGGDNITEDFVRSIR  352

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG  C YN   T ICYLFARKF PSALEPL +L+  VM F
Sbjct  353  NNGALCQYNSEMTSICYLFARKFAPSALEPLLELASSVMEF  393



>gb|KHN11046.1| hypothetical protein glysoja_044070, partial [Glycine soja]
Length=308

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ+V WG+ +L DAERRLLANALLDFSNERF+LLSE+CIPVYDFPTVY+YLT S
Sbjct  88   YLRNIPSQDVSWGTFTLADAERRLLANALLDFSNERFLLLSETCIPVYDFPTVYRYLTHS  147

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ESYD+PTRYGRGRY+  M P I L  WRKGSQWFE+NR+LA+ IVS+TK+Y++F+
Sbjct  148  SLSFVESYDEPTRYGRGRYSRHMLPHIHLRHWRKGSQWFELNRSLAVYIVSDTKYYSLFR  207

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GPHPA++  ANIT  F+QSIR
Sbjct  208  KYCKPACYPDEHYIPTFLHMFHGSLNSNRTVTWVDWSMLGPHPATFGRANITAAFLQSIR  267

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  268  NNGSLCPYNSEMTSICYLFARKFDPSALEPLLNLSSEVMNF  308



>ref|XP_007221893.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
 gb|EMJ23092.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
Length=393

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V WG+V+LVDAERRLL+NALLDFSN+RFVLLSESCIPVY+FPTVYKYL  S
Sbjct  173  YGRQIPSQLVSWGTVTLVDAERRLLSNALLDFSNQRFVLLSESCIPVYNFPTVYKYLIGS  232

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP RYGRGRY+ +M P+I+L++WRKGSQWFE++R LAI IVSETK+Y +F 
Sbjct  233  NHSFVESYDDPGRYGRGRYSRKMLPEIELYQWRKGSQWFELSRTLAIYIVSETKYYTLFS  292

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P+CYPDEHY+PTY  + HG +N+NR+VT+VDWSLGGPHPA+Y   NITE F++SIR
Sbjct  293  RYCLPACYPDEHYMPTYFNMFHGSLNSNRTVTWVDWSLGGPHPATYGGDNITEDFVRSIR  352

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++G  C YN   T ICYLFARKF PSALEPL +L+  VM F
Sbjct  353  NSGALCQYNSEMTSICYLFARKFAPSALEPLLELASSVMEF  393



>ref|XP_010682059.1| PREDICTED: uncharacterized protein LOC104896962 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 183/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S+ V WG+VSL DAE+RLLANALLDFSNERFVLLSESCIP+Y+F TVYKYLTES
Sbjct  201  FGRQIPSKEVSWGNVSLADAEKRLLANALLDFSNERFVLLSESCIPIYNFQTVYKYLTES  260

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            TH+F+ESYDDPTR+GRGRY+  M+P I + +WRKG+QWFE+NRAL I I+S+ K+Y +F+
Sbjct  261  THTFVESYDDPTRFGRGRYDRHMRPSIMIDQWRKGAQWFEINRALGIEIISDYKYYDLFR  320

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC P C+PDEHYIPTYL + H   N+NR++T VDWSLGGPHP ++   NITEGFIQ+IR
Sbjct  321  KYCHPPCFPDEHYIPTYLNIFHAPFNSNRTLTKVDWSLGGPHPTTFVRDNITEGFIQNIR  380

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +N   C YN   T +CYLFARKF PSALEPL  LSLKVMGF
Sbjct  381  NNKKKCLYNSKSTTVCYLFARKFAPSALEPLLDLSLKVMGF  421



>ref|XP_004503749.1| PREDICTED: uncharacterized protein LOC101509636 isoform X2 [Cicer 
arietinum]
Length=350

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -1

Query  784  SQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIE  605
            SQ V WG+V+L DAERRLLANALLDFSNERFVLLSESCIPVY+FPTVYKYLT S HSF+E
Sbjct  136  SQAVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPVYNFPTVYKYLTNSAHSFVE  195

Query  604  SYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPS  425
            SYDDP+RYGRGRY+  M PDI+L  WRKGSQWFE+ RALA+ IVS+T++Y++F+KYC+P+
Sbjct  196  SYDDPSRYGRGRYSRSMLPDIQLKHWRKGSQWFELKRALAVYIVSDTRYYSLFRKYCKPA  255

Query  424  CYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSC  245
            CYPDEHYIPT+L + H  +N+NR+VT+VDWS+ GPHPA+Y   NIT GFIQ+IR+NG+ C
Sbjct  256  CYPDEHYIPTFLNMFHASLNSNRTVTWVDWSMLGPHPATYGRDNITVGFIQAIRNNGSLC  315

Query  244  SYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             YN   T +CYLFARKF P+ALEPL  LS +VM F
Sbjct  316  GYNSDTTSLCYLFARKFDPTALEPLLNLSSEVMNF  350



>ref|XP_003540132.1| PREDICTED: uncharacterized protein LOC100793763 [Glycine max]
Length=383

 Score =   339 bits (870),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ+V WG+ +L DAERRLLANALLDFSNERF+LLSE+CIPVYDFPTVY+YLT S
Sbjct  163  YLRNIPSQDVSWGTFTLADAERRLLANALLDFSNERFLLLSETCIPVYDFPTVYRYLTHS  222

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ESYD+PTRYGRGRY+  M P I L  WRKGSQWFE+NR+LA+ IVS+TK+Y++F+
Sbjct  223  SLSFVESYDEPTRYGRGRYSRHMLPHIHLRHWRKGSQWFELNRSLAVYIVSDTKYYSLFR  282

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GPHPA++  ANIT  F+QSIR
Sbjct  283  KYCKPACYPDEHYIPTFLHMFHGSLNSNRTVTWVDWSMLGPHPATFGRANITAAFLQSIR  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  343  NNGSLCPYNSEMTSICYLFARKFDPSALEPLLNLSSEVMNF  383



>emb|CAN60261.1| hypothetical protein VITISV_020168 [Vitis vinifera]
Length=430

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  781  QNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIES  602
            Q VEWG+V+L +AERRLLANALLDFSNERFVLLSESCIP+Y+FP VYKYL  S +SF+ES
Sbjct  194  QXVEWGTVALAEAERRLLANALLDFSNERFVLLSESCIPIYNFPIVYKYLINSDYSFVES  253

Query  601  YDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSC  422
            YDDP+RYGRGRY+  M PDIKL++WRKGSQWFE++R LA+ IV++TK+Y +FKKYC+PSC
Sbjct  254  YDDPSRYGRGRYSRNMLPDIKLYQWRKGSQWFELSRELAVNIVADTKYYTLFKKYCKPSC  313

Query  421  YPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCS  242
            YPDEHYI T+L + +G +NANRSVT+VDWS+GGPHPA+  AANITEGFIQ++R+NGT C 
Sbjct  314  YPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGPHPATLGAANITEGFIQALRNNGTVCP  373

Query  241  YNRGKTQICYLFARKFFPSALEPLEKLSLKVM  146
            YN  KT +CYLFARKF PSALEPL  L+ K++
Sbjct  374  YNSEKTSVCYLFARKFAPSALEPLLNLTSKML  405



>ref|XP_008357658.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357660.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357661.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357662.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
 ref|XP_008357663.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
 ref|XP_008357664.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
Length=390

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ V WG+V+LVDAERRLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYL  S
Sbjct  170  YQRQIPSQPVSWGTVTLVDAERRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLIGS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HS++ESYD+P RYGRGRY+  M PDI+L++WRKGSQWFE++RAL++  VSETK+Y +F 
Sbjct  230  NHSYVESYDNPGRYGRGRYSREMFPDIQLYQWRKGSQWFELSRALSVYJVSETKYYTIFS  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC P+CYPDEHY+PTY  + HG++N+NR+VT+VDWSLGGPHPA+Y   NITE F++SIR
Sbjct  290  KYCLPACYPDEHYLPTYFNMFHGWLNSNRTVTWVDWSLGGPHPATYGGDNITEDFVRSIR  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG  C YN   T ICYLFARKF P+AL PL + +  VM +
Sbjct  350  NNGALCQYNAEMTSICYLFARKFAPTALGPLLEFAASVMEY  390



>ref|XP_011028389.1| PREDICTED: uncharacterized protein LOC105128426 [Populus euphratica]
Length=392

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 182/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R+I S++VEWGS+S+VDAE+RLLANALLDFSNERFVLLSESCIP+Y F  VYKYL  S
Sbjct  172  YGRKIPSKDVEWGSISMVDAEKRLLANALLDFSNERFVLLSESCIPIYKFSIVYKYLIRS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD PTRY RGRYN +M PDI L++WRKGSQWFE+ R LA+ +VS+TK++ +FK
Sbjct  232  KHSFVESYDAPTRYARGRYNQKMLPDIHLYQWRKGSQWFEIQRELAVYLVSDTKYHTIFK  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRP+CYPDEHYIPTYL + HG +NANR+VT+VDWS+  PHP +Y   +ITEGFIQSIR
Sbjct  292  KYCRPACYPDEHYIPTYLNMFHGSLNANRTVTWVDWSIVAPHPPTYDGIDITEGFIQSIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G  CSYN   T +CYLFARKF PSAL PL  L+  VMGF
Sbjct  352  NKGNHCSYNSEMTSVCYLFARKFAPSALVPLLNLTSTVMGF  392



>ref|XP_006385074.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
 gb|ERP62871.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
Length=392

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 182/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R+I S++VEWGS+S+VDAE+RLLANALLDFSNERFVLLSESCIP+Y F  VYKYL  S
Sbjct  172  YGRKIPSKDVEWGSISMVDAEKRLLANALLDFSNERFVLLSESCIPIYKFSIVYKYLIRS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD PTRY RGRYN +M PDI L++WRKGSQWFE+ R LA+ +VS+TK++ +FK
Sbjct  232  KHSFVESYDAPTRYARGRYNQKMLPDIHLYQWRKGSQWFEIQRDLAVYLVSDTKYHTIFK  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRP+CYPDEHYIPTYL + HG +NANR+VT+VDWS+  PHP +Y   ++TEGFIQSIR
Sbjct  292  KYCRPACYPDEHYIPTYLNMFHGSLNANRTVTWVDWSIVAPHPPTYDGIDVTEGFIQSIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G  CSYN   T +CYLFARKF PSAL PL  L+  VMGF
Sbjct  352  NKGNQCSYNSEMTSVCYLFARKFAPSALVPLLNLTSTVMGF  392



>ref|XP_009355369.1| PREDICTED: uncharacterized protein LOC103946396 [Pyrus x bretschneideri]
 ref|XP_009355370.1| PREDICTED: uncharacterized protein LOC103946396 [Pyrus x bretschneideri]
Length=390

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ V WG+V+LVDAERRLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYL  S
Sbjct  170  YQRQIPSQPVSWGTVTLVDAERRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLIGS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HS++ESYD+P RYGRGRY+  M PDI+L++WRKGSQWFE++RAL++ IVSET++Y +F 
Sbjct  230  NHSYVESYDNPGRYGRGRYSREMFPDIQLYQWRKGSQWFELSRALSVYIVSETRYYTIFS  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC P+CYPDEHY+PTY  + HG++N+NR+VT+VDWSLGGPHPA+Y   NITE F++SIR
Sbjct  290  KYCLPACYPDEHYLPTYFNMFHGWLNSNRTVTWVDWSLGGPHPATYGGDNITEDFVRSIR  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG  C YN   T ICYLFARKF P+AL PL + +  VM +
Sbjct  350  NNGALCQYNAEMTSICYLFARKFAPTALGPLLEFAASVMEY  390



>ref|XP_009414639.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414640.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   338 bits (866),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGSV+LVDAE+RLLANALLDFSNERF+LLSESCIPVY+FPTVY+YL  S
Sbjct  166  YGRQIPSEEVSWGSVTLVDAEKRLLANALLDFSNERFILLSESCIPVYNFPTVYEYLINS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+ ++ GRGRY+  M P IKLH+WRKGS+WFE+NR LA+ +V++ K+Y++F 
Sbjct  226  AHSFVESYDENSQQGRGRYSRHMFPTIKLHQWRKGSEWFELNRELAVNVVADYKYYSIFS  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPT+L + HG +NANR++T+VDWS GGPHPA+Y A NIT  FIQSIR
Sbjct  286  KYCKPSCYPDEHYIPTFLNMFHGSLNANRTITWVDWSRGGPHPATYGAPNITPDFIQSIR  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGTSC YN   T +C+LFARKF PS+L+PL  L+  VMGF
Sbjct  346  NNGTSCMYNSRPTSVCFLFARKFAPSSLDPLLNLTSTVMGF  386



>ref|XP_006431491.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
 gb|ESR44731.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
Length=393

 Score =   337 bits (865),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 187/222 (84%), Gaps = 1/222 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+NV WG+V + DAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYLT S
Sbjct  172  YGRQIPSRNVGWGTVEMADAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM R +AI I+S+TK+ ++F+
Sbjct  232  PYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLSLFR  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GPHPA Y   NITE FIQS+R
Sbjct  292  KYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGPHPAMYKKENITEEFIQSLR  351

Query  262  -SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             SNG+ C YN  +T  CYLFARKF P+ LEPL K+S KVM F
Sbjct  352  NSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSKVMEF  393



>ref|XP_009144461.1| PREDICTED: uncharacterized protein LOC103868108 isoform X1 [Brassica 
rapa]
Length=413

 Score =   338 bits (866),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 184/230 (80%), Gaps = 9/230 (4%)
 Frame = -1

Query  802  YKRQIKSQ---------NVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFP  650
            Y RQ+ SQ          V WGS  L DAE+RLLANALLDFSNERFVLLSESC+PVY+F 
Sbjct  184  YNRQVPSQASFFTKLGLKVAWGSPLLTDAEKRLLANALLDFSNERFVLLSESCVPVYNFT  243

Query  649  TVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVS  470
            TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+NR +AI I+S
Sbjct  244  TVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEVNRKIAIYIIS  303

Query  469  ETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANI  290
            ++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGPHPA+Y A NI
Sbjct  304  DSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGPHPATYGADNI  363

Query  289  TEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            TEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  364  TEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  413



>ref|XP_009399147.1| PREDICTED: uncharacterized protein LOC103983624 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V WGS++L+DAE+RLLANALLDFSNERFVLLSESCIPVY FPTVY+YL  S
Sbjct  167  YGRQIPSQEVSWGSITLLDAEKRLLANALLDFSNERFVLLSESCIPVYSFPTVYEYLVNS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF++SYD   +  RGRYN RM P IKL +WRKGS+WFE+NR LAI IV+E  +Y++F+
Sbjct  227  AHSFVDSYDKDIQQARGRYNWRMSPKIKLSQWRKGSEWFELNRGLAIDIVAEHTYYSLFR  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG +NANRSVT+VDWS GG HPA Y AANIT  FIQSIR
Sbjct  287  KYCKPSCYPDEHYIPTYLNMFHGSLNANRSVTWVDWSRGGSHPARYGAANITVEFIQSIR  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGTSC YN   T +C+LFARKF PSAL PL  +S  VMGF
Sbjct  347  NNGTSCMYNSRSTSVCFLFARKFAPSALAPLLNVSSTVMGF  387



>gb|ACU18530.1| unknown [Glycine max]
Length=383

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ+V WG+ +L DAERRL+ANALLDFSNERF+LLSE+CIPVYDFPTVY+YLT S
Sbjct  163  YLRNIPSQDVSWGTFTLADAERRLVANALLDFSNERFLLLSETCIPVYDFPTVYRYLTHS  222

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ESYD+PTRYGRGRY+  M P I L  WRKGSQWFE+NR+LA+ IVS+TK+Y++F+
Sbjct  223  SLSFVESYDEPTRYGRGRYSRHMLPHIHLRHWRKGSQWFELNRSLAVYIVSDTKYYSLFR  282

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P+CYPDEHYIPT+L + HG +N+NR+ T+VDWS+ GPHPA++  ANIT  F+QSIR
Sbjct  283  KYCKPACYPDEHYIPTFLHMFHGSLNSNRTDTWVDWSMLGPHPATFGRANITAAFLQSIR  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  343  NNGSLCPYNSEMTSICYLFARKFDPSALEPLLNLSSEVMNF  383



>gb|EPS73540.1| hypothetical protein M569_01216 [Genlisea aurea]
Length=466

 Score =   337 bits (865),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = -1

Query  799  KRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTEST  620
            +RQI SQ+VEWGS+SLVDAE+RLLANALLDFSNERFVL+SESCIP+YDF TVY+YL  S 
Sbjct  246  QRQIPSQHVEWGSISLVDAEKRLLANALLDFSNERFVLVSESCIPIYDFKTVYRYLVGSK  305

Query  619  HSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKK  440
             SFI+SYDDP+R GRGRY++ MKP ++L EWRKGS+WFEM+R LA+ IVSETK+Y++F++
Sbjct  306  QSFIQSYDDPSRQGRGRYSSWMKPYVRLSEWRKGSEWFEMHRDLAVRIVSETKYYSVFRR  365

Query  439  YCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRS  260
            YC+PSCYPDEHYIPTY+   +G +NANRSVTYVDWSL GPHPA++TAAN+T GFI+S+RS
Sbjct  366  YCKPSCYPDEHYIPTYVAKFYGILNANRSVTYVDWSLMGPHPATFTAANVTRGFIESLRS  425

Query  259  NGT-SCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            N T  CSYN G T +C+LFARKF   AL+PL  ++   MGF
Sbjct  426  NATRRCSYNAGTTPVCFLFARKFDSGALQPLLDVASGTMGF  466



>ref|XP_010927836.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927837.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927838.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
Length=388

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGSV+LVDAE+RLLANALLDFSNERFVLLSESCIPVY+FPTVY+YL  S
Sbjct  168  YGRQIPSEEVSWGSVTLVDAEKRLLANALLDFSNERFVLLSESCIPVYNFPTVYEYLINS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+ +  GRGRYN  M P IKL++WRKGS+WFE+NR LA+ +V++ K+YA+F+
Sbjct  228  EHSFVESYDEDSPQGRGRYNRYMAPHIKLYQWRKGSEWFELNRELAVTMVADYKYYALFR  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GGPHPA+Y A +IT GFIQ+IR
Sbjct  288  KYCKPSCYPDEHYIPTYLNMFHGSLNANRSLTWVDWSRGGPHPATYGAPSITAGFIQAIR  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T IC+LFARKF P+ALE L  L+  VM F
Sbjct  348  NNGTFCMYNSRPTSICFLFARKFAPNALESLLNLTSTVMDF  388



>ref|XP_009410706.1| PREDICTED: uncharacterized protein LOC103992641 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 181/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPVY+FPTVY+YL  S
Sbjct  171  YGRQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVYNFPTVYEYLINS  230

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+ TR GRGRY+ RM P I L++WRKGS+WFE+NR LA  IV+E K+Y +F+
Sbjct  231  AHSFVESYDENTRQGRGRYSWRMAPKIMLYQWRKGSEWFELNRELATNIVAEHKYYPLFR  290

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GG HPA Y A NIT  FIQSIR
Sbjct  291  KYCKPSCYPDEHYIPTYLNMFHGALNANRSLTWVDWSRGGSHPARYGAPNITVEFIQSIR  350

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T IC+LFARKF PSAL PL  L+  VMGF
Sbjct  351  NNGTFCLYNSVPTSICFLFARKFAPSALAPLLNLTSTVMGF  391



>gb|KDO42566.1| hypothetical protein CISIN_1g039454mg, partial [Citrus sinensis]
Length=214

 Score =   327 bits (839),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -1

Query  778  NVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESY  599
            NV WG+V + DAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYLT S +SF+ESY
Sbjct  1    NVGWGTVEMADAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESY  60

Query  598  DDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCY  419
            DDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM R +AI I+S+TK+  +F+KYC+PSCY
Sbjct  61   DDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLTLFRKYCKPSCY  120

Query  418  PDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR-SNGTSCS  242
            PDEHYIPTYL + HG + ANRSVT+VDWS+ GPHPA Y   NITE FIQS+R SNG+ C 
Sbjct  121  PDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGPHPAMYKKENITEEFIQSLRNSNGSLCL  180

Query  241  YNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            YN  +T  CYLFARKF P+ LEPL K+S KVM F
Sbjct  181  YNEQRTSRCYLFARKFAPNTLEPLLKISSKVMEF  214



>gb|EYU33292.1| hypothetical protein MIMGU_mgv1a007588mg [Erythranthe guttata]
Length=402

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 194/221 (88%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQNV+WGSVSLVDAE+RLLANALLDFSNERFVLLSE CIP+Y+F TV+KYLTES
Sbjct  182  YRRQIPSQNVQWGSVSLVDAEKRLLANALLDFSNERFVLLSERCIPIYNFATVHKYLTES  241

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI+SYDDP+RYGRGRYN RM+PDI+L EWRKGSQWFE +R LA+ IV++ K+Y++F+
Sbjct  242  LHSFIDSYDDPSRYGRGRYNRRMQPDIRLAEWRKGSQWFEAHRTLAVKIVADFKYYSIFR  301

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRPSCYPDEHYIPTY++  +G +N+NRS+TYVDWS+ GPHPA++TA NIT  F+Q +R
Sbjct  302  KYCRPSCYPDEHYIPTYVRKFYGALNSNRSLTYVDWSMMGPHPATFTAVNITTQFLQLLR  361

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT CSYN  KT ICYLFARKF  SALEPL  +S +VMGF
Sbjct  362  NNGTMCSYNSEKTNICYLFARKFDESALEPLLSISSQVMGF  402



>ref|XP_010682058.1| PREDICTED: uncharacterized protein LOC104896961 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 190/221 (86%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI SQ V WG +SL DAE+RLLANALLDFSNERFVL+SESCIPVY+F TVYKY+TES
Sbjct  205  FGRQIPSQKVSWGDISLADAEKRLLANALLDFSNERFVLISESCIPVYNFQTVYKYITES  264

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP+RYGRGRY+ RM PDIKL +WRKGSQWFE+ R+LAI I+S+ K+Y +F+
Sbjct  265  VHSFVESYDDPSRYGRGRYSRRMGPDIKLRQWRKGSQWFEITRSLAIEIISDYKYYDLFR  324

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC PSCYPDEHYIPTYLQ+ H  +N+NR+VT+VDWSLGGPHPAS+   NITEGFIQ+IR
Sbjct  325  KYCHPSCYPDEHYIPTYLQIFHPLLNSNRTVTWVDWSLGGPHPASFGRENITEGFIQNIR  384

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN  +T ICYLFARKF PSALEPL  +S KVMGF
Sbjct  385  NNGTECWYNFQRTPICYLFARKFDPSALEPLLNISSKVMGF  425



>ref|XP_010553652.1| PREDICTED: uncharacterized protein LOC104823674 [Tarenaya hassleriana]
Length=402

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R I SQ VEWG+  L DAE+RLLANALLDFSNERF+LLSESCIP+++FPTVY+YL  S
Sbjct  183  HGRLIPSQRVEWGTALLTDAEKRLLANALLDFSNERFLLLSESCIPIHNFPTVYRYLIGS  242

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYD+PTRYGRGRY+ +M P IKLH+WRKGSQWFE NR +A  I+S+TK+Y++FK
Sbjct  243  NYSFVESYDEPTRYGRGRYSRKMLPHIKLHQWRKGSQWFEANRKIATYIISDTKYYSLFK  302

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRP+CYPDEHYIPT+L + HG  NANR+VT+VDWS GGPHPA Y A NITE FIQ IR
Sbjct  303  KYCRPACYPDEHYIPTFLNMFHGSDNANRTVTWVDWSFGGPHPARYNAENITESFIQQIR  362

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SNG SC YN   T +CYLFARKF P+AL PL  LS  VM F
Sbjct  363  SNG-SCLYNGEVTSLCYLFARKFAPNALAPLMNLSSTVMEF  402



>ref|XP_008812747.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
 ref|XP_008812748.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
Length=388

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S  V WGSVSLVDAE+RLLANALLDFSNERFVLLSESCIPVY+FPTVY+YL  S
Sbjct  168  YGRQIPSGEVSWGSVSLVDAEKRLLANALLDFSNERFVLLSESCIPVYNFPTVYEYLINS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+ +  GRGRY+  M P IKL++WRKGS+WFE+NR LA+ +V++ K+Y +F+
Sbjct  228  EHSFVESYDEDSPQGRGRYSRYMAPHIKLYQWRKGSEWFELNRELAVTVVADYKYYTLFR  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRPSCYPDEHYIPTYL + HG +NANRSVT+VDWS GGPHPA Y A  IT  FIQ+IR
Sbjct  288  KYCRPSCYPDEHYIPTYLNMFHGSLNANRSVTWVDWSRGGPHPARYGAPTITAEFIQAIR  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T IC+LFARKF P+ALE L  L+  VMGF
Sbjct  348  NNGTFCMYNSRPTSICFLFARKFAPNALESLLNLTSSVMGF  388



>ref|XP_006836850.1| PREDICTED: uncharacterized protein LOC18427741 [Amborella trichopoda]
 gb|ERM99703.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
Length=401

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 183/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V+WG++++ D ERRLLANALLDFSNERFVLLSESCIP+Y+FPTVY YL  S
Sbjct  181  YGRQIPSQEVKWGTINMADGERRLLANALLDFSNERFVLLSESCIPMYNFPTVYNYLITS  240

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF++SYDDP+RYGRGRY+  M PDIKLH+WRKGSQWFE +R +A+ IVS++K+Y +FK
Sbjct  241  KESFVDSYDDPSRYGRGRYSRNMAPDIKLHQWRKGSQWFEAHRDVAVNIVSDSKYYTIFK  300

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + +G +N+NRSVT+VDWS GGPHPA++   +ITE FI +IR
Sbjct  301  KYCKPSCYPDEHYIPTYLNMFYGSLNSNRSVTWVDWSRGGPHPATFGGPDITEDFIFAIR  360

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+C +N   T +CYLFARKF PSAL PL  LS  VM F
Sbjct  361  NNGTTCFHNSEPTSLCYLFARKFAPSALGPLLNLSSTVMEF  401



>ref|XP_006470991.1| PREDICTED: uncharacterized protein LOC102625510 isoform X2 [Citrus 
sinensis]
Length=392

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 183/219 (84%), Gaps = 1/219 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+NV WG+V + DAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYLT S
Sbjct  172  YGRQIPSRNVGWGTVEMADAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM R +AI I+S+TK+  +F+
Sbjct  232  PYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLTLFR  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GPHP  Y   NITE FIQS+R
Sbjct  292  KYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGPHPVMYKKENITEQFIQSLR  351

Query  262  -SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  149
             SNG+ C YN  +T  CYLFARKF P+ LEPL K+S KV
Sbjct  352  NSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSKV  390



>ref|XP_004301567.1| PREDICTED: uncharacterized protein LOC101308879 [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 183/221 (83%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R+I SQ V WGSV+LVDAERRLLANALLDFSNERF+LLSESCIPVY+FPTVYKYLT S
Sbjct  187  YRREIPSQPVSWGSVTLVDAERRLLANALLDFSNERFILLSESCIPVYNFPTVYKYLTGS  246

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDD  R+GRGRY+ RM PDI+L++WRKGSQWFE++R LA IIV++ ++Y +F 
Sbjct  247  KYSFVESYDDAGRFGRGRYSRRMLPDIQLYQWRKGSQWFELSRTLAAIIVADVRYYTVFS  306

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC P+CYPDEHY+ TY  + HG +N+NR+VT+VDWS+GGPHPA Y   N+TE F++SIR
Sbjct  307  KYCLPACYPDEHYMATYFNMFHGSLNSNRTVTWVDWSVGGPHPAMYGGENVTEDFVRSIR  366

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG  C YN   T IC LFARKF P+ALEPL +L+  VM F
Sbjct  367  NNGALCQYNSEMTSICNLFARKFAPTALEPLLELASSVMEF  407



>ref|XP_006659748.1| PREDICTED: uncharacterized protein LOC102714034 [Oryza brachyantha]
Length=372

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 181/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  152  YARQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  211

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ IV++ K+Y++F+
Sbjct  212  AHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFELNRELAVQIVADNKYYSIFR  271

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR+VT+VDWS GGPHPA Y AANITE FIQ+IR
Sbjct  272  KHCRPSCYPDEHYIPTYLHLFHGSLNANRTVTWVDWSRGGPHPARYGAANITEEFIQAIR  331

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGTSC+YN   T +CYLFARKF PSAL PL  L+  V+ F
Sbjct  332  NNGTSCTYNSKPTSLCYLFARKFAPSALGPLMNLTSTVLDF  372



>ref|XP_010907977.1| PREDICTED: uncharacterized protein LOC105034483 [Elaeis guineensis]
Length=388

 Score =   329 bits (844),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 182/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S  V WGSV+LVDAE+RLLANALLDFSNERFVLLSESCIP+Y+FP VY+YL  S
Sbjct  168  YGRQIPSLEVSWGSVTLVDAEKRLLANALLDFSNERFVLLSESCIPIYNFPAVYEYLINS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+ +  GRGRY   M P IKL++WRKGS+WFE+NR LA+ IV++ K+YA+F+
Sbjct  228  HHSFVESYDEDSLQGRGRYRRGMSPHIKLYQWRKGSEWFELNRELAVTIVADYKYYAIFR  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GGPHPA Y A+N+T  FIQ++R
Sbjct  288  KHCKPSCYPDEHYIPTYLNMFHGSLNANRSLTWVDWSRGGPHPARYGASNVTPEFIQALR  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T IC+LFARKF P+ALEPL  L+  VMGF
Sbjct  348  NNGTFCMYNSRPTSICFLFARKFAPNALEPLLNLTSTVMGF  388



>ref|XP_006470990.1| PREDICTED: uncharacterized protein LOC102625510 isoform X1 [Citrus 
sinensis]
Length=404

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+NV WG+V + DAE+RLLANALLDFSNERFVLLSESCIP+Y+FPTVYKYLT S
Sbjct  172  YGRQIPSRNVGWGTVEMADAEKRLLANALLDFSNERFVLLSESCIPIYNFPTVYKYLTGS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM R +AI I+S+TK+  +F+
Sbjct  232  PYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEMQRKVAIYIISDTKYLTLFR  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GPHP  Y   NITE FIQS+R
Sbjct  292  KYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGPHPVMYKKENITEQFIQSLR  351

Query  262  -SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLK  152
             SNG+ C YN  +T  CYLFARKF P+ LEPL K+S K
Sbjct  352  NSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSK  389



>emb|CDO97644.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+ VEWG+VSLVDAE+RLLANALLDFSNERFVLLSESCIPVY+FP VY YLT S
Sbjct  179  YRRQIPSRRVEWGTVSLVDAEKRLLANALLDFSNERFVLLSESCIPVYNFPAVYGYLTGS  238

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF++SYDDP+RYGRGRY+ RM+PDI+L +WRKGSQWFE+NR LA I+V+ETK+Y++FK
Sbjct  239  MHSFVQSYDDPSRYGRGRYSRRMQPDIRLADWRKGSQWFELNRYLAAIVVAETKYYSIFK  298

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHY+PT+L   +G  NANR+VTYVDWS+  PHP ++TA N+TEGFI+SIR
Sbjct  299  KHCRPSCYPDEHYLPTFLHKFYGATNANRTVTYVDWSVIAPHPGTFTAVNVTEGFIRSIR  358

Query  262  SNGTSCSYN-RGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT+CSYN +  T +CYLFARKF P ALEPL  LS +VM +
Sbjct  359  NNGTACSYNLKSTTTVCYLFARKFTPDALEPLLNLSSEVMRY  400



>ref|XP_008775897.1| PREDICTED: uncharacterized protein LOC103696141 [Phoenix dactylifera]
Length=391

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 182/221 (82%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQ+ S  V WGSV+LVDAE+RLLANALLDFSNERFVLLSESCIPV++FP VY+YL  S
Sbjct  172  YGRQVPSLEVSWGSVTLVDAEKRLLANALLDFSNERFVLLSESCIPVHNFPAVYEYLINS  231

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDD +  GRGRY+  M P IKL++WRKGS+WFE+NR LA+ IV++ ++YA+F+
Sbjct  232  EHSFVESYDDDSSQGRGRYSRYMAPHIKLYQWRKGSEWFELNRDLAVTIVADYRYYAIFR  291

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GGPHPA Y A NIT  FIQ+IR
Sbjct  292  KYCKPSCYPDEHYIPTYLNMFHGSLNANRSLTWVDWSRGGPHPARYGAPNITAEFIQAIR  351

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +C+LFARKF P+ALEPL  L+  VMGF
Sbjct  352  NNGTFCMYNSRPTSVCFLFARKFAPNALEPLLNLT-SVMGF  391



>ref|XP_010099779.1| hypothetical protein L484_010966 [Morus notabilis]
 gb|EXB80397.1| hypothetical protein L484_010966 [Morus notabilis]
Length=395

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++R+I SQ+V WG+V+L DAERRLLANALLDFSNERFVLLSESCIPVY+F T+Y YL  S
Sbjct  175  HRREIPSQHVSWGTVTLADAERRLLANALLDFSNERFVLLSESCIPVYNFSTIYNYLIGS  234

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T SF+++YD+PTRYGRGRY+ RM PDIKL++WRKGSQWFE+NRALA+ IVS+TK+Y +FK
Sbjct  235  TQSFVQAYDEPTRYGRGRYSRRMLPDIKLYQWRKGSQWFELNRALAVYIVSDTKYYTLFK  294

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC P+CYPDEHY+PTY+ + HG +N+NR+VT+V+WS+GGPHP +Y  AN+T  FIQ+IR
Sbjct  295  KYCLPACYPDEHYLPTYINMFHGPLNSNRTVTWVNWSIGGPHPVTYGEANVTVDFIQAIR  354

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T ICYLFARKF PSALEPL  LS  VM F
Sbjct  355  NNGTPCQYNTQTTSICYLFARKFAPSALEPLLNLSSSVMKF  395



>gb|EAZ41277.1| hypothetical protein OsJ_25784 [Oryza sativa Japonica Group]
Length=295

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  75   FARQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  134

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ I+++ K+Y++F+
Sbjct  135  AHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFELNRELALRIIADNKYYSIFR  194

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPA Y A+NI+E FIQ+IR
Sbjct  195  KHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGPHPARYGASNISEEFIQAIR  254

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C+YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  255  NNGTRCTYNSKPTSVCYLFARKFAPSALGPLMNLTSTILDF  295



>ref|XP_009411881.1| PREDICTED: uncharacterized protein LOC103993515 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 181/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESC+PVY+FP+VY+YL  S
Sbjct  167  YSRQIPSEEVFWGSITLVDAEKRLLANALLDFSNERFVLLSESCVPVYNFPSVYEYLINS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYD+ +  GRGRY+  M P+I+ ++W KGS+WFE+NR LA+ IV++ K+Y++F+
Sbjct  227  AHSFVESYDEDSPQGRGRYSQNMAPEIQEYQWMKGSEWFELNRELAVNIVADYKYYSIFR  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCYPDEHYIPTYL + HG +NANRSVT+VDWS GGPHPA Y   NIT GFIQ+IR
Sbjct  287  KYCKPSCYPDEHYIPTYLNMFHGALNANRSVTWVDWSRGGPHPARYGDPNITVGFIQAIR  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +N T C YN   T IC+LFARKF PSAL PL  ++  VMGF
Sbjct  347  NNATFCMYNSRPTPICFLFARKFAPSALVPLLDMASTVMGF  387



>ref|XP_002444900.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
 gb|EES14395.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
Length=412

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ+V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  192  YGRQIPSQDVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  251

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ IV++ K+Y++F+
Sbjct  252  AHSFVESYNIDTPQSAGRYNRRMAPHIMADQWRKGSEWFELNRELAVQIVADYKYYSIFR  311

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPASY AA+ITE FIQ+IR
Sbjct  312  KHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGPHPASYGAADITEDFIQAIR  371

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF P+AL  L  ++  V+ F
Sbjct  372  NNGTQCFYNSKPTSVCYLFARKFAPNALGRLMNMTSTVLDF  412



>ref|NP_001060819.1| Os08g0110400 [Oryza sativa Japonica Group]
 dbj|BAD09537.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22733.1| Os08g0110400 [Oryza sativa Japonica Group]
 dbj|BAG94403.1| unnamed protein product [Oryza sativa Japonica Group]
Length=407

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  187  FARQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  246

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ I+++ K+Y++F+
Sbjct  247  AHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFELNRELALRIIADNKYYSIFR  306

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPA Y A+NI+E FIQ+IR
Sbjct  307  KHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGPHPARYGASNISEEFIQAIR  366

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C+YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  367  NNGTRCTYNSKPTSVCYLFARKFAPSALGPLMNLTSTILDF  407



>gb|EAZ05353.1| hypothetical protein OsI_27557 [Oryza sativa Indica Group]
Length=407

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  187  FARQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  246

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ I+++ K+Y++F+
Sbjct  247  AHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFELNRELALRIIADNKYYSIFR  306

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPA Y A+NI+E FIQ+IR
Sbjct  307  KHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGPHPARYGASNISEEFIQAIR  366

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C+YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  367  NNGTRCTYNSKPTSVCYLFARKFAPSALGPLMNLTSTILDF  407



>gb|EMS61782.1| hypothetical protein TRIUR3_23279 [Triticum urartu]
 gb|EMT25870.1| hypothetical protein F775_27169 [Aegilops tauschii]
Length=295

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 176/221 (80%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  75   YGRQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  134

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ +V++ K+Y++F+
Sbjct  135  EHSFVESYNIDTPQSAGRYNRRMAPHILPEQWRKGSEWFELNRELAVRVVADYKYYSIFR  194

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPA Y A NI   FI++IR
Sbjct  195  KHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGPHPARYGAGNINVDFIKAIR  254

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF PSAL PL  L+  V+ F
Sbjct  255  NNGTQCLYNSKHTSVCYLFARKFAPSALGPLMNLTSTVLDF  295



>ref|XP_004972466.1| PREDICTED: uncharacterized protein LOC101769924 [Setaria italica]
Length=410

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 179/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  190  YGRQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  249

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ IV++ K+Y++F+
Sbjct  250  AHSFVESYNIDTPQCAGRYNRRMAPHIMADQWRKGSEWFELNRELAVQIVADYKYYSIFR  309

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPASY AA+ITE FIQ+IR
Sbjct  310  KHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGPHPASYGAADITEEFIQTIR  369

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF P+AL  L  L+  V+ F
Sbjct  370  NNGTQCFYNSKPTSVCYLFARKFAPNALGRLMNLTSTVLDF  410



>ref|XP_003573284.1| PREDICTED: uncharacterized protein LOC100833185 [Brachypodium 
distachyon]
Length=406

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 177/221 (80%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS+SLVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  186  YGRQIPSEEVSWGSISLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  245

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ +V++ K+Y++F+
Sbjct  246  EHSFVESYNIDTPQSAGRYNRRMAPHILPDQWRKGSEWFELNRELAVRVVADYKYYSIFR  305

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPA Y AANI   FIQ+IR
Sbjct  306  KHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGPHPARYGAANINVEFIQAIR  365

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  366  NNGTQCLYNSKHTSVCYLFARKFAPSALGPLMNLTSTILDF  406



>ref|NP_001143222.1| uncharacterized protein LOC100275738 [Zea mays]
 gb|ACG29937.1| hypothetical protein [Zea mays]
 gb|ACN25800.1| unknown [Zea mays]
 gb|ACN28199.1| unknown [Zea mays]
 gb|AFW74275.1| hypothetical protein ZEAMMB73_796456 [Zea mays]
Length=414

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 178/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  194  YGRQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  253

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ IV++ K+Y++F+
Sbjct  254  AHSFVESYNIDTPQCAGRYNRRMAPHIMADQWRKGSEWFELNRELAVQIVADYKYYSIFR  313

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPASY A +ITE FIQ+IR
Sbjct  314  KHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGPHPASYGATDITEDFIQAIR  373

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF P+AL  L  L+  V+ F
Sbjct  374  NNGTQCFYNSKPTSVCYLFARKFAPNALPRLMNLTSTVLDF  414



>ref|NP_001143215.1| uncharacterized protein LOC100275720 [Zea mays]
 gb|ACG29786.1| hypothetical protein [Zea mays]
Length=414

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 178/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+ V WGS++LVDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVY+YL  S
Sbjct  194  YGRQIPSEEVSWGSITLVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYEYLINS  253

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+NR LA+ IV++ K+Y++F+
Sbjct  254  AHSFVESYNIDTPQCAGRYNRRMAPHIMADQWRKGSEWFELNRELAVQIVADYKYYSIFR  313

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGPHPASY A +ITE FIQ+IR
Sbjct  314  KHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGPHPASYGATDITEEFIQAIR  373

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   T +CYLFARKF P+AL  L  L+  V+ F
Sbjct  374  NNGTQCFYNSKPTSVCYLFARKFAPNALPRLMNLTSTVLDF  414



>emb|CAH67921.1| OSIGBa0138E08-OSIGBa0161L23.2 [Oryza sativa Indica Group]
Length=412

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S +V WGS++LVDAE+RLLANALLDFSNERFVL SESC+PV++FPTVY+YL  S
Sbjct  192  HGRQIPSGDVSWGSITLVDAEKRLLANALLDFSNERFVLASESCVPVFNFPTVYEYLVNS  251

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN RM PD+   +WRKGS+WFEM+R LA  IV++ K++A+F+
Sbjct  252  AQSYVESYNIDVPQCAGRYNPRMAPDVLEEQWRKGSEWFEMSRDLAADIVADRKYHAIFR  311

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGPHPA +  A +T  F+Q+IR
Sbjct  312  KHCTPSCYPDEHYIPTYLHLRHGARNANRTVTWVDWSRGGPHPARFGKATVTPAFVQAIR  371

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C+YN   T +CYLFARKF PSAL PL  +S  ++ F
Sbjct  372  NNGTRCAYNGKPTTVCYLFARKFAPSALGPLLNMSTTLLEF  412



>ref|NP_001052347.1| Os04g0272400 [Oryza sativa Japonica Group]
 emb|CAE01750.2| OSJNBb0056F09.13 [Oryza sativa Japonica Group]
 dbj|BAF14261.1| Os04g0272400 [Oryza sativa Japonica Group]
 gb|EAZ30027.1| hypothetical protein OsJ_14085 [Oryza sativa Japonica Group]
 dbj|BAH00498.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S +V WGS++LVDAE+RLLANALLDFSNERFVL SESC+PV++FPTVY+YL  S
Sbjct  192  HGRQIPSGDVSWGSITLVDAEKRLLANALLDFSNERFVLASESCVPVFNFPTVYEYLVNS  251

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN RM PD+   +WRKGS+WFEM+R LA  IV++ K++A+F+
Sbjct  252  AQSYVESYNIDVPQCAGRYNPRMAPDVLEEQWRKGSEWFEMSRDLAADIVADRKYHAIFR  311

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGPHPA +  A +T  F+Q+IR
Sbjct  312  KHCTPSCYPDEHYIPTYLHLRHGARNANRTVTWVDWSRGGPHPARFGKATVTPAFVQAIR  371

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C+YN   T +CYLFARKF PSAL PL  +S  ++ F
Sbjct  372  NNGTRCAYNGKPTTVCYLFARKFAPSALGPLLNMSTTLLEF  412



>ref|XP_008786442.1| PREDICTED: uncharacterized protein LOC103704784 [Phoenix dactylifera]
Length=298

 Score =   296 bits (757),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ  EWGS+SLVDAERRLLANALLDFSNERFVLLS+ CIP+YDF T+Y+YL  S
Sbjct  78   YGRQIPSQATEWGSMSLVDAERRLLANALLDFSNERFVLLSDGCIPLYDFVTIYRYLLRS  137

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ SYD+ T  GRGRY+  + P IKL +WRKG+QWFE++R+LA+ IV++ K+Y +F+
Sbjct  138  DHSFVHSYDEDTENGRGRYSRHLAPAIKLSQWRKGAQWFELHRSLAVNIVADDKYYNLFR  197

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KY     YPDEHYIPT+L + +G   ANR++T+VDWS  GPHPA++   NITEGFIQSIR
Sbjct  198  KYAGSLNYPDEHYIPTFLSMIYGASIANRTLTWVDWSTRGPHPATFGRRNITEGFIQSIR  257

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +N T+CSYN   T +C+LFARKF   ALEPL  +S  VM F
Sbjct  258  NNATTCSYNFRPTSVCFLFARKFSRDALEPLLNISPTVMRF  298



>ref|XP_009341368.1| PREDICTED: uncharacterized protein LOC103933398 [Pyrus x bretschneideri]
Length=390

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 175/221 (79%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V WG+++L+DAERRLLANALLD SNERFVLLSESCIP+Y+F TVY+YL  S
Sbjct  170  YLRQIPSQPVSWGTLTLLDAERRLLANALLDLSNERFVLLSESCIPIYNFTTVYEYLVGS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HS+++SYDDP RYGRGRY   M PDI   +WRKGSQWFE++RAL++ IVSETK+Y +F 
Sbjct  230  NHSYVQSYDDPGRYGRGRYRRNMFPDITPRQWRKGSQWFELSRALSVYIVSETKYYTIFS  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC P+CYPDEHY+PTY+ +  G +N+NR+VT+VDWSL GPHP +Y   NITE F++ IR
Sbjct  290  NYCLPACYPDEHYLPTYINMLQGSLNSNRTVTWVDWSLRGPHPTTYGGDNITEDFLRWIR  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NG  C YN     ICYLFARKF P+ALEPL KL+  VM +
Sbjct  350  NNGAPCQYNAEMKSICYLFARKFAPTALEPLLKLAAVVMEY  390



>ref|XP_003567325.1| PREDICTED: uncharacterized protein LOC100845991 [Brachypodium 
distachyon]
Length=395

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 167/222 (75%), Gaps = 1/222 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R+I SQ   WGSVSL+DAE+RLLANALLDFSNERFVLLSESCIPV  FP V+ YL  S
Sbjct  174  YRREIPSQATSWGSVSLMDAEKRLLANALLDFSNERFVLLSESCIPVQPFPVVHDYLVGS  233

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y  P++  RGRYN RM PDI L +WRKGSQWFE++R +A  ++++ K+Y +F+
Sbjct  234  RHSFVEVYYVPSKQCRGRYNRRMAPDITLRQWRKGSQWFELSRDVATAVLADAKYYPLFR  293

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSI-  266
            K+CRPSCYPDEHYIPT + + HG+ N+NR++T+VDWS GGPHPA Y A ++T   IQ I 
Sbjct  294  KHCRPSCYPDEHYIPTMVNMLHGHRNSNRTITFVDWSKGGPHPAKYGAGDVTVELIQRIR  353

Query  265  RSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            R  G  C YN   T +C+LFARKF P  L PL  +S  VMGF
Sbjct  354  RRTGRPCLYNSRPTSMCFLFARKFTPDMLGPLLNMSSAVMGF  395



>ref|XP_009415010.1| PREDICTED: uncharacterized protein LOC103995962 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   296 bits (758),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI ++ V WGS+S+VDAE+RLLANALLDFSNERFVLLSESCIPVY FPTVYKYL  S
Sbjct  173  YGRQIPNKVVRWGSISMVDAEKRLLANALLDFSNERFVLLSESCIPVYGFPTVYKYLIRS  232

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF++S+D+ +  GRGRYN RM PDI L +WRKGS+W E++R+LA+ +V++ K++ +F+
Sbjct  233  AHSFVQSFDENSPLGRGRYNHRMAPDIVLSQWRKGSEWLELSRSLAVEVVADFKYHFLFR  292

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+P CY DEHY PTY  + HG + ANRS+T+VDWS GGPHPA+Y   NIT+  IQSIR
Sbjct  293  KYCQPPCYADEHYFPTYFNMFHGALIANRSITWVDWSRGGPHPATYGYQNITKDLIQSIR  352

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  146
             +   C YN G T +C+LFARKF   ALE L  L+  VM
Sbjct  353  ESKI-CKYNSGATTMCFLFARKFASDALELLLNLTSAVM  390



>ref|XP_006645101.1| PREDICTED: uncharacterized protein LOC102713419 [Oryza brachyantha]
Length=385

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 169/221 (76%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ  +WGS++L+DAE+RLLANALLDFSNERFVLLSESCIPV  FPTVY YLT S
Sbjct  165  YGRQIPSQETKWGSITLMDAEKRLLANALLDFSNERFVLLSESCIPVQSFPTVYDYLTGS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE++R LA+ ++++T++Y +F+
Sbjct  225  RHSFVEVYYHKDKTCRGRYSHRMEPDITLPQWRKGSQWFELSRGLAVSVLADTRYYPLFR  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHY+PT + + HG  N+NR+VTYVDWS GG HP +Y A ++T   IQS+R
Sbjct  285  QHCLPSCYPDEHYLPTLVTMLHGAANSNRTVTYVDWSRGGAHPVTYAAGDVTPDLIQSLR  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             + T C YN   T  C+LFARKF P ALEPL  +S  VM +
Sbjct  345  RSETPCMYNSRPTTACFLFARKFSPDALEPLLNMSSTVMQY  385



>ref|XP_010227722.1| PREDICTED: uncharacterized protein LOC104581568 [Brachypodium 
distachyon]
Length=411

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 164/207 (79%), Gaps = 0/207 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ V WGS++LVDAE+RLLANALLDFSNERF+L+SESC+PV++FPTVY+YL  S
Sbjct  191  YGRQIPSQEVSWGSITLVDAEKRLLANALLDFSNERFLLVSESCVPVFNFPTVYEYLVNS  250

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN RM PD+   +WRKGS+WFE++R LA+ +VS+ ++YA+F+
Sbjct  251  AQSYVESYNMDVPQCAGRYNPRMAPDVLEEQWRKGSEWFEVSRELAVDVVSDRRYYAVFR  310

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGPHPA Y    +T  F+Q+IR
Sbjct  311  KHCTPSCYPDEHYIPTYLHLVHGPRNANRTVTWVDWSRGGPHPARYGKGTVTAEFLQAIR  370

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSA  182
            +NGT C YN   T +CYLFARKF PSA
Sbjct  371  NNGTQCLYNGKPTTVCYLFARKFAPSA  397



>ref|XP_008786440.1| PREDICTED: uncharacterized protein LOC103704783 isoform X2 [Phoenix 
dactylifera]
Length=284

 Score =   287 bits (735),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  + G +S VDAE+RLLANALLDFSNERFVLLSESCIPV++F TVYKYLT+S
Sbjct  64   YDRQIPSEKTKHGLISQVDAEKRLLANALLDFSNERFVLLSESCIPVFNFSTVYKYLTKS  123

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+ +  G G YN+ + P+IKL +WRKGS+WFE+ R+LA+ IV++ K+Y  F+
Sbjct  124  AYSFVQSYDENSFQGLGHYNSHLAPEIKLPQWRKGSRWFEIQRSLAVNIVADKKYYFFFR  183

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC+ +CYPDE YIPTYL + HG  NANR+VT+  WS+GG HPA+Y   +ITE  I+SIR
Sbjct  184  EYCKTNCYPDEFYIPTYLNMFHGLSNANRTVTWAGWSIGGHHPATYGREDITESLIRSIR  243

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SNGT C+YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  244  SNGTICTYNSKPSSLCFLFAMKFSPDALEPLLNLTSTVMKF  284



>dbj|BAK04145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 168/226 (74%), Gaps = 5/226 (2%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGS+SL+DAE+RLLANALLDFSNERFVLLSESCIP++ F  VY YL  S
Sbjct  166  YGRQIPSQETAWGSISLMDAEKRLLANALLDFSNERFVLLSESCIPLHSFRAVYDYLVGS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y   T+  +GRY+ RM P I+L +WRKGSQWFE+NR LAI ++++TK+Y +F+
Sbjct  226  RHSFVEVYFQQTKQCQGRYSRRMAPAIRLPQWRKGSQWFELNRDLAISVLADTKYYPLFR  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+PT + + HG  NANR+VTYVDW+ GG HPA YTA+N+T   IQ IR
Sbjct  286  RHCRPSCYPDEHYLPTTVDMLHGARNANRTVTYVDWTKGGAHPAKYTASNVTAAAIQGIR  345

Query  262  -----SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
                  +  SC YN   T +C+LFARKF P  L PL  +S  VMG+
Sbjct  346  RRRWKGDRPSCYYNDRPTSMCFLFARKFAPDTLGPLLNMSSAVMGY  391



>gb|EMS55277.1| hypothetical protein TRIUR3_33067 [Triticum urartu]
Length=449

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S++V WGS++LVDAE+RLLANALLD SN+RFVL+SESC+PV++FPTVY+YL  S
Sbjct  229  YGRQIPSRDVSWGSITLVDAEKRLLANALLDHSNQRFVLVSESCVPVFNFPTVYEYLINS  288

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN RM PD+   +WRKGS+WFE++R LA+ IV++ ++Y +F+
Sbjct  289  AQSYVESYNIDVPQCAGRYNPRMAPDVTEQQWRKGSEWFELSRELAVDIVADRRYYHVFR  348

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+C PSCYPDEHYIPTYL L HG  NANR++T+VDWS GGPHPA Y  A++T+ FIQ+IR
Sbjct  349  KHCTPSCYPDEHYIPTYLHLVHGPRNANRTITWVDWSRGGPHPARYGKASVTKEFIQAIR  408

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSA  182
            +NGT C YN   T +CYLFARKF PSA
Sbjct  409  NNGTQCLYNGRPTTVCYLFARKFAPSA  435



>ref|XP_008786439.1| PREDICTED: uncharacterized protein LOC103704783 isoform X1 [Phoenix 
dactylifera]
Length=384

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 172/221 (78%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  + G +S VDAE+RLLANALLDFSNERFVLLSESCIPV++F TVYKYLT+S
Sbjct  164  YDRQIPSEKTKHGLISQVDAEKRLLANALLDFSNERFVLLSESCIPVFNFSTVYKYLTKS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+ +  G G YN+ + P+IKL +WRKGS+WFE+ R+LA+ IV++ K+Y  F+
Sbjct  224  AYSFVQSYDENSFQGLGHYNSHLAPEIKLPQWRKGSRWFEIQRSLAVNIVADKKYYFFFR  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC+ +CYPDE YIPTYL + HG  NANR+VT+  WS+GG HPA+Y   +ITE  I+SIR
Sbjct  284  EYCKTNCYPDEFYIPTYLNMFHGLSNANRTVTWAGWSIGGHHPATYGREDITESLIRSIR  343

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SNGT C+YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  344  SNGTICTYNSKPSSLCFLFAMKFSPDALEPLLNLTSTVMKF  384



>ref|XP_010942042.1| PREDICTED: uncharacterized protein LOC105060116 isoform X2 [Elaeis 
guineensis]
Length=298

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI S+  EWG +S+ DAERRLLANALLD SNERFVLLSESCIP+Y+F   Y+YL  S
Sbjct  78   YKRQIPSKVTEWGKMSMCDAERRLLANALLDLSNERFVLLSESCIPLYNFSITYRYLMRS  137

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+DDP  +GRGRYN RMKP++ + +WRKG+QWFE+NR LAI I+S+ K+Y  F+
Sbjct  138  RYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQWRKGAQWFEVNRKLAINIISDAKYYPKFR  197

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P CY DEHY PT L +   ++ ANRSVT+VDWS GG HPA++   +ITE F++ I 
Sbjct  198  DFCKPGCYVDEHYFPTMLAIESPHLMANRSVTWVDWSRGGAHPATFGKRDITEAFLKKIL  257

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN   + +C+LFARKF P+ALEPL +L+  ++GF
Sbjct  258  -EGKSCFYNAQPSSVCFLFARKFAPNALEPLLQLAPSLLGF  297



>ref|XP_006355313.1| PREDICTED: uncharacterized protein LOC102601627 [Solanum tuberosum]
Length=388

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRLLANALLD SNE FVLLSESCIP+Y+F  +YKY+++S
Sbjct  169  YKRQIPSQVTEWGKMSMCDAERRLLANALLDISNEWFVLLSESCIPLYNFNVIYKYISQS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  YGRGRY+  M P++ + +WRKGSQWFEM+R LA+ IV +TKFY  F 
Sbjct  229  KHSFVGAFDDPGPYGRGRYDENMLPEVNISQWRKGSQWFEMSRKLALFIVEDTKFYPKFA  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  ++ITE F++ + 
Sbjct  289  EFCRPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGAHPATFGKSDITEEFMKRML  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G +C+YN   T +CY+FARKF PSALEPL  L+ K +GF
Sbjct  349  A-GPNCTYNDRNTSMCYIFARKFAPSALEPLFLLAPKYLGF  388



>gb|KDP29447.1| hypothetical protein JCGZ_18368 [Jatropha curcas]
Length=353

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ VEWG  ++VDAERRLLANALLDFSNERFVLLSE+CIP+++F T+Y YL  S
Sbjct  132  HNRRIPSQQVEWGKATMVDAERRLLANALLDFSNERFVLLSETCIPIFNFTTIYNYLINS  191

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ SYDDP+R GRGRYN R+ P + L +WRKGSQWFE++R L   IVS+ K+Y +F+
Sbjct  192  NQSFLASYDDPSRAGRGRYNKRLWPTVTLSDWRKGSQWFEIHRKLTGKIVSDVKYYPIFR  251

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC+P CY DEHY PT +      +N+NRS+T+VDWSLGGPHP +Y   +++E F+  IR
Sbjct  252  DYCKPPCYMDEHYFPTLVTKICPELNSNRSITWVDWSLGGPHPRNYVKKDVSEAFLNWIR  311

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +CSYN   T +C+LFARKF  SAL+PL +++  ++GF
Sbjct  312  -NGFNCSYNGAMTTVCFLFARKFHSSALQPLLRIAPALLGF  351



>ref|XP_010453221.1| PREDICTED: uncharacterized protein LOC104735185 [Camelina sativa]
Length=387

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAE+RLLANALLD SNE FVL+SESCIP+Y+F T+Y YL+ S
Sbjct  168  YRRQIPSQVAEWGRMSMCDAEKRLLANALLDVSNEWFVLVSESCIPLYNFTTIYSYLSRS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  YGRGRYN  M+P++ L +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  228  KHSFMGAFDDPGPYGRGRYNGNMEPEVPLTKWRKGSQWFEINRDLAATIVKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  288  EFCRPACYVDEHYFPTMLTIEKPAVLANRSITWVDWSRGGPHPATFGRSDITEKFFERI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C+YN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  347  FDGRNCTYNGRNTSLCYLFARKFAPSALEPLLHIAPKILGF  387



>ref|XP_010942037.1| PREDICTED: uncharacterized protein LOC105060116 isoform X1 [Elaeis 
guineensis]
Length=384

 Score =   286 bits (731),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI S+  EWG +S+ DAERRLLANALLD SNERFVLLSESCIP+Y+F   Y+YL  S
Sbjct  164  YKRQIPSKVTEWGKMSMCDAERRLLANALLDLSNERFVLLSESCIPLYNFSITYRYLMRS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+DDP  +GRGRYN RMKP++ + +WRKG+QWFE+NR LAI I+S+ K+Y  F+
Sbjct  224  RYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQWRKGAQWFEVNRKLAINIISDAKYYPKFR  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P CY DEHY PT L +   ++ ANRSVT+VDWS GG HPA++   +ITE F++ I 
Sbjct  284  DFCKPGCYVDEHYFPTMLAIESPHLMANRSVTWVDWSRGGAHPATFGKRDITEAFLKKIL  343

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN   + +C+LFARKF P+ALEPL +L+  ++GF
Sbjct  344  -EGKSCFYNAQPSSVCFLFARKFAPNALEPLLQLAPSLLGF  383



>ref|XP_012082166.1| PREDICTED: uncharacterized protein LOC105642088 [Jatropha curcas]
Length=372

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ VEWG  ++VDAERRLLANALLDFSNERFVLLSE+CIP+++F T+Y YL  S
Sbjct  151  HNRRIPSQQVEWGKATMVDAERRLLANALLDFSNERFVLLSETCIPIFNFTTIYNYLINS  210

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ SYDDP+R GRGRYN R+ P + L +WRKGSQWFE++R L   IVS+ K+Y +F+
Sbjct  211  NQSFLASYDDPSRAGRGRYNKRLWPTVTLSDWRKGSQWFEIHRKLTGKIVSDVKYYPIFR  270

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC+P CY DEHY PT +      +N+NRS+T+VDWSLGGPHP +Y   +++E F+  IR
Sbjct  271  DYCKPPCYMDEHYFPTLVTKICPELNSNRSITWVDWSLGGPHPRNYVKKDVSEAFLNWIR  330

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +CSYN   T +C+LFARKF  SAL+PL +++  ++GF
Sbjct  331  -NGFNCSYNGAMTTVCFLFARKFHSSALQPLLRIAPALLGF  370



>ref|NP_001044966.1| Os01g0875800 [Oryza sativa Japonica Group]
 dbj|BAF06880.1| Os01g0875800 [Oryza sativa Japonica Group]
 dbj|BAG97459.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGS++L+DAE+RLLANALLDFSN+RFVLLSESCIPV  FP  Y YLT S
Sbjct  164  YGRQIPSQETSWGSITLMDAEKRLLANALLDFSNDRFVLLSESCIPVQSFPVAYGYLTGS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+ R LA+  +++ ++Y +F+
Sbjct  224  RHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFELRRDLAVAALTDARYYPLFR  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG HPA+YTA ++T   I SIR
Sbjct  284  RHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGAHPATYTAGDVTPELILSIR  343

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +   C YN   T  C+LFARKF   ALEPL  +S  VM +
Sbjct  344  RSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY  384



>ref|XP_006394845.1| hypothetical protein EUTSA_v10004382mg [Eutrema salsugineum]
 gb|ESQ32131.1| hypothetical protein EUTSA_v10004382mg [Eutrema salsugineum]
Length=387

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+++F T++ Y+T+S
Sbjct  168  YRRQIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSESCIPLFNFTTIHGYITKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP+ YGRGRYN  M P++ ++EWRKGSQWFE+NR LA+ I+ +T +Y  FK
Sbjct  228  KHSFMGSFDDPSPYGRGRYNGNMSPEVSINEWRKGSQWFEVNRELAVSIIKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C P+CY DEHY PT L +      ANRS+T+VDWS GGPHPA++  ++++E F   I 
Sbjct  288  EFCTPACYVDEHYFPTMLTIEKPAALANRSLTWVDWSRGGPHPATFGQSDVSEEFFARIL  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +C+YN G T +CYLFARKF PSALEPL  ++ K++ F
Sbjct  348  -NGDNCTYNGGNTSMCYLFARKFSPSALEPLIYIAPKILSF  387



>dbj|BAD82090.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ14347.1| hypothetical protein OsJ_04268 [Oryza sativa Japonica Group]
Length=380

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGS++L+DAE+RLLANALLDFSN+RFVLLSESCIPV  FP  Y YLT S
Sbjct  160  YGRQIPSQETSWGSITLMDAEKRLLANALLDFSNDRFVLLSESCIPVQSFPVAYGYLTGS  219

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+ R LA+  +++ ++Y +F+
Sbjct  220  RHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFELRRDLAVAALTDARYYPLFR  279

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG HPA+YTA ++T   I SIR
Sbjct  280  RHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGAHPATYTAGDVTPELILSIR  339

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +   C YN   T  C+LFARKF   ALEPL  +S  VM +
Sbjct  340  RSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY  380



>gb|ERN15387.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
Length=327

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +S+ DAERRLLANALLDFSNERFVLLSESCIP+ +F TVY YL  S
Sbjct  108  YRRQIPSKVAEWGEMSMCDAERRLLANALLDFSNERFVLLSESCIPIMNFTTVYHYLMRS  167

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP+ YGRGRYN  M P++ + EWRKGSQWFE+NR LA+ ++ +T +Y  FK
Sbjct  168  RHSFVGSFDDPSVYGRGRYNENMAPEVNITEWRKGSQWFEVNRKLALTLIEDTTYYPKFK  227

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY PT   +   Y  ANRS+T+VDWS GG HPA++   +IT  FI  I 
Sbjct  228  NFCRPACYVDEHYFPTMFTIKAPYHIANRSITWVDWSRGGAHPATFGKVDITVEFIARI-  286

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
             NG  C YN   + +C+LFARKF PSAL PL  L+ K +G
Sbjct  287  VNGNECKYNNQSSSVCFLFARKFAPSALVPLLDLAPKFIG  326



>ref|XP_002871492.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47751.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAE+RLLANALLD SNE FVL+SESCIP+++F T+Y YL+ S
Sbjct  168  YRRQIPSQVAEWGRMSMCDAEKRLLANALLDISNEWFVLVSESCIPLFNFTTIYSYLSRS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ L +WRKGSQWFE++R LA  IV +T +Y  FK
Sbjct  228  KHSFMGAFDDPGPFGRGRYNGNMEPEVPLSKWRKGSQWFEVDRDLAATIVKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  288  EFCRPACYVDEHYFPTMLTIEKPTVLANRSLTWVDWSRGGPHPATFGRSDITEKFFERI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +CSYN G T +CYLFARKF PS LEPL  ++ KV+GF
Sbjct  347  FDGRNCSYNGGNTSMCYLFARKFAPSTLEPLLHIAPKVLGF  387



>emb|CBI26990.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKR+I S++V+WG  ++VDAERRLLANALLDFSNERFVLLSE+CIP+++F T+YKYL  S
Sbjct  75   YKRRIPSKSVDWGKATMVDAERRLLANALLDFSNERFVLLSETCIPLFNFTTIYKYLINS  134

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP   GRGRYN RM P + L +WRKGSQWFE++R LAI IVS+  +Y +F+
Sbjct  135  NHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKGSQWFEVHRKLAIEIVSDVTYYPIFQ  194

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY+ T +      +N+NRS+T+VDWS GG HP  +   +++E F+   R
Sbjct  195  EHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVDWSRGGSHPTKFVRKDVSEAFLNQAR  254

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +CSYN G + IC+LFARKF PS LEPL +++  ++GF
Sbjct  255  -HGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAPSLLGF  294



>gb|EAY76682.1| hypothetical protein OsI_04637 [Oryza sativa Indica Group]
Length=380

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGS++L+DAE+RLLANALLDFSN+RFVLLSESCIPV  FP  Y YLT S
Sbjct  160  YGRQIPSQETSWGSITLMDAEKRLLANALLDFSNDRFVLLSESCIPVQSFPVAYGYLTGS  219

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+ R LA+  +++ ++Y +F+
Sbjct  220  RHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFELRRDLAVASLTDARYYPLFR  279

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG HPA+YTA ++T   I SIR
Sbjct  280  RHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGAHPATYTAGDVTPELILSIR  339

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +   C YN   T  C+LFARKF   ALEPL  +S  VM +
Sbjct  340  RSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY  380



>ref|XP_009601239.1| PREDICTED: uncharacterized protein LOC104096562 [Nicotiana tomentosiformis]
Length=388

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRL+ANALLD SNE FVLLSESCIP+Y+F  +YKY+++S
Sbjct  169  YKRQIPSQVTEWGKMSMCDAERRLIANALLDISNEWFVLLSESCIPLYNFNVIYKYISQS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI ++DDP  YGRGRY+  M P++ + +WRKGSQWFE+NR LA+ IV +TKFY  F 
Sbjct  229  KHSFIGAFDDPGPYGRGRYDENMLPEVNITDWRKGSQWFEINRKLALYIVEDTKFYPKFA  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  ++ITE F++ + 
Sbjct  289  EFCKPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGAHPATFGKSDITEEFMKRML  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G +C+YN   T +C+LFARKF PSALEPL  L+ K +GF
Sbjct  349  A-GRNCTYNERNTSMCFLFARKFAPSALEPLFLLAPKYLGF  388



>ref|XP_008796992.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796993.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796994.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
Length=384

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  EWG +S+ DAERRLLANALLD SNERFVLLSESCIP+Y+F  +Y YL  S
Sbjct  164  YNRQIPSKVAEWGRMSMCDAERRLLANALLDLSNERFVLLSESCIPLYNFSIIYHYLMRS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+DDP  YGRGRYN RM P++ + +WRKG+QWFE+NR LAI IV +TK+Y  F 
Sbjct  224  RYSFVGSFDDPGPYGRGRYNLRMAPEVNIMQWRKGAQWFEVNRKLAIDIVRDTKYYPKFN  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCY DEHY PT L +   ++ ANR++T+VDWS GG HPA++   +ITE F++ I 
Sbjct  284  EFCRPSCYVDEHYFPTMLTIESPHLIANRTITWVDWSRGGAHPATFGKGDITEAFLKKIL  343

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   + +C+LFARKF PSALEPL + +  ++GF
Sbjct  344  -EGKTCLYNDQPSSVCFLFARKFAPSALEPLLQFATSLLGF  383



>ref|XP_010916432.1| PREDICTED: uncharacterized protein LOC105041249 [Elaeis guineensis]
Length=399

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 175/221 (79%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ V+WG +S+++AERRLLANALLD+SN+RF+LLSESCIP+++F T+Y YL  S
Sbjct  178  HGRRVPSKVVKWGQLSMMEAERRLLANALLDYSNQRFILLSESCIPLFNFSTIYSYLINS  237

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +++ SYDDP   GRGRYN RMKP +KL EWRKGSQWFE++RALAI I+S+ K++ +FK
Sbjct  238  TQTYVSSYDDPGPNGRGRYNIRMKPRVKLQEWRKGSQWFEVDRALAIEIISDEKYFPVFK  297

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCRPSCY DEHY+ T++ +   + NANRS+T+VDWS GGPHPA +   ++T   ++ +R
Sbjct  298  KYCRPSCYVDEHYLSTFVSMRFWWRNANRSLTWVDWSKGGPHPARFGRLDVTTELLERMR  357

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG++C+YN   T +C+LFARKF P++L  L + + +V+GF
Sbjct  358  -NGSTCNYNGRTTSVCFLFARKFLPNSLTRLMRFAPRVLGF  397



>ref|XP_006842356.2| PREDICTED: uncharacterized protein LOC18432183 [Amborella trichopoda]
Length=349

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++R++ S+ VEWG  +++DAERRLLANALLDFSNERFVLLSESCIP+++F T Y YL  S
Sbjct  128  FRRKVPSKVVEWGRATMIDAERRLLANALLDFSNERFVLLSESCIPLFNFTTAYSYLINS  187

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP   GRGRYN  M P+I L EWRKGSQWFE+NRALAI IVS+TK+YA+F+
Sbjct  188  HHSFVGSFDDPRHCGRGRYNKTMAPEILLSEWRKGSQWFEVNRALAIEIVSDTKYYAIFR  247

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C P CY DEHY+PT++  +    N+NRS  +VDWS GG HPA++ + + TE F+  IR
Sbjct  248  EHCNPPCYMDEHYLPTFVTKNFPSSNSNRSFMWVDWSRGGSHPATFRSGDATERFLNQIR  307

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N  +C+YN   T IC+LFARK+ P+AL+PL +++ +V+G 
Sbjct  308  -NSENCTYNGNPTSICFLFARKWAPNALQPLLRIAPRVLGL  347



>gb|ADE76813.1| unknown [Picea sitchensis]
Length=345

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 167/215 (78%), Gaps = 1/215 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R+I SQ VEWG  ++ DAE RLLANALLDFSNERF+LLSE+CIPV++F T+Y YL +S
Sbjct  126  YRREIPSQVVEWGEANMCDAETRLLANALLDFSNERFILLSETCIPVFNFSTIYNYLIKS  185

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP   GRGRYN +M P++ L +WRKGSQWFE++R LAI I+S+TK+Y +FK
Sbjct  186  KHSFVHSFDDPRPEGRGRYNIKMAPEVTLSQWRKGSQWFEVHRKLAIDIISDTKYYQIFK  245

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+PSCY DEHYIPT L +  G + +NRS+T+VDWS GG HPA +   +IT+ F+ SIR
Sbjct  246  AFCKPSCYIDEHYIPTILSMQFGSLISNRSITWVDWSRGGSHPAMFGKDDITQEFMMSIR  305

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLS  158
             +  +C+YN     +C+LFARKF PSAL+PL  +S
Sbjct  306  -DVNNCTYNDQTMSLCFLFARKFSPSALDPLLNMS  339



>ref|XP_010930512.1| PREDICTED: uncharacterized protein LOC105051676 [Elaeis guineensis]
Length=383

 Score =   283 bits (725),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 165/215 (77%), Gaps = 0/215 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  +   +S VDAE+RLLANALLDFSNERFVLLSESCIPV++FPTVYKYL +S
Sbjct  165  YDRQIPSKKTKQALISTVDAEKRLLANALLDFSNERFVLLSESCIPVFNFPTVYKYLIDS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+ +  G   YN+RM PDIKL +WRKGS+WFE+ R LA+ IV++ K+Y+ F+
Sbjct  225  AYSFVQSYDENSNQGLRYYNSRMAPDIKLSQWRKGSRWFEIQRLLAVDIVADKKYYSFFR  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+  C+PDE YIPTYL + HG  NANR+VT+  WS GG HPA+Y   +ITE  IQSIR
Sbjct  285  KYCKTGCFPDEFYIPTYLNMFHGLSNANRTVTWAGWSRGGHHPATYGREDITESLIQSIR  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLS  158
            +NG  C+YN   + +C+LFA KF P ALEPL  L+
Sbjct  345  NNGIICTYNSKPSSVCFLFAMKFSPDALEPLLNLT  379



>emb|CDM85189.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 165/225 (73%), Gaps = 4/225 (2%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGS+SL+DAE+RLLANALLDFSNERFVLLSESCIP++ F  VY YL  S
Sbjct  161  YGRQIPSQETAWGSISLMDAEKRLLANALLDFSNERFVLLSESCIPLHSFRAVYDYLIGS  220

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y   T+  +GRY+ RM P I L +WRKGSQWFE++R LAI ++++TK+Y +F+
Sbjct  221  RHSFVEVYFQQTKQCQGRYSRRMAPAITLQQWRKGSQWFELSRDLAISVLADTKYYPLFR  280

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+PT + + HG  NANR+VTYVDWS GG HPA +TA N+T   IQ IR
Sbjct  281  RHCRPSCYPDEHYLPTTVSMLHGARNANRTVTYVDWSKGGAHPAKHTAENVTAAAIQGIR  340

Query  262  SNGTS----CSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
                     C YN+  T +C+LFARKF P  L PL  +S  VMG+
Sbjct  341  RRRWRNDRPCYYNQRPTSMCFLFARKFAPDTLGPLLNMSSAVMGY  385



>gb|ERN04031.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
Length=376

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++R++ S+ VEWG  +++DAERRLLANALLDFSNERFVLLSESCIP+++F T Y YL  S
Sbjct  155  FRRKVPSKVVEWGRATMIDAERRLLANALLDFSNERFVLLSESCIPLFNFTTAYSYLINS  214

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP   GRGRYN  M P+I L EWRKGSQWFE+NRALAI IVS+TK+YA+F+
Sbjct  215  HHSFVGSFDDPRHCGRGRYNKTMAPEILLSEWRKGSQWFEVNRALAIEIVSDTKYYAIFR  274

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C P CY DEHY+PT++  +    N+NRS  +VDWS GG HPA++ + + TE F+  IR
Sbjct  275  EHCNPPCYMDEHYLPTFVTKNFPSSNSNRSFMWVDWSRGGSHPATFRSGDATERFLNQIR  334

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N  +C+YN   T IC+LFARK+ P+AL+PL +++ +V+G 
Sbjct  335  -NSENCTYNGNPTSICFLFARKWAPNALQPLLRIAPRVLGL  374



>ref|XP_006853920.2| PREDICTED: uncharacterized protein LOC18443676 [Amborella trichopoda]
Length=382

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 1/220 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +S+ DAERRLLANALLDFSNERFVLLSESCIP+ +F TVY YL  S
Sbjct  163  YRRQIPSKVAEWGEMSMCDAERRLLANALLDFSNERFVLLSESCIPIMNFTTVYHYLMRS  222

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP+ YGRGRYN  M P++ + EWRKGSQWFE+NR LA+ ++ +T +Y  FK
Sbjct  223  RHSFVGSFDDPSVYGRGRYNENMAPEVNITEWRKGSQWFEVNRKLALTLIEDTTYYPKFK  282

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY PT   +   Y  ANRS+T+VDWS GG HPA++   +IT  FI  I 
Sbjct  283  NFCRPACYVDEHYFPTMFTIKAPYHIANRSITWVDWSRGGAHPATFGKVDITVEFIARI-  341

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
             NG  C YN   + +C+LFARKF PSAL PL  L+ K +G
Sbjct  342  VNGNECKYNNQSSSVCFLFARKFAPSALVPLLDLAPKFIG  381



>ref|XP_008377912.1| PREDICTED: uncharacterized protein LOC103440993, partial [Malus 
domestica]
Length=220

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -1

Query  784  SQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIE  605
            +Q  EWG +S+ DAERRLLANALLD SNERF+LLSESCIP+Y+F  +Y+YL +S +S++ 
Sbjct  7    AQVAEWGRMSMCDAERRLLANALLDISNERFILLSESCIPLYNFSVIYQYLMKSKYSYVG  66

Query  604  SYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPS  425
            ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +TKFY  FK++CRP+
Sbjct  67   AFDDPGPYGRGRYNDNMAPEVSISKWRKGSQWFEVNRKLAITIVEDTKFYPKFKEFCRPA  126

Query  424  CYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSC  245
            CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+ITE F++ I      C
Sbjct  127  CYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGPHPATFGRADITEEFLKRIFER-QRC  185

Query  244  SYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +YN   + +C+LF RKF PSA+EPL  L+ K +GF
Sbjct  186  TYNDRNSTVCFLFGRKFAPSAMEPLLHLAPKFLGF  220



>ref|XP_006286517.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
 gb|EOA19415.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
Length=386

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAE+RLLANALLD SNE F+L+SESCIP+Y+F T+Y YL+ S
Sbjct  167  HRRQIPSQVAEWGRMSMCDAEKRLLANALLDISNEWFILVSESCIPLYNFTTIYSYLSRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  YGRGRYN+ M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPYGRGRYNSNMEPEVPITKWRKGSQWFEINRDLAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  +++TE F   I 
Sbjct  287  EFCRPACYVDEHYFPTMLTIEKPEVLANRSLTWVDWSRGGPHPATFGRSDVTENFFVKI-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C+YN   T +CYLFARKF PSALEPL  +S K++GF
Sbjct  346  FDGRNCTYNGRNTSMCYLFARKFAPSALEPLLSISPKILGF  386



>ref|XP_010491917.1| PREDICTED: uncharacterized protein LOC104769408 [Camelina sativa]
Length=387

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAE+RLLANALLD SNE FVL+SESCIP+Y+F T+Y YL+ S
Sbjct  168  HRRQIPSQVAEWGRMSMCDAEKRLLANALLDISNEWFVLVSESCIPLYNFTTIYSYLSRS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  YGRGRYN  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  228  KHSFMGAFDDPGPYGRGRYNGNMEPEVPVTKWRKGSQWFEINRDLAATIVKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F   I 
Sbjct  288  EFCRPACYVDEHYFPTMLTIEKPAVLANRSITWVDWSRGGPHPATFGRSDITEKFFGRI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C+YN   T ICYLFARKF PSALEPL  ++ K++GF
Sbjct  347  FDGRNCTYNGRNTSICYLFARKFAPSALEPLLHIAPKILGF  387



>dbj|BAB86235.1| P0648C09.24 [Oryza sativa Japonica Group]
Length=481

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 163/219 (74%), Gaps = 0/219 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGS++L+DAE+RLLANALLDFSN+RFVLLSESCIPV  FP  Y YLT S
Sbjct  160  YGRQIPSQETSWGSITLMDAEKRLLANALLDFSNDRFVLLSESCIPVQSFPVAYGYLTGS  219

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+ R LA+  +++ ++Y +F+
Sbjct  220  RHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFELRRDLAVAALTDARYYPLFR  279

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG HPA+YTA ++T   I SIR
Sbjct  280  RHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGAHPATYTAGDVTPELILSIR  339

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  146
             +   C YN   T  C+LFARKF   ALEPL  +S  VM
Sbjct  340  RSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVM  378



>ref|XP_010519868.1| PREDICTED: uncharacterized protein LOC104799181 [Tarenaya hassleriana]
Length=384

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +++ DAERRLLANALLD SNE FVLLSE+CIP+++F T+++Y+T+S
Sbjct  165  YRRQIPSKAAEWGRMTMCDAERRLLANALLDISNEWFVLLSETCIPLFNFTTIHRYITKS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP  YGRGRYN+ M P++ + +WRKGSQWFE+NR LA+ IV +T +Y  F+
Sbjct  225  KHSFVGSFDDPGPYGRGRYNSSMAPEMDITQWRKGSQWFEVNRELAVTIVKDTVYYPKFR  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY PT L +    + ANRSVT+VDWS GG HPA++  +++TE F   I 
Sbjct  285  DFCRPACYVDEHYFPTMLNVEKPGLLANRSVTWVDWSRGGAHPATFGRSDMTEDFFGRIH  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +CSYN   T +CYLFARKF PSALEPL  L+ KV+GF
Sbjct  345  -GGRNCSYNGHNTSMCYLFARKFAPSALEPLLHLAPKVLGF  384



>ref|XP_004245124.1| PREDICTED: uncharacterized protein LOC101267146 [Solanum lycopersicum]
Length=388

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRLLANALLD SNE FVLLSESCIP+Y+F  +YK+++ S
Sbjct  169  YKRQIPSQATEWGKMSMCDAERRLLANALLDISNEWFVLLSESCIPLYNFNVIYKHISRS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  YGRGRY+  M P++ + +WRKGSQWFEM+R LA+ IV +T FY  F 
Sbjct  229  KHSFVGAFDDPGPYGRGRYDENMLPEVNVSQWRKGSQWFEMSRKLALFIVEDTIFYPKFA  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  ++ITE F++ + 
Sbjct  289  EFCRPACYVDEHYFPTMLTIEASNLLANRSITWVDWSRGGAHPATFGKSDITEEFMKRML  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C+YN   T ICYLFARKF PSALEPL  L+ K +GF
Sbjct  349  -QGQNCTYNNRNTSICYLFARKFAPSALEPLFLLAPKYLGF  388



>ref|XP_011081713.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
 ref|XP_011081714.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
Length=385

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+VDAERRLLANALLD SNE FVLLSESCIP+Y+F  VY Y+T S
Sbjct  166  YKRQIPSQVSEWGKMSMVDAERRLLANALLDISNEWFVLLSESCIPLYNFSMVYNYITGS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+N+ LA+ IV +TKFY  F 
Sbjct  226  KYSFIGAFDDPGPYGRGRYNDNMLPEVNITDWRKGSQWFEINKKLALYIVEDTKFYPKFS  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  ++ITE F + I 
Sbjct  286  EFCKPACYVDEHYFPTMLTIQAATLLANRSITWVDWSRGGAHPATFGGSDITEEFFKKI-  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G SC YN   + ICYLFARKF PSALE L  L+ K +GF
Sbjct  345  FDGRSCLYNNKPSSICYLFARKFSPSALEALFLLAPKFLGF  385



>ref|XP_010912680.1| PREDICTED: uncharacterized protein LOC105038537 [Elaeis guineensis]
Length=385

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 169/221 (76%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  +WGS+SLVDA +RLLANALLD SNERFVLLSESCIPV++FPTVY YL +S
Sbjct  165  YDRQIPSEKTKWGSISLVDARKRLLANALLDLSNERFVLLSESCIPVFNFPTVYNYLIDS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++SYD+    G+G Y++ M P+I   +WRKG+ WFE+ R+LA+ IV++ K+Y++F+
Sbjct  225  AYSFVQSYDENPIQGQGYYDSHMAPEINHSQWRKGTPWFEVQRSLAVNIVADNKYYSIFR  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+ +C+ D+ YIPTYL +  G +NANR+V + DWS+ G HPA+Y   +ITEG IQSIR
Sbjct  285  KYCKTTCHSDDSYIPTYLNMLDGILNANRTVIWADWSMRGSHPATYGHEDITEGIIQSIR  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  345  NNGTICRYNSKPSSVCFLFAMKFSPDALEPLLNLTSTVMKF  385



>ref|XP_006399687.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
 gb|ESQ41140.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
Length=386

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+++F T+Y YL++S
Sbjct  167  YRRQIPSQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLFNFTTIYSYLSQS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPFGRGRYNPNMEPEVPITKWRKGSQWFEINRELAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F   I 
Sbjct  287  EFCRPACYVDEHYFPTMLTIEKPVVLANRSLTWVDWSRGGPHPATFGRSDITENFFGKI-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C+YN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  346  FDGRNCTYNGRNTSMCYLFARKFAPSALEPLLHIAPKILGF  386



>ref|NP_196734.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 emb|CAB87691.1| putative protein [Arabidopsis thaliana]
 gb|AAM13183.1| putative protein [Arabidopsis thaliana]
 gb|AAP68292.1| At5g11730 [Arabidopsis thaliana]
 dbj|BAE99143.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91715.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38636.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=386

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAE+RLLANALLD SNE FVL+SESCIP+Y+F T+Y YL+ S
Sbjct  167  HRRQIPSQVAEWGRMSMCDAEKRLLANALLDVSNEWFVLVSESCIPLYNFTTIYSYLSRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ L +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPFGRGRYNGNMEPEVPLTKWRKGSQWFEVNRDLAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F   I 
Sbjct  287  EFCRPACYVDEHYFPTMLTIEKPTVLANRSLTWVDWSRGGPHPATFGRSDITENFFGKI-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +CSYN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  346  FDGRNCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKILGF  386



>gb|ACF84653.1| unknown [Zea mays]
Length=302

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGSV+LVDAERRLLANALLDFSNERFVLLSESCIPV++F TVY YL  S
Sbjct  82   YGRQIPSQKTSWGSVTLVDAERRLLANALLDFSNERFVLLSESCIPVHNFTTVYDYLVGS  141

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E+Y    R  R RY+ RM PDI L EWRKGSQW E++R LA  ++++T++Y +F+
Sbjct  142  RHSFVEAYYRDDRGCRSRYSRRMAPDITLREWRKGSQWLELSRDLAASVLADTRYYPLFR  201

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHY+ TY+ L HG  N+NR+VT V+W  G  HP +Y A + T   ++SIR
Sbjct  202  RHCTPSCYPDEHYVQTYVSLRHGARNSNRTVTRVEWPAGTSHPVTYGAGDATPELVRSIR  261

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++   C+YN   T  CYLFARKF P AL PL  +S  VM +
Sbjct  262  TSAEPCAYNSRLTSTCYLFARKFSPDALAPLLNMSAAVMHY  302



>ref|XP_010108861.1| hypothetical protein L484_027054 [Morus notabilis]
 gb|EXC20501.1| hypothetical protein L484_027054 [Morus notabilis]
Length=405

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R+I SQ V WGS++++DAERRLLANALLD SN+RFVLLSESCIP+++F  +Y YL  S
Sbjct  184  YGRRIPSQPVYWGSITMIDAERRLLANALLDLSNQRFVLLSESCIPLFNFTAIYSYLINS  243

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP   GRGRYN +M+P IKL +WRKG+QWFE++R LA+ ++S+ KFY +F+
Sbjct  244  NLSFLGSFDDPRSPGRGRYNPQMQPHIKLSDWRKGAQWFELHRDLAVRVLSDRKFYPLFR  303

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
              CRP+CY DEHY+PT + + +G  NANRSVT+VDWS GGPHP  +   ++T+ F+  IR
Sbjct  304  DLCRPACYSDEHYLPTLVNILYGESNANRSVTWVDWSRGGPHPGRFGWGDVTDEFLNRIR  363

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G+ C YN  +T +C+LFARKF P+ALEPL ++S  ++GF
Sbjct  364  F-GSKCLYNGNETSMCFLFARKFLPNALEPLLRVSPVLLGF  403



>ref|XP_010648315.1| PREDICTED: uncharacterized protein LOC100249300 [Vitis vinifera]
Length=385

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +S+ DAERRLLANALLD SNERFVLLSESCIP+Y+F  +Y Y+ +S
Sbjct  166  YRRQIPSKVAEWGRMSMCDAERRLLANALLDISNERFVLLSESCIPLYNFTLIYHYIMKS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ ++DDP  YGRGRYN  MKP++ + +WRKG+QWFE+NR LA+ IV +T FY  F+
Sbjct  226  KYSFMGAFDDPGPYGRGRYNGNMKPEVSISQWRKGAQWFEVNRKLAVNIVEDTTFYKKFE  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +  G++ ANRS+T+VDWS GG HPA++  A+ITE F+  + 
Sbjct  286  EFCKPACYVDEHYFPTMLTIQSGHLIANRSITWVDWSRGGAHPATFGKADITEEFLHRVV  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SN   C YN   +  C+LFARKF PS LEPL +L+ K +GF
Sbjct  346  SN-HKCLYNNQPSSTCFLFARKFAPSTLEPLLQLAHKHLGF  385



>ref|XP_009337144.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
 ref|XP_009337145.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
Length=389

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNERF+LLSESCIP+Y+F  +Y YL +S
Sbjct  170  YGRHIPSQVAEWGRMSMCDAERRLLANALLDISNERFILLSESCIPLYNFSVIYHYLMKS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +S++ ++DDP  YGRGRYN  M P++K+ +WRKGSQWFE+NR LAI IV +TKFY  FK
Sbjct  230  KYSYVGAFDDPGPYGRGRYNDNMAPEVKISKWRKGSQWFEVNRKLAITIVEDTKFYPKFK  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+IT  F++ I 
Sbjct  290  EFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGPHPATFGRAHITGEFLKRIF  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
                 C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  350  ET-QRCTYNDRNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  389



>ref|XP_004959909.1| PREDICTED: uncharacterized protein LOC101775358 [Setaria italica]
Length=410

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S+ V WGS++LVDAE+RLLANALLD+SN+RFVL+SESC+PV++F TVY+YL  S
Sbjct  190  HGRQIPSREVSWGSITLVDAEKRLLANALLDWSNQRFVLVSESCVPVFNFRTVYEYLVNS  249

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HS++ESY+       GRYN  M P++   +WRKGS+WFE++R LA+ +V++ ++YA+F+
Sbjct  250  AHSYVESYNIDVPQCAGRYNPAMAPEVMEEQWRKGSEWFELSRELAVDVVADQRYYALFR  309

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGPHPA +  A  T GF+ +IR
Sbjct  310  RHCTPSCYPDEHYIPTYLHLRHGARNANRTVTWVDWSRGGPHPARFGRAATTAGFVAAIR  369

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSA  182
            +NGT C YN   T +CYLFARKF PSA
Sbjct  370  NNGTRCLYNGKPTTVCYLFARKFAPSA  396



>ref|XP_008795296.1| PREDICTED: uncharacterized protein LOC103711078 [Phoenix dactylifera]
Length=385

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 171/221 (77%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  + GS+SLVDA++RLLANALLD SNERFVLLSESCIPV++F T+Y YL  S
Sbjct  165  YDRQIPSEKTKRGSISLVDAQKRLLANALLDLSNERFVLLSESCIPVFNFQTIYNYLINS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF++S D+    G G YN+RM P+IK  +WR+G++WFE+ R+LA+ IV++ K+Y++F+
Sbjct  225  AYSFVQSNDENPIQGHGSYNSRMAPEIKHSQWREGTRWFEVKRSLAVNIVADNKYYSIFR  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+ +CYPD+ YIPTYL +  G +NANR+VT+ DWS  G HPA+Y + +ITEG IQSIR
Sbjct  285  KYCKITCYPDDSYIPTYLNMLDGILNANRTVTWADWSKRGHHPATYGSEDITEGLIQSIR  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +NGT C+YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  345  NNGTICTYNSKPSSVCFLFAMKFSPDALEPLLNLASMVMKF  385



>ref|XP_002279551.2| PREDICTED: uncharacterized protein LOC100250702 [Vitis vinifera]
Length=427

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKR+I S++V+WG  ++VDAERRLLANALLDFSNERFVLLSE+CIP+++F T+YKYL  S
Sbjct  206  YKRRIPSKSVDWGKATMVDAERRLLANALLDFSNERFVLLSETCIPLFNFTTIYKYLINS  265

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP   GRGRYN RM P + L +WRKGSQWFE++R LAI IVS+  +Y +F+
Sbjct  266  NHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKGSQWFEVHRKLAIEIVSDVTYYPIFQ  325

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY+ T +      +N+NRS+T+VDWS GG HP  +   +++E F+   R
Sbjct  326  EHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVDWSRGGSHPTKFVRKDVSEAFLNQAR  385

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +CSYN G + IC+LFARKF PS LEPL +++  ++GF
Sbjct  386  -HGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAPSLLGF  425



>ref|XP_009131226.1| PREDICTED: uncharacterized protein LOC103855927 [Brassica rapa]
Length=386

 Score =   280 bits (717),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+Y+F T+Y YL++S
Sbjct  167  YKRQIPSQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLYNFTTIYTYLSQS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI + DDP  +GRGRYN +M+P++ + +WRKG QWFE+ R LA  IV +T ++  F+
Sbjct  227  KHSFIGAVDDPGPFGRGRYNEKMEPEVPITKWRKGPQWFEVGRDLAATIVRDTLYHQKFR  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +      ANRSVT+ DWS GGPHPA++  ++ITE F   I 
Sbjct  287  EFCRPACYSDEHYFPTMLTIEKPTALANRSVTWTDWSRGGPHPATFGRSDITEEFFGKI-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +GT+CSYN   T +CYLFARKF PSALEPL  ++ K+MGF
Sbjct  346  FDGTNCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKIMGF  386



>emb|CAN70606.1| hypothetical protein VITISV_040196 [Vitis vinifera]
Length=385

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +S+ DAERRLLANALLD SNERFVLLSESCIP+Y+F  +Y Y+ +S
Sbjct  166  YRRQIPSKVAEWGRMSMCDAERRLLANALLDISNERFVLLSESCIPLYNFTLIYHYIMKS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ ++DDP  YGRGRYN  MKP++ + +WRKG+QWFE+NR LA+ IV +T FY  F+
Sbjct  226  KYSFMGAFDDPGPYGRGRYNGNMKPEVSISQWRKGAQWFEVNRKLAVNIVEDTTFYKKFE  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +  G + ANRS+T+VDWS GG HPA++  A+ITE F+  + 
Sbjct  286  EFCKPACYVDEHYFPTMLTIQSGNLIANRSITWVDWSRGGAHPATFGKADITEEFLHRVV  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SN   C YN   +  C+LFARKF PS LEPL +L+ K +GF
Sbjct  346  SN-HKCLYNNQPSSTCFLFARKFAPSTLEPLLQLAHKHLGF  385



>ref|XP_002872192.1| hypothetical protein ARALYDRAFT_910666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48451.1| hypothetical protein ARALYDRAFT_910666 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+++F T+Y Y+T+S
Sbjct  167  YRRHIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSESCIPLFNFTTIYTYITKS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP+ YGRGRY+  M P++ +++WRKGSQWFE+NR LA+ IV +T +Y  FK
Sbjct  227  KHSFMGSFDDPSPYGRGRYHGNMAPEVSINQWRKGSQWFEVNRELAVSIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +      ANRSVT+VDWS GG HPA++ A +I+E F   + 
Sbjct  287  QFCKPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGAHPATFGAQDISEEFFAWVL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C+YN G T +CYLFARKF PSALEPL +++ K++ F
Sbjct  347  -KGDNCTYNGGYTSMCYLFARKFSPSALEPLIQIAPKILSF  386



>ref|XP_009772023.1| PREDICTED: uncharacterized protein LOC104222493 [Nicotiana sylvestris]
Length=388

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRL+ANALLD SNE FVLLSESCIP+Y+F  +YKY+++S
Sbjct  169  YKRQIPSQVTEWGKMSMCDAERRLIANALLDISNEWFVLLSESCIPLYNFNVIYKYISQS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI ++DDP  YGRGRY+  M P++ + +WRKGSQWFE+NR LA+ IV +TKFY  F 
Sbjct  229  KHSFIGAFDDPGPYGRGRYDENMLPEVNITDWRKGSQWFEINRKLALYIVEDTKFYPKFA  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  ++ITE F++ + 
Sbjct  289  EFCKPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGAHPATFGKSDITEEFMKRML  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G +C+YN     +C+LFARKF PSALEPL  L+   +GF
Sbjct  349  AGG-NCTYNERNISMCFLFARKFAPSALEPLFLLAPTYLGF  388



>ref|XP_010419754.1| PREDICTED: uncharacterized protein LOC104705440 [Camelina sativa]
Length=387

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAE+RLLANALLD +NE FVL+SESCIP+Y+F T+Y Y++ S
Sbjct  168  HRRQILSQVAEWGRMSMCDAEKRLLANALLDINNEWFVLVSESCIPLYNFTTIYSYISRS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  YGRGRYN  M+P++ L +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  228  KHSFMGAFDDPGPYGRGRYNGNMEPEVPLTKWRKGSQWFEINRDLAATIVKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F   I 
Sbjct  288  EFCRPACYVDEHYFPTMLTIEKPAVLANRSITWVDWSRGGPHPATFGRSDITEKFFGRI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C+YN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  347  FDGRNCTYNGRNTSMCYLFARKFAPSALEPLLHIAPKILGF  387



>ref|XP_002872191.1| hypothetical protein ARALYDRAFT_351610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48450.1| hypothetical protein ARALYDRAFT_351610 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+++F T+Y Y+T+S
Sbjct  167  YRRHIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSESCIPLFNFTTIYTYITKS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP+ YGRGRY+  M P++ + +WRKGSQWFE+NR LA+ IV +T +Y  FK
Sbjct  227  KHSFMGSFDDPSPYGRGRYHGNMAPEVSIDQWRKGSQWFEVNRELAVSIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +      ANRSVT+VDWS GG HPA++ A +I+E F   + 
Sbjct  287  QFCKPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGAHPATFGAQDISEEFFAWVL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C+YN G T +CYLFARKF PSALEPL +++ K++ F
Sbjct  347  -KGDNCTYNGGYTSMCYLFARKFSPSALEPLIQIAPKILSF  386



>ref|XP_009357077.1| PREDICTED: uncharacterized protein LOC103947833 [Pyrus x bretschneideri]
Length=400

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ VEWG+V++++AERRLLANALLD SNERFVLLSE+CIP+++F TVY Y+  S
Sbjct  179  HGRRIPSQEVEWGNVNMIEAERRLLANALLDISNERFVLLSEACIPLHNFSTVYNYVIRS  238

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              +F++ YDDP+  GRGRY+  M P + L++WRKGSQWFEM+R+LAI +VS+ K++ +F+
Sbjct  239  NETFVQVYDDPSSVGRGRYSFNMYPQVWLNQWRKGSQWFEMDRSLAIEVVSDRKYFPVFQ  298

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC+ SCY DEHY+PT++ +  G  N+NRS+T+VDWS GGPHPA +T  ++T   + S+R
Sbjct  299  SYCKGSCYADEHYLPTFVNMKFGKKNSNRSLTWVDWSRGGPHPAKFTRTDVTVDVLNSLR  358

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGTSC YN   + +CYLFARKF P  LE L K + K+MGF
Sbjct  359  -NGTSCIYNGRVSNVCYLFARKFGPETLERLLKFAPKLMGF  398



>ref|XP_008339646.1| PREDICTED: uncharacterized protein LOC103402673 [Malus domestica]
Length=400

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ VEWG+V++++AERRLLANALLD SNERFVLLSESCIP+++F TVY Y+  S
Sbjct  179  HGRRIPSQEVEWGNVNMIEAERRLLANALLDISNERFVLLSESCIPLHNFSTVYNYIIRS  238

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              +F++ YDDP+  GRGRY+  M P + L++WRKGSQWFEM+R+LAI +VS+ K++ +F+
Sbjct  239  NETFVQVYDDPSSVGRGRYSFNMYPQVWLNQWRKGSQWFEMDRSLAIEVVSDRKYFPVFQ  298

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC+ SCY DEHY+PT++ +  G  N+NR++T+VDWS GGPHPA +T  ++T   + S+R
Sbjct  299  SYCKGSCYADEHYLPTFVNMKFGKKNSNRTLTWVDWSRGGPHPAKFTRTDVTIDVLNSLR  358

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGTSC YN   + +CYLFARKF P  LE L K + K+MGF
Sbjct  359  -NGTSCIYNGRVSNVCYLFARKFGPETLERLLKFAPKLMGF  398



>ref|XP_004141306.1| PREDICTED: uncharacterized protein LOC101205668 [Cucumis sativus]
 gb|KGN55314.1| hypothetical protein Csa_4G645880 [Cucumis sativus]
Length=386

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI SQ  EWG +S+ DAE+RLLANALLD +NE F+LLSESCIP+++F  +YKYL ES
Sbjct  167  HGRQIPSQVAEWGRMSICDAEKRLLANALLDINNEWFILLSESCIPLFNFSVIYKYLKES  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+DD   YGRGRY   M P++ + EWRKGSQWFE+NR LAI IV +TKFY  F+
Sbjct  227  KYSFVGSFDDLGPYGRGRYRDAMAPEVNITEWRKGSQWFEVNRKLAISIVQDTKFYKKFE  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +  G + ANRS+T+VDWS GGPHPA++   +ITE  +  I 
Sbjct  287  QFCRPPCYVDEHYFPTMLTIEAGDVIANRSLTWVDWSRGGPHPATFGRRDITEELLARI-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +CSYN G + IC LFARKF PS+L PL +L+L V G+
Sbjct  346  VNGQNCSYNNGTSSICSLFARKFAPSSLRPLLRLALDVFGY  386



>ref|NP_001173628.1| Os03g0731050 [Oryza sativa Japonica Group]
 dbj|BAH92356.1| Os03g0731050, partial [Oryza sativa Japonica Group]
Length=240

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP+++F T Y+YL  S
Sbjct  20   YRRQIPSKVAEWGEMTMCDAERRLLANALLDISNEWFVLVSESCIPIFNFNTTYRYLQNS  79

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+NR LAI IV +T +Y  FK
Sbjct  80   SQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEVNRELAIEIVRDTLYYPKFK  139

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +      ANRS+T+VDWS GG HPA++   +ITE F++ ++
Sbjct  140  EFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGAHPATFGRGDITEEFLRRVQ  199

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  200  E-GRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  239



>gb|KJB18563.1| hypothetical protein B456_003G060300 [Gossypium raimondii]
Length=383

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ VEWG +S+ +AERRLLANALLD SNE F+LLSESCIP+Y+F  +Y Y++ S
Sbjct  164  HRRQIPSQMVEWGKMSMCEAERRLLANALLDISNEWFILLSESCIPLYNFSVIYHYISRS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESYDDP  YGRGRY++RM+P++ L +WRKGSQWFE+NR LAI I+ + K+Y  FK
Sbjct  224  NHSFMESYDDPGPYGRGRYDSRMEPEVTLGQWRKGSQWFEVNRMLAINIIEDNKYYPKFK  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY  T L +   ++ ANR++T+ DWS GG HPA++   ++TE F Q I 
Sbjct  284  EFCQPACYVDEHYFTTMLTIQVPHLLANRTLTWTDWSRGGAHPATFGKDDMTEAFFQKI-  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   T +C+LFARKF P+AL+PL +L+ KV GF
Sbjct  343  FEGQACLYNGQPTSLCFLFARKFAPNALDPLLELAPKVFGF  383



>ref|XP_010265065.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265066.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265067.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
Length=411

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = -1

Query  796  RQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTH  617
            R+I S++V+WG  S+++AERRLLANALLDFSN+RFVLLS++CIP+++F TVY YL  ST 
Sbjct  193  RRIPSKDVQWGKFSMIEAERRLLANALLDFSNQRFVLLSDACIPLFNFSTVYNYLIGSTK  252

Query  616  SFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKY  437
            SF+E+YD+P   GRGRY+ RMKPDIKL +WRKGSQWFEM+R LAI I S+ K++++F +Y
Sbjct  253  SFVEAYDEPGPVGRGRYSPRMKPDIKLSQWRKGSQWFEMDRDLAIEIASDRKYFSLFGRY  312

Query  436  CRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSN  257
            C+PSCY DEHYIPT + L     N+NRS+T+VDWS GGPHP  +   ++T   ++ +RS 
Sbjct  313  CKPSCYSDEHYIPTLVSLKFWEKNSNRSLTWVDWSRGGPHPTRFMRTDVTVELLERMRS-  371

Query  256  GTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            G +C YN   T +C LFARKF+P+ L+ L + + KVM F
Sbjct  372  GRTCEYNGKTTNVCSLFARKFYPNTLDRLLRFAPKVMKF  410



>gb|KFK25431.1| hypothetical protein AALP_AA8G114400 [Arabis alpina]
Length=387

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAE+RLLANALLD SNERFVL+SESCIP+++F T+Y YL +S
Sbjct  168  HERQIPSQVAEWGRMSMCDAEKRLLANALLDISNERFVLVSESCIPLFNFTTIYSYLIKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DD   +GRGRY+  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  228  KHSFMGAFDDLGPFGRGRYSQNMEPEVPITKWRKGSQWFEINRDLAATIVEDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  288  EFCRPACYVDEHYFPTMLTIEKPAVLANRSLTWVDWSRGGPHPATFGRSDITEKFFERI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C YN G T +CYLFARKF PS LEPL  ++ KV+GF
Sbjct  347  FDGRNCPYNDGNTSMCYLFARKFAPSTLEPLLHIAHKVLGF  387



>ref|XP_007222675.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
 gb|EMJ23874.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
Length=325

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNE F+L+SESCIP+Y+F  +Y YL +S
Sbjct  106  YGRHIPSQVSEWGRMSMCDAERRLLANALLDISNEWFILVSESCIPLYNFSVIYHYLMKS  165

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +T FY  F+
Sbjct  166  KYSFIGAFDDPGPFGRGRYNNNMAPEVNITQWRKGSQWFEVNRKLAISIVEDTTFYQKFE  225

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+ITE F + + 
Sbjct  226  KFCRPACYVDEHYFPTMLTIQAGNSLANRSITWVDWSRGGPHPATFGRADITEEFFKRML  285

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  286  -EGHRCTYNDRNSSICFLFGRKFAPSAMEPLLHLAPKFLGF  325



>ref|XP_009763004.1| PREDICTED: uncharacterized protein LOC104214963 isoform X2 [Nicotiana 
sylvestris]
Length=230

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -1

Query  781  QNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIES  602
            Q VEWG  ++V+AERRLLANALLD SNERFVLLSESCIP+Y+F T+Y Y+  ST +F+ES
Sbjct  17   QRVEWGKFNMVEAERRLLANALLDLSNERFVLLSESCIPLYNFTTIYNYIMNSTKTFMES  76

Query  601  YDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSC  422
            YD P+  GRGRYN +M+P I L +WRKGSQWFE++R +AI I+++ K++ +FK+YC+P+C
Sbjct  77   YDLPSPVGRGRYNKKMQPWITLDQWRKGSQWFEVDREIAIDIITDQKYFQLFKRYCKPAC  136

Query  421  YPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCS  242
            Y DEHY+PT++ + + + N NR++T+VDW+ GGPHP  +   ++T   +  +R NGT C 
Sbjct  137  YSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGPHPTRFIRTDVTADLLNRMR-NGTQCE  195

Query  241  YNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            YN   T +CYLFARKF PS L+ L + + K+M F
Sbjct  196  YNGDPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  229



>ref|XP_008452696.1| PREDICTED: uncharacterized protein LOC103493641 [Cucumis melo]
Length=386

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI SQ  EWG +S+ DAE+RLLANALLD +NE F+LLSESCIP+++F  +YKYL ES
Sbjct  167  HGRQIPSQVAEWGRMSMCDAEKRLLANALLDINNEWFILLSESCIPLFNFSVIYKYLKES  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+DD   YGRGRY   M P++ + EWRKGSQWFE+NR LAI IV +TK+Y  F+
Sbjct  227  KYSFVGSFDDLGPYGRGRYRDAMAPEVNITEWRKGSQWFEVNRKLAISIVQDTKYYQKFE  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +  G + ANRS+T+VDWS GGPHPA++   +ITE  +  I 
Sbjct  287  QFCRPPCYVDEHYFPTMLTIEAGDVIANRSLTWVDWSRGGPHPATFGRRDITEELLARI-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +CSYN G + IC LFARKF PS+L+PL +L+L V G+
Sbjct  346  VNGQNCSYNNGTSSICSLFARKFAPSSLQPLLRLALDVFGY  386



>ref|XP_002466519.1| hypothetical protein SORBIDRAFT_01g009210 [Sorghum bicolor]
 gb|EER93517.1| hypothetical protein SORBIDRAFT_01g009210 [Sorghum bicolor]
Length=402

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 166/224 (74%), Gaps = 4/224 (2%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ+V+WG +++ DAERRLLANALLD SNE FVL+SESCIP++DF T Y Y   S
Sbjct  179  YRRQIPSQDVQWGQMTMCDAERRLLANALLDISNEWFVLVSESCIPLFDFNTTYGYFQNS  238

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            +HSF+ S DDP R GRGRYN  M P+++L +WRKG QWFE +R LA+ IV +T +Y  FK
Sbjct  239  SHSFVMSIDDPGRDGRGRYNLNMAPEVELEQWRKGWQWFEADRDLAVAIVEDTVYYPKFK  298

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP---HPASYTAANITEGFIQ  272
            ++CRP CY DEHYI T L++   +  ANR+ T+VDWS GGP   HPA++   +ITE F++
Sbjct  299  QFCRPGCYADEHYIQTMLKIEAPHKLANRTATWVDWSRGGPNSAHPATFGRGDITEEFLK  358

Query  271  SIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             IR  G +C YN   T +CYLFARKF PSALEPL +L+  V+GF
Sbjct  359  GIR-GGETCLYNGQNTTLCYLFARKFAPSALEPLLELAPTVLGF  401



>ref|XP_011007501.1| PREDICTED: uncharacterized protein LOC105113152 isoform X2 [Populus 
euphratica]
Length=411

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG  +++DAERRLLANALLDFSNERFVLLSE+CIPV++F T+Y YL  S
Sbjct  190  YQRQIPSKPAEWGRATMIDAERRLLANALLDFSNERFVLLSETCIPVFNFSTIYNYLMNS  249

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP   GRGRYN RM+P + L +WRKGSQWFE +R +AI ++S+ K+Y +F+
Sbjct  250  NQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWFEAHRKVAIEMISDVKYYPVFR  309

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP CY DEHY PT +      +N+NRS+T+VDWS GG HP  +   +++E F+  IR
Sbjct  310  DHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGGGSHPTRFVRKDVSEAFLNQIR  369

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +C+YN G T +C+LFARKF PS L+PL +++  ++GF
Sbjct  370  -NGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAPGLLGF  409



>ref|XP_007222895.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
 gb|EMJ24094.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
Length=398

 Score =   279 bits (713),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ VEWG+V++++AERRLLANALLD SN+RFVLLSESCIP+++F TVY YL  S
Sbjct  177  HDRRIPSREVEWGNVNMIEAERRLLANALLDISNQRFVLLSESCIPLHNFSTVYSYLVRS  236

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF++ YDDP+  GRGRYN+ M P I L +WRKGSQWFEM+R  AI IVS+ K++  F+
Sbjct  237  RESFVQVYDDPSSVGRGRYNSHMYPKISLSQWRKGSQWFEMDRRHAIEIVSDKKYFPAFQ  296

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCR SCY DEHY+PT+  ++ G  N+NRS+T+VDWS GGPHPA +T  ++T   +  +R
Sbjct  297  KYCRGSCYADEHYLPTFANINFGAKNSNRSLTWVDWSRGGPHPAKFTRTDVTVELLSRLR  356

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGT+C YN   T +C+LFARKF P  LE L + + K+M F
Sbjct  357  -NGTACVYNGKSTNVCFLFARKFGPDTLERLLRFAPKLMRF  396



>ref|XP_010033803.1| PREDICTED: uncharacterized protein LOC104423043 [Eucalyptus grandis]
 gb|KCW53627.1| hypothetical protein EUGRSUZ_J02890 [Eucalyptus grandis]
Length=384

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ VEWG +S+ DAERRLLANALLD SNE F+L+SESCIP+ +  TVY YL++S
Sbjct  165  YERQIPSQVVEWGLMSMCDAERRLLANALLDMSNEWFILVSESCIPIQNLTTVYSYLSQS  224

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI S+D+ + YGRGRYN +M P+I L EWRKGSQWFE+NR LAI I+ ++ +Y  FK
Sbjct  225  RYSFIGSFDEDSSYGRGRYNKKMAPEINLTEWRKGSQWFEVNRKLAIDIIEDSTYYPKFK  284

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHPA++  A+IT+ F + I 
Sbjct  285  KFCRPTCYVDEHYFPTMLSIQSPDLLANRSLTWVDWSRGGPHPATFGEADITKEFFKKIL  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N +SCSYN     +C+LFARKF PSAL  L  L+L V G+
Sbjct  345  EN-SSCSYNDQPYSLCFLFARKFAPSALVSLSDLALDVFGY  384



>gb|KJB70318.1| hypothetical protein B456_011G068900 [Gossypium raimondii]
Length=387

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 165/218 (76%), Gaps = 1/218 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWG +S+ +AERRLLANALLD SNE F+LLSESCIP+++F  +Y+Y++ S
Sbjct  168  YGRQIPSQTVEWGRMSMCEAERRLLANALLDISNEWFILLSESCIPLHNFSIIYRYISRS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+D+P  YGRGRYN  M+P++ L +WRKGSQWFE+NR LAI IV +T +Y  FK
Sbjct  228  RHSFMGSFDEPGPYGRGRYNPHMQPEVTLSQWRKGSQWFEVNRKLAIDIVVDTTYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CY DEHY PT L +   ++ ANR++T+ DWS GG HPA++  A+ITEGF + I 
Sbjct  288  KFCRPACYVDEHYFPTMLTIQSPHLLANRTLTWTDWSRGGAHPATFGKADITEGFFKKI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  149
              G  C YN   + +CYLFARKF PSAL+PL  L+ KV
Sbjct  347  FEGQVCLYNGQPSTVCYLFARKFAPSALDPLLGLASKV  384



>emb|CBI33634.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   275 bits (703),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ V WG+ S++DAERRLLANALLDFSN+RFVLLSESCIP+++F T Y YL  S
Sbjct  75   HGRRIPSKPVYWGTASMIDAERRLLANALLDFSNQRFVLLSESCIPLFNFTTTYNYLMAS  134

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE++R LA+ I+S+ K+Y +F 
Sbjct  135  NLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEVHRELAVQIISDRKYYTIFG  194

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P CY DEHYIPT + + +  MN+NRS+T+VDWS GGPHP+ +   +IT+ F+  IR
Sbjct  195  EYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGPHPSKFGWGDITDEFLNKIR  254

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G+ C YN   T IC+LFARKF P+ALEPL +++  ++GF
Sbjct  255  Y-GSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGF  294



>gb|KHG10617.1| Putative non-structural 4 [Gossypium arboreum]
Length=388

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+Y+F  +Y+Y+ +S
Sbjct  169  YRRQIPSQVAEWGRMSMCDAERRLLANALLDISNEWFILLSESCIPLYNFSVIYQYIMKS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +  +Y  F+
Sbjct  229  KHSFMGAFDDPGPFGRGRYNYNMVPEVNISKWRKGSQWFEVNRKLAINIVEDVTYYPKFE  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHP ++  ++ITE F   I 
Sbjct  289  QFCRPACYVDEHYFPTMLTIQTPNLLANRSITWVDWSRGGPHPGTFGRSDITEDFFNRIL  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + IC+LFARKF PSA+EPL +++ KV+GF
Sbjct  349  -EGRQCRYNDQPSSICFLFARKFAPSAMEPLLQIAQKVLGF  388



>ref|XP_002315929.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
 gb|EEF02100.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
Length=411

 Score =   279 bits (713),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG  +++DAERRLLANALLDFSNERFVLLSE+CIPV++F T+Y YL  S
Sbjct  190  YQRQIPSKPAEWGRATMIDAERRLLANALLDFSNERFVLLSETCIPVFNFSTIYNYLMNS  249

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP   GRGRYN RM+P + L +WRKGSQWFE +R +AI ++S+ K+Y +F+
Sbjct  250  NQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWFEAHRKVAIEMISDVKYYPVFR  309

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP CY DEHY PT +      +N+NRS+T+VDWS GG HPA +   +++E F+  IR
Sbjct  310  DHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGGGSHPARFVRKDVSEAFLNQIR  369

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +C+YN G T +C+LFARKF PS L+ L +++ +++GF
Sbjct  370  -NGFNCTYNGGITTVCFLFARKFHPSTLDSLLRIAPELLGF  409



>ref|XP_010941940.1| PREDICTED: uncharacterized protein LOC105060052 [Elaeis guineensis]
Length=384

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+Y+F  +Y+YL  S
Sbjct  164  YNRQIPSKVAEWGKMNMCDAERRLLANALLDLSNEWFVLLSESCIPLYNFSIIYQYLMRS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+DDP  YGRGRYN RM P+I + +WRKG+QWFE+NR LAI IV +TK+Y  FK
Sbjct  224  RYSFVGSFDDPGPYGRGRYNLRMAPEIDITQWRKGAQWFEVNRKLAIDIVRDTKYYPKFK  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+PSCY DEHY PT L +   ++ ANR++T+VDWS GG HPA++   +ITE F++ I 
Sbjct  284  EFCKPSCYVDEHYFPTMLTIESPHLIANRTLTWVDWSRGGAHPATFGKGDITEAFLKKI-  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN   + +C+LFARKF PSA+ PL + +  ++GF
Sbjct  343  FEGKSCLYNDQPSSVCFLFARKFAPSAMAPLLQFAPSLLGF  383



>ref|XP_009403975.1| PREDICTED: uncharacterized protein LOC103987406 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R+I SQ V WG++S++DAERRLLANALLDFSN RFVLLSESCIP+++FPTVY YL  S
Sbjct  176  YGRRIPSQVVRWGTISMLDAERRLLANALLDFSNRRFVLLSESCIPLFNFPTVYSYLINS  235

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T  F+E YDDP   GRGRY + +KP I+  +WRKGSQWF ++R LA+ IVS+ K++ +F+
Sbjct  236  TEVFVEVYDDPGPNGRGRYKSTLKPGIEFKQWRKGSQWFAVDRGLAMEIVSDEKYFPLFQ  295

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YCRPSC  DEHY+PT + +   +  ANRS+T+ DWS GGPHPA      IT   +Q +R
Sbjct  296  RYCRPSCLADEHYLPTLMNVRSFWGTANRSLTWADWSKGGPHPARIGRNEITAELLQRMR  355

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG++CSYN   T+ICYLF RKF P++L  L +L+ K+M F
Sbjct  356  -NGSACSYNGRTTRICYLFGRKFLPNSLNRLVRLAPKLMDF  395



>ref|XP_007024391.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY27013.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=386

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ VEWG +S+ +AERRL+ANALLD SNE F+LLSESCIP+++F  +Y+Y++ S
Sbjct  167  YRRQIPSQMVEWGKMSMCEAERRLIANALLDISNEWFILLSESCIPLHNFSIIYRYISRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+D+   YGRGRYN RM+P++ L +WRKGSQWFE+NR LAI I+ +T +Y  FK
Sbjct  227  RHSFMGSFDEAGPYGRGRYNPRMEPEVTLSQWRKGSQWFEVNRRLAINIIEDTTYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +   ++ ANR++T+ DWS GG HPA++  A+ITEG    I 
Sbjct  287  EFCRPACYVDEHYFPTMLSIQFPHLLANRTLTWTDWSRGGAHPATFGKADITEGLFNKIL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + +CYLFARKF PSAL+PL  L+ KV+G+
Sbjct  347  -EGQLCLYNNQPSSVCYLFARKFAPSALDPLLGLASKVLGY  386



>ref|XP_004291015.1| PREDICTED: uncharacterized protein LOC101301742 [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            +KR I SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+Y+F  VY+Y+ +S
Sbjct  170  HKRHIPSQVAEWGRMSMCDAERRLLANALLDISNEWFILLSESCIPLYNFTVVYEYMRKS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +S++ ++DD   +GRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +TKFY  FK
Sbjct  230  KYSYMGAFDDHGPFGRGRYNDNMAPEVNITQWRKGSQWFEVNRKLAITIVEDTKFYPKFK  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +  G M ANRS+T+VDWS GGPHPA++   +ITE F++ + 
Sbjct  290  EFCRPACYVDEHYFPTMLTIQAGSMIANRSITWVDWSRGGPHPATFGRGDITEDFMKRML  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +   C+YN   + +C+LFARKF PS LEPL +L+ K +GF
Sbjct  350  GSH-RCTYNNQNSTMCFLFARKFAPSTLEPLLRLAPKFLGF  389



>ref|NP_001143735.1| uncharacterized protein LOC100276489 [Zea mays]
 gb|ACG34831.1| hypothetical protein [Zea mays]
 gb|ACG37959.1| hypothetical protein [Zea mays]
Length=429

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGSV+LVDAERRLLANALLDFSNERFVLLSESCIPV++F TVY YL  S
Sbjct  209  YGRQIPSQKTSWGSVTLVDAERRLLANALLDFSNERFVLLSESCIPVHNFTTVYDYLVGS  268

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E+Y    R  R RY+ RM PDI L EWRKGSQW E++R LA  ++++T++Y +F+
Sbjct  269  RHSFVEAYYRDDRGCRSRYSRRMAPDITLREWRKGSQWLELSRDLAASVLADTRYYPLFR  328

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHY+ TY+ L HG  N+NR+VT V+W  G  HP +Y A + T   ++SIR
Sbjct  329  RHCTPSCYPDEHYVQTYVSLRHGARNSNRTVTRVEWPAGTSHPVTYGAGDATPELVRSIR  388

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++   C+YN   T  CYLFARKF P AL PL  +S  VM +
Sbjct  389  ASAEPCAYNSRPTSTCYLFARKFSPDALAPLLNMSSAVMHY  429



>ref|XP_008672591.1| PREDICTED: uncharacterized protein LOC100276489 isoform X1 [Zea 
mays]
 gb|ACF85141.1| unknown [Zea mays]
 gb|ACN33298.1| unknown [Zea mays]
 tpg|DAA56576.1| TPA: hypothetical protein ZEAMMB73_174536 [Zea mays]
Length=430

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGSV+LVDAERRLLANALLDFSNERFVLLSESCIPV++F TVY YL  S
Sbjct  210  YGRQIPSQKTSWGSVTLVDAERRLLANALLDFSNERFVLLSESCIPVHNFTTVYDYLVGS  269

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E+Y    R  R RY+ RM PDI L EWRKGSQW E++R LA  ++++T++Y +F+
Sbjct  270  RHSFVEAYYRDDRGCRSRYSRRMAPDITLREWRKGSQWLELSRDLAASVLADTRYYPLFR  329

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHY+ TY+ L HG  N+NR+VT V+W  G  HP +Y A + T   ++SIR
Sbjct  330  RHCTPSCYPDEHYVQTYVSLRHGARNSNRTVTRVEWPAGTSHPVTYGAGDATPELVRSIR  389

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++   C+YN   T  CYLFARKF P AL PL  +S  VM +
Sbjct  390  TSAEPCAYNSRLTSTCYLFARKFSPDALAPLLNMSAAVMHY  430



>gb|ACL54529.1| unknown [Zea mays]
Length=430

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ   WGSV+LVDAERRLLANALLDFSNERFVLLSESCIPV++F TVY YL  S
Sbjct  210  YGRQIPSQKTSWGSVTLVDAERRLLANALLDFSNERFVLLSESCIPVHNFTTVYDYLVGS  269

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+E+Y    R  R RY+ RM PDI L EWRKGSQW E++R LA  ++++T++Y +F+
Sbjct  270  RHSFVEAYYRDDRGCRSRYSRRMAPDITLREWRKGSQWLELSRDLAASVLADTRYYPLFR  329

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHY+ TY+ L HG  N+NR+VT V+W  G  HP +Y A + T   ++SIR
Sbjct  330  RHCTPSCYPDEHYVQTYVSLRHGARNSNRTVTRVEWPAGTSHPVTYGAGDATPELVRSIR  389

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++   C+YN   T  CYLFARKF P AL PL  +S  VM +
Sbjct  390  TSAEPCAYNSRLTSTCYLFARKFSPDALAPLLNMSAAVMHY  430



>ref|XP_010097098.1| hypothetical protein L484_019537 [Morus notabilis]
 gb|EXB66899.1| hypothetical protein L484_019537 [Morus notabilis]
Length=387

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNERFVLLSESCIP+Y+F  +Y Y+++S
Sbjct  168  YGRHIPSQVSEWGRMSMCDAERRLLANALLDISNERFVLLSESCIPLYNFSIIYHYISKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ ++DDP  YGRGRYN  M P++ +  WRKGSQWFE+NR LA  I+ +T FY  F+
Sbjct  228  KFSFMGAFDDPGPYGRGRYNDNMLPEVNISRWRKGSQWFEVNRKLATYIIGDTTFYPKFE  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++   +IT+ F + + 
Sbjct  288  KFCRPACYVDEHYFPTMLTIEAANLLANRSITWVDWSRGGAHPATFGRPDITDEFFKRV-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              GT C+YN   + IC+LFARKF PSALEPL ++S KV+G+
Sbjct  347  FEGTRCTYNNRNSSICFLFARKFAPSALEPLLRISKKVLGY  387



>ref|XP_009361651.1| PREDICTED: uncharacterized protein LOC103951891 [Pyrus x bretschneideri]
Length=389

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+Y+F  V++YL +S
Sbjct  170  YGRHIPSQVAEWGRMSMCDAERRLLANALLDISNEWFILLSESCIPLYNFSVVHRYLMKS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +S++ ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +TK+Y  FK
Sbjct  230  KYSYVGAFDDPGPHGRGRYNDNMAPEVNISDWRKGSQWFEVNRKLAISIVEDTKYYPKFK  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+ITE F++ I 
Sbjct  290  EFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGPHPATFGRADITEEFLKRIF  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  350  W-GQRCPYNGQNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  389



>ref|XP_004981886.1| PREDICTED: uncharacterized protein LOC101780921 [Setaria italica]
Length=389

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP++DF T YKY   S
Sbjct  169  YRRQIPSKVAEWGQMTMCDAERRLLANALLDISNEWFVLVSESCIPIFDFNTTYKYFQNS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE++R LA+ IV +T +Y  FK
Sbjct  229  SQSFLMAFDDPGPYGRGRYNWNMTPEVELDQWRKGSQWFEVDRELAVAIVKDTVYYPKFK  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +   +  ANRSVT+VDWS GG HPA++   +I+E F++ +R
Sbjct  289  EFCRPHCYVDEHYFPTMLTIEAPHSLANRSVTWVDWSRGGAHPATFGRGDISEEFLRRVR  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  349  -EGRTCLYNNQNSTMCFLFARKFSPSALEPLLELAPTVLGF  388



>ref|XP_011019540.1| PREDICTED: uncharacterized protein LOC105122240 [Populus euphratica]
Length=385

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAERRLLANALLD SNERFVL+SESCIP+Y+F  +Y Y+  S
Sbjct  166  HRRQIPSQVAEWGRMSMCDAERRLLANALLDISNERFVLVSESCIPLYNFSVIYDYIMRS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+NR LA+ +V + ++Y  F+
Sbjct  226  KHSFIGAFDDHGPYGRGRYNENMAPEVNITQWRKGSQWFEINRKLAVSVVEDARYYPKFE  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCY DEHY PT L +    + ANR++T+VDWS GG HPA++  A+ITE F + IR
Sbjct  286  EFCRPSCYVDEHYFPTMLTIEAAPLLANRTLTWVDWSRGGAHPATFGRADITEEFFKKIR  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +   C YN   + +C+LFARKF PSALEPL ++S  V+GF
Sbjct  346  ED-KHCIYNNQSSPVCFLFARKFAPSALEPLLQVSQNVLGF  385



>gb|AFW60050.1| hypothetical protein ZEAMMB73_108408 [Zea mays]
Length=437

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S  V WGS++LVDAE+RLLANALLD+SN+RFVL+SESC+PV++F TVY+YL  S
Sbjct  217  HGRQIPSGEVSWGSITLVDAEKRLLANALLDWSNQRFVLVSESCVPVFNFRTVYEYLVNS  276

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN +M P++    WRKGS+WFEM+R LA+ +V++ ++YA+F+
Sbjct  277  AMSYVESYNIDVPQCAGRYNPQMAPEVLEEHWRKGSEWFEMSRDLAVDVVADQRYYALFR  336

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHYIPT+L L HG  NANR+VT+VDWS GGPHPA +  A  T   + +IR
Sbjct  337  RHCTPSCYPDEHYIPTFLHLRHGARNANRTVTWVDWSRGGPHPARFGKAATTADLMAAIR  396

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SNGT C YN   T +CYLFARKF PSAL  L   S  ++ F
Sbjct  397  SNGTLCLYNGKPTTVCYLFARKFAPSALPMLLNFSNTLLDF  437



>ref|XP_008663766.1| PREDICTED: uncharacterized protein LOC103642231 [Zea mays]
Length=439

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S  V WGS++LVDAE+RLLANALLD+SN+RFVL+SESC+PV++F TVY+YL  S
Sbjct  219  HGRQIPSGEVSWGSITLVDAEKRLLANALLDWSNQRFVLVSESCVPVFNFRTVYEYLVNS  278

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN +M P++    WRKGS+WFEM+R LA+ +V++ ++YA+F+
Sbjct  279  AMSYVESYNIDVPQCAGRYNPQMAPEVLEEHWRKGSEWFEMSRDLAVDVVADQRYYALFR  338

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHYIPT+L L HG  NANR+VT+VDWS GGPHPA +  A  T   + +IR
Sbjct  339  RHCTPSCYPDEHYIPTFLHLRHGARNANRTVTWVDWSRGGPHPARFGKAATTADLMAAIR  398

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            SNGT C YN   T +CYLFARKF PSAL  L   S  ++ F
Sbjct  399  SNGTLCLYNGKPTTVCYLFARKFAPSALPMLLNFSNTLLDF  439



>ref|XP_002458851.1| hypothetical protein SORBIDRAFT_03g041470 [Sorghum bicolor]
 gb|EES03971.1| hypothetical protein SORBIDRAFT_03g041470 [Sorghum bicolor]
Length=395

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 162/221 (73%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ  EWGSV+LVDAE+RLLANALLDFSNERFVLLSESCIPV++F TVY YL  S
Sbjct  175  YGRQIPSQKTEWGSVTLVDAEKRLLANALLDFSNERFVLLSESCIPVHNFTTVYDYLVGS  234

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ESY    R  R RY+  M PDI L +WRKGSQW E++R LA  ++++T++Y +F+
Sbjct  235  RHSFVESYYRNDRGVRNRYSRSMLPDITLRQWRKGSQWLELSRDLATSVLTDTRYYPLFR  294

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRPSCYPDEHY+ TY+ L HG  N+NR+VT V+W  G  HP +Y A + T   ++SIR
Sbjct  295  RHCRPSCYPDEHYVQTYVTLRHGARNSNRTVTRVEWQPGESHPVTYGARDATPELVRSIR  354

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++   C+YN   T  CYLFARKF P AL PL  +S  VM +
Sbjct  355  TSAEPCAYNSRPTSTCYLFARKFAPDALAPLLNMSSTVMHY  395



>ref|XP_008220437.1| PREDICTED: uncharacterized protein LOC103320525 [Prunus mume]
Length=388

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNE F+L+SESCIP+Y+F  +Y YL +S
Sbjct  169  YGRHIPSQVSEWGRMSMCDAERRLLANALLDISNEWFILVSESCIPLYNFSVIYHYLMKS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +T FY  F+
Sbjct  229  KYSFIGAFDDPGPFGRGRYNNNMAPEVNITQWRKGSQWFEVNRKLAISIVEDTTFYPKFE  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+I+E F + + 
Sbjct  289  KFCRPACYVDEHYFPTMLTIQAGNSLANRSITWVDWSRGGPHPATFGRADISEEFFKRML  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  349  -EGHRCTYNDRNSSICFLFGRKFAPSAMEPLLHLAPKFLGF  388



>ref|XP_006485819.1| PREDICTED: uncharacterized protein LOC102611796 [Citrus sinensis]
Length=419

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ V+WG  S+++AERRLLANALLD +N+RFVLLSESCIP+++F T+Y YL  S
Sbjct  199  HGRRIPSKEVQWGKFSMLEAERRLLANALLDITNQRFVLLSESCIPLFNFSTIYNYLINS  258

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + +F+E+YD P   GRGRYN RM+P I+L +WRKGSQWFEM+RALA+ ++S+ K++  FK
Sbjct  259  SKAFVEAYDLPGPVGRGRYNRRMRPVIRLEQWRKGSQWFEMDRALALEVISDKKYFVTFK  318

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+ SCY DEHY+PT++       N+NRS+T+VDWS GGPHPA +   ++T  F++ +R
Sbjct  319  RHCKASCYADEHYLPTFVSAKFWKRNSNRSLTWVDWSKGGPHPAKFQRRDVTIEFLKRLR  378

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S G+ C YN  +T IC+LFARKF P+AL+ L + + KVMGF
Sbjct  379  S-GSHCEYNGKRTNICFLFARKFLPNALDRLLRFAPKVMGF  418



>ref|XP_006466159.1| PREDICTED: uncharacterized protein LOC102619633 [Citrus sinensis]
Length=385

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ +AERRLLANALLD SNE F+LLSESCIP+++F  VY Y+++S
Sbjct  166  YRRQIPSQPAEWGEMSMCEAERRLLANALLDVSNEWFILLSESCIPLHNFSIVYYYISKS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP  YGRGRYN  M+P++ L +WRKGSQWFE+NR LA+ I+ +T +Y  F+
Sbjct  226  RYSFMESYDDPGPYGRGRYNGNMEPEVTLSQWRKGSQWFEINRRLAVDIIEDTSYYPKFR  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P CY DEHY PT L +H   + ANR++T+ DWS GG HPA+Y  A+I+E F + I 
Sbjct  286  DFCKPGCYVDEHYFPTMLTIHFSRLLANRTLTWTDWSRGGAHPATYGGADISEEFFRKIT  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++ + C YN+  T  CYLF RKF PSAL PL +LSL   GF
Sbjct  346  AS-SQCYYNKQVTSFCYLFGRKFAPSALGPLLELSLSAFGF  385



>ref|NP_197969.2| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|ABE66181.1| hypothetical protein At5g25970 [Arabidopsis thaliana]
 gb|AED93506.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38604.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=387

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 1/219 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+++F T+Y Y+T+S
Sbjct  168  YRRHIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSESCIPLFNFTTIYTYMTKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP  YGRGRY+  M P++ + +WRKGSQWFE+NR LA+ IV +T +Y  FK
Sbjct  228  EHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQWRKGSQWFEINRELAVSIVKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +      ANRSVT+VDWS GG HPA++ A +I E F   I 
Sbjct  288  EFCQPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGAHPATFGAQDINEEFFARIL  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  146
              G +C+YN G T +CYLFARKF PSALEPL +++ K++
Sbjct  348  -KGDNCTYNGGYTSMCYLFARKFSPSALEPLVQIAPKLL  385



>gb|KJB54739.1| hypothetical protein B456_009G047200 [Gossypium raimondii]
 gb|KJB54740.1| hypothetical protein B456_009G047200 [Gossypium raimondii]
Length=388

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+Y+F  +Y+Y+ +S
Sbjct  169  YRRQIPSQVAEWGRMSMCDAERRLLANALLDISNEWFILLSESCIPLYNFSVIYQYIMKS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +  +Y  F+
Sbjct  229  KHSFMGAFDDPGPFGRGRYNYNMVPEVNISKWRKGSQWFEVNRKLAINIVEDVTYYPKFE  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGPHP ++  ++IT  F + I 
Sbjct  289  QFCRPACYVDEHYFPTMLTIQTPNLLANRSITWVDWSRGGPHPGTFGRSDITVDFFKRIL  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + IC+LFARKF PSA+EPL +++ KV+GF
Sbjct  349  -EGHQCKYNDQPSSICFLFARKFAPSAMEPLLQIAQKVLGF  388



>gb|ABK28713.1| unknown [Arabidopsis thaliana]
Length=388

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 1/219 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+++F T+Y Y+T+S
Sbjct  168  YRRHIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSESCIPLFNFTTIYTYMTKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP  YGRGRY+  M P++ + +WRKGSQWFE+NR LA+ IV +T +Y  FK
Sbjct  228  EHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQWRKGSQWFEINRELAVSIVKDTLYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +      ANRSVT+VDWS GG HPA++ A +I E F   I 
Sbjct  288  EFCQPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGAHPATFGAQDINEEFFARIL  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  146
              G +C+YN G T +CYLFARKF PSALEPL +++ K++
Sbjct  348  -KGDNCTYNGGYTSMCYLFARKFSPSALEPLVQIAPKLL  385



>ref|XP_009778079.1| PREDICTED: uncharacterized protein LOC104227520 [Nicotiana sylvestris]
Length=382

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ +AERRLLANALLD SNE FVLLSESCIP+++F  VY+Y++ES
Sbjct  163  YRRQIPSQVAEWGKMSVCNAERRLLANALLDISNEWFVLLSESCIPLHNFSVVYRYISES  222

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI  +DDP   GRGRYN  M P++ + EWRKGSQWFE+NR LAI IV +  +Y  F 
Sbjct  223  RHSFISVFDDPGPVGRGRYNKNMSPEVNITEWRKGSQWFEVNRKLAIDIVKDQVYYLKFD  282

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+PSCY DEHY PT L + + ++ ANRS+T VDWS GG HPA++  A+IT+ F++ I 
Sbjct  283  QFCKPSCYVDEHYFPTMLHIQYPHLLANRSLTLVDWSRGGAHPATFGKADITDQFLKKIV  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              GT C YN   T +C+LF RKF PS LEPL + S K +GF
Sbjct  343  EGGT-CVYNNQATSLCFLFTRKFSPSTLEPLLERSSKYLGF  382



>ref|XP_004300973.1| PREDICTED: uncharacterized protein LOC101293399 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKR I S+ VEWG V++V+AERRLLANALLDFSNERFVLLSESCIP+++F TVY YLT S
Sbjct  181  YKRMIPSKAVEWGKVTMVEAERRLLANALLDFSNERFVLLSESCIPLFNFTTVYDYLTNS  240

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI S+DDP   GRGRYN RM P + L +WRKGSQWFE++R LA+ IVS+  ++ +F+
Sbjct  241  KYSFISSFDDPRGTGRGRYNRRMWPTVTLSDWRKGSQWFEVHRNLALKIVSDVTYFPIFR  300

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
              C+P CY DEHY+ T +      +N+NRS+T+ DWS+GGPHPA+Y   ++ E F+  +R
Sbjct  301  DLCQPPCYNDEHYLATLVTKVGPGVNSNRSITWADWSIGGPHPATYERRDVNEMFLNQLR  360

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C+YN G + IC+LFARKF PSALEPL K++  +  F
Sbjct  361  -HGFNCTYNGGISNICHLFARKFHPSALEPLLKIAPALFKF  400



>ref|XP_006842358.2| PREDICTED: uncharacterized protein LOC18432185 [Amborella trichopoda]
Length=216

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 161/215 (75%), Gaps = 1/215 (0%)
 Frame = -1

Query  781  QNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIES  602
            Q V+WG +S++D+ERRLLANALLD SNERFVLLSE+CIP+++F TVY YLT S HS++ S
Sbjct  2    QPVQWGRLSMLDSERRLLANALLDVSNERFVLLSEACIPLFNFTTVYSYLTNSRHSYVHS  61

Query  601  YDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSC  422
            +DDP   GRGRY  RM+P +KL  WRKGSQWFE++RA+A  IV+E+ +Y +F KYC+P+C
Sbjct  62   FDDPGANGRGRYPRRMRPHVKLSSWRKGSQWFELDRAMAQDIVAESNYYGLFAKYCKPTC  121

Query  421  YPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSN-GTSC  245
            Y DEHY+ T + L  G  +ANRS+T+VDWS GGPHP  +    +T   +  +RS  G  C
Sbjct  122  YVDEHYLSTLVALKFGGRSANRSLTWVDWSRGGPHPMRFGRREVTIEVLNKMRSGEGKRC  181

Query  244  SYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             YN G T IC+LFARKF P+AL+ L + + KV+G+
Sbjct  182  GYNGGSTDICFLFARKFLPNALDRLLRFAPKVLGY  216



>ref|XP_002280674.1| PREDICTED: uncharacterized protein LOC100244641 [Vitis vinifera]
Length=414

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ V WG+ S++DAERRLLANALLDFSN+RFVLLSESCIP+++F T Y YL  S
Sbjct  193  HGRRIPSKPVYWGTASMIDAERRLLANALLDFSNQRFVLLSESCIPLFNFTTTYNYLMAS  252

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE++R LA+ I+S+ K+Y +F 
Sbjct  253  NLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEVHRELAVQIISDRKYYTIFG  312

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P CY DEHYIPT + + +  MN+NRS+T+VDWS GGPHP+ +   +IT+ F+  IR
Sbjct  313  EYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGPHPSKFGWGDITDEFLNKIR  372

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G+ C YN   T IC+LFARKF P+ALEPL +++  ++GF
Sbjct  373  Y-GSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGF  412



>ref|XP_008243270.1| PREDICTED: uncharacterized protein LOC103341513 [Prunus mume]
Length=398

 Score =   276 bits (706),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 1/219 (0%)
 Frame = -1

Query  796  RQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTH  617
            R+I S+ V WG+V++++AERRLLANALLD SNERFVLLSESCIP+++F TVY YL  S  
Sbjct  179  RRIPSREVGWGNVNMIEAERRLLANALLDISNERFVLLSESCIPLHNFSTVYSYLVHSRE  238

Query  616  SFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKY  437
            SF++ YDDP+  GRGRYN+ M P I L +WRKGSQWFEM+R  AI IVS+ K++  F+KY
Sbjct  239  SFVQVYDDPSSVGRGRYNSHMYPKISLSQWRKGSQWFEMHRRHAIDIVSDKKYFPAFQKY  298

Query  436  CRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSN  257
            CR SCY DEHY+PT+  ++ G  N+NRS+T+VDWS GGPHPA +T  ++T   +  +R N
Sbjct  299  CRGSCYADEHYLPTFANINFGAKNSNRSLTWVDWSRGGPHPAKFTRTDVTVEVLSRLR-N  357

Query  256  GTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            GT+C YN   T +C+LFARKF P  LE L + + K+M F
Sbjct  358  GTACVYNGKSTNVCFLFARKFGPDTLERLLRFAPKLMRF  396



>gb|KDO58674.1| hypothetical protein CISIN_1g040146mg [Citrus sinensis]
Length=385

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ +AERRLLANALLD SNE F+LLSESC+P+++F  VY Y+++S
Sbjct  166  YRRQIPSQPAEWGEMSMCEAERRLLANALLDVSNEWFILLSESCVPLHNFSIVYYYISKS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ESYDDP  YGRGRYN  M+P++ L +WRKGSQWFE+NR LA+ I+ +T +Y  F+
Sbjct  226  RYSFMESYDDPGPYGRGRYNGNMEPEVTLSQWRKGSQWFEINRRLAVDIIEDTSYYPKFR  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P CY DEHY PT L +H   + ANR++T+ DWS GG HPA+Y  A+I+E F + I 
Sbjct  286  DFCKPGCYVDEHYFPTMLTIHFSRLLANRTLTWTDWSRGGAHPATYGGADISEEFFRKIT  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            ++ + C YN+  T  CYLF RKF PSAL PL +LSL   GF
Sbjct  346  AS-SQCYYNKQVTSFCYLFGRKFAPSALGPLLELSLSAFGF  385



>ref|XP_009763003.1| PREDICTED: uncharacterized protein LOC104214963 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   276 bits (706),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ VEWG  ++V+AERRLLANALLD SNERFVLLSESCIP+Y+F T+Y Y+  S
Sbjct  189  HGRRIPSKRVEWGKFNMVEAERRLLANALLDLSNERFVLLSESCIPLYNFTTIYNYIMNS  248

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +F+ESYD P+  GRGRYN +M+P I L +WRKGSQWFE++R +AI I+++ K++ +FK
Sbjct  249  TKTFMESYDLPSPVGRGRYNKKMQPWITLDQWRKGSQWFEVDREIAIDIITDQKYFQLFK  308

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC+P+CY DEHY+PT++ + + + N NR++T+VDW+ GGPHP  +   ++T   +  +R
Sbjct  309  RYCKPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGPHPTRFIRTDVTADLLNRMR  368

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGT C YN   T +CYLFARKF PS L+ L + + K+M F
Sbjct  369  -NGTQCEYNGDPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  408



>ref|XP_012069039.1| PREDICTED: uncharacterized protein LOC105631509 [Jatropha curcas]
 ref|XP_012069040.1| PREDICTED: uncharacterized protein LOC105631509 [Jatropha curcas]
 gb|KDP40817.1| hypothetical protein JCGZ_24816 [Jatropha curcas]
Length=381

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ VEWG +S+ DAERRLLANA+LD SNE F+LLSE+CIP+++F   Y+Y++ S
Sbjct  162  YKRQIPSQVVEWGRMSMCDAERRLLANAMLDISNEWFILLSEACIPLHNFSIFYRYISRS  221

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+D+   YGRGRYN+ M+P++ L +WRKGSQWFE+NR LAI I+ +T +Y  F+
Sbjct  222  RHSFMGSFDELGPYGRGRYNSNMQPEVTLEQWRKGSQWFEVNRRLAINIIEDTTYYPKFR  281

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P+CY DEHY PT L +   ++ ANR++T+ DWS GG HPA++  A+ITE F + I 
Sbjct  282  DFCQPACYVDEHYFPTMLSIKLPHLLANRTLTWTDWSRGGAHPATFGKADITEEFFKRI-  340

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC+YN   T +CYLFARKF PSAL+PL  L+ KV GF
Sbjct  341  FEGQSCTYNNQPTTVCYLFARKFAPSALDPLLALASKVFGF  381



>ref|XP_008393665.1| PREDICTED: uncharacterized protein LOC103455840 isoform X2 [Malus 
domestica]
Length=387

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNE F LLSESCIP+Y+F  V+ YL +S
Sbjct  168  YGRHIPSQVAEWGRMSICDAERRLLANALLDXSNEWFXLLSESCIPLYNFSVVHHYLMKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +S++ ++DDP  +GRGRYN  M P++K+  WRKGSQWFE+NR LA+ IV +TK+Y  FK
Sbjct  228  KYSYVGAFDDPGPHGRGRYNYNMAPEVKISNWRKGSQWFEVNRKLAVSIVEDTKYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+ITE F++ I 
Sbjct  288  EFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGPHPATFGRADITEEFLKRI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  347  FRGQRCTYNGQNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  387



>ref|XP_008393663.1| PREDICTED: uncharacterized protein LOC103455840 isoform X1 [Malus 
domestica]
 ref|XP_008393664.1| PREDICTED: uncharacterized protein LOC103455840 isoform X1 [Malus 
domestica]
Length=388

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R I SQ  EWG +S+ DAERRLLANALLD SNE F LLSESCIP+Y+F  V+ YL +S
Sbjct  169  YGRHIPSQVAEWGRMSICDAERRLLANALLDXSNEWFXLLSESCIPLYNFSVVHHYLMKS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +S++ ++DDP  +GRGRYN  M P++K+  WRKGSQWFE+NR LA+ IV +TK+Y  FK
Sbjct  229  KYSYVGAFDDPGPHGRGRYNYNMAPEVKISNWRKGSQWFEVNRKLAVSIVEDTKYYPKFK  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGPHPA++  A+ITE F++ I 
Sbjct  289  EFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGPHPATFGRADITEEFLKRI-  347

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  348  FRGQRCTYNGQNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  388



>ref|XP_010244357.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
 ref|XP_010244358.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
Length=385

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAERRLLANALLD SNE FVL+SESCIP+Y+F  +Y Y+  S
Sbjct  166  YRRQIPSQVSEWGKMSMCDAERRLLANALLDISNEWFVLVSESCIPLYNFSIIYNYIARS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +  FY  F+
Sbjct  226  RYSFIGAFDDPGPYGRGRYNENMAPEVNITQWRKGSQWFEINRKLAINIVGDVIFYPKFE  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  A+ITE F++ I 
Sbjct  286  EFCKPNCYVDEHYFPTMLTIQAAQLLANRSITWVDWSRGGAHPATFGRADITEDFVKRIL  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN   + +CYLFARKF PSALEPL  L+ K  G+
Sbjct  346  -EGHSCLYNNQPSSVCYLFARKFAPSALEPLFFLAPKYFGY  385



>ref|XP_010318628.1| PREDICTED: uncharacterized protein LOC101267221 isoform X2 [Solanum 
lycopersicum]
Length=282

 Score =   272 bits (695),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ VEWG  ++V+AERRLLANALLD SNERFVLLSESCIP+YDF T+Y Y+  S
Sbjct  62   HDRRVASKKVEWGKFNMVEAERRLLANALLDISNERFVLLSESCIPLYDFTTIYDYIINS  121

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             ++F+ESYD  +  GRGRYN +MKP + L +WRKGSQWFE++R +AI I+S+ K+  +FK
Sbjct  122  ANTFMESYDLISPVGRGRYNKKMKPLVTLAQWRKGSQWFEVDREIAIDIISDQKYSNLFK  181

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY+PT++ + + + N NR++T+VDW+ GGPHP  +   ++TE  +  +R
Sbjct  182  RFCRPACYSDEHYLPTFVTMKYWWKNENRTLTWVDWAKGGPHPTKFIRPDVTEDLLYGMR  241

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGT C YN   + +CYLFARKF PS L+ L + + K+M F
Sbjct  242  -NGTKCEYNGQPSNMCYLFARKFLPSTLDRLLRFAPKIMKF  281



>gb|AFO66494.1| hypothetical protein [Brassica napus]
Length=386

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+++F T+Y YL+ +
Sbjct  167  YQRQIPSQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLFNFTTIYSYLSRT  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPFGRGRYNDNMEPEVPITKWRKGSQWFEINRELAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +      ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  287  EFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGPHPATFGRSDITEKFFERIL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  347  -DGKNCVYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>gb|KHG11266.1| Insulin-degrading enzyme [Gossypium arboreum]
Length=359

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+Y+F  +Y Y+ +S
Sbjct  140  YRRQIPSQVSEWGKMSMCDAERRLLANALLDISNEWFILLSESCIPLYNFSVIYHYIKKS  199

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DDP  +G+GRYN  M P++ L +WRKGSQWFE+NR LA+ IV +  +Y  F+
Sbjct  200  KYSFIGAFDDPGPHGQGRYNESMAPEVNLTQWRKGSQWFEINRKLAVNIVEDITYYPKFE  259

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++ +A+ITE F   I 
Sbjct  260  QFCRPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGAHPATFGSADITEEFFTRIY  319

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + IC+LFARKF PSALEPL +++ KV+GF
Sbjct  320  -EGHECWYNDQPSSICFLFARKFAPSALEPLLQIAPKVLGF  359



>gb|KJB65609.1| hypothetical protein B456_010G103300 [Gossypium raimondii]
Length=386

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+Y+F  +Y Y+ +S
Sbjct  167  YRRQIPSQVSEWGKMSMCDAERRLLANALLDISNEWFILLSESCIPLYNFSVIYHYIKKS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DDP  +G+GRYN  M P++ L +WRKGSQWFE+NR LA+ IV +  +Y  F+
Sbjct  227  KYSFIGAFDDPGPHGQGRYNESMAPEVNLTQWRKGSQWFEINRKLAVNIVEDITYYPKFE  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++ +A+ITE F   I 
Sbjct  287  QFCRPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGAHPATFGSADITEEFFTRIY  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + IC+LFARKF PSALEPL +++ KV+GF
Sbjct  347  -EGHECRYNDQPSSICFLFARKFAPSALEPLLQIAPKVLGF  386



>ref|XP_007044267.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY00099.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=404

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R+I S+ V+WG  ++VDAERRLLANALLD +NERFVLLSE+CIP+++F TVY YL  S
Sbjct  182  YERRIPSKPVQWGRATMVDAERRLLANALLDLTNERFVLLSEACIPLFNFTTVYNYLINS  241

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ S+DDPT  GRGRYN +M P + L +WRKGSQWFE+NR LA  IVS+ K+Y +F+
Sbjct  242  SRSFLGSFDDPTHTGRGRYNKQMWPTVSLADWRKGSQWFEVNRMLAAEIVSDDKYYPVFR  301

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP CY DEHY+PT + L    +N+NRS+T+VDWS GGPHP  Y   +++   +  +R
Sbjct  302  DHCRPPCYMDEHYLPTLVNLICPELNSNRSITWVDWSRGGPHPTKYLRKDVSVALLNQVR  361

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C+YN  ++ IC+LFARKF PS LEPL +++  ++GF
Sbjct  362  -QGFNCTYNGERSSICFLFARKFHPSTLEPLLRIAPALLGF  401



>ref|XP_007044265.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00097.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=399

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y R+I S+ VEWG V++++AERRLLANALLDFSN+RFVLLSESCIP+++F TVY YL  S
Sbjct  178  YGRRIPSKEVEWGKVNMIEAERRLLANALLDFSNQRFVLLSESCIPIFNFSTVYSYLINS  237

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ESYD     GRGRY+ RM P + L +WRKG+QWFEM+R LAI +VS+ +++ +F+
Sbjct  238  SQSFVESYDLEGPVGRGRYSRRMSPRVTLDQWRKGAQWFEMDRELAIGVVSDQEYFPVFQ  297

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+ +CY DEHY+PT++ +  G+ N+NR++T+VDWS GGPHPA +    +T  F++ +R
Sbjct  298  KYCKGACYADEHYLPTFVTMKFGHKNSNRTLTWVDWSKGGPHPAKFLRTEVTVEFLERLR  357

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S G+ C YN   T IC+LFARKF P AL  L K + K+M F
Sbjct  358  S-GSQCQYNGNTTDICHLFARKFSPDALYRLLKFAPKLMHF  397



>ref|XP_011007493.1| PREDICTED: uncharacterized protein LOC105113152 isoform X1 [Populus 
euphratica]
Length=415

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 166/225 (74%), Gaps = 5/225 (2%)
 Frame = -1

Query  802  YKRQIKS----QNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKY  635
            Y+RQI S    Q  EWG  +++DAERRLLANALLDFSNERFVLLSE+CIPV++F T+Y Y
Sbjct  190  YQRQIPSKCFLQPAEWGRATMIDAERRLLANALLDFSNERFVLLSETCIPVFNFSTIYNY  249

Query  634  LTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFY  455
            L  S  SF+ S+DDP   GRGRYN RM+P + L +WRKGSQWFE +R +AI ++S+ K+Y
Sbjct  250  LMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWFEAHRKVAIEMISDVKYY  309

Query  454  AMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFI  275
             +F+ +CRP CY DEHY PT +      +N+NRS+T+VDWS GG HP  +   +++E F+
Sbjct  310  PVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGGGSHPTRFVRKDVSEAFL  369

Query  274  QSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              IR NG +C+YN G T +C+LFARKF PS L+PL +++  ++GF
Sbjct  370  NQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAPGLLGF  413



>ref|XP_010999299.1| PREDICTED: uncharacterized protein LOC105107168 [Populus euphratica]
Length=383

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+++F  +Y+Y+++S
Sbjct  164  YKRQIPSQVAEWGMMSMCDAERRLLANALLDISNEWFILLSESCIPLHNFGIIYRYISKS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI  +DDP  YGRGRYN  M+P++ L +WRKGSQWFE++R LA+ ++ ++ +Y  FK
Sbjct  224  RYSFIGVFDDPGPYGRGRYNWNMQPEVMLDQWRKGSQWFEVDRKLAVSVIEDSTYYPKFK  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP CY DEHY PT L +   ++ ANRSVT+ DWS GG HPA++  ++IT+ F + + 
Sbjct  284  DFCRPGCYADEHYFPTMLSIQFPHLLANRSVTWTDWSRGGAHPATFGNSDITDEFFKRM-  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN     +C+LFARKF PSALEPL  LS KV+GF
Sbjct  343  FEGQSCLYNNQPDNVCFLFARKFAPSALEPLLDLSPKVLGF  383



>ref|XP_009151114.1| PREDICTED: uncharacterized protein LOC103874440 [Brassica rapa]
Length=386

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+Y+F T+Y Y+++S
Sbjct  167  YRRQIPSQVAEWGRMTICDAERRLLANALLDISNEWFVLLSESCIPLYNFTTIYGYISKS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP+ YGRGRYN  M P++ + +WRKGSQWFE+NR LA+ +V +T +Y  FK
Sbjct  227  KHSFMGSFDDPSPYGRGRYNGNMSPEVSIEQWRKGSQWFEVNRELAVSLVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C P+CY DEHY PT L +      ANRS+T+VDWS GG HPA++   +I E F   I 
Sbjct  287  EFCTPACYVDEHYFPTMLTIEKPAALANRSLTWVDWSRGGAHPATFGEPDINEDFFAKIM  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C+YN   T +C LFARKF PSALEPL +++ K++ F
Sbjct  347  -KGDNCTYNGESTSMCSLFARKFSPSALEPLIQIAPKILSF  386



>ref|XP_007226202.1| hypothetical protein PRUPE_ppa016185mg [Prunus persica]
 gb|EMJ27401.1| hypothetical protein PRUPE_ppa016185mg [Prunus persica]
Length=404

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKR+I SQ VEWG  ++VDAERRLLANALLDFSNERFVLLSESCIP+++F  VY +L  S
Sbjct  183  YKRKIPSQAVEWGKPTMVDAERRLLANALLDFSNERFVLLSESCIPLFNFTKVYSHLVNS  242

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP   GRGRY  +M P + L +WRKGSQWFE +R L I IVS+  +Y +FK
Sbjct  243  NHSFVSSFDDPRNVGRGRYKKQMWPTVTLSDWRKGSQWFEAHRKLTIEIVSDPTYYPVFK  302

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C P CY DEHY+ T +      +N+NR++T+VDWS GGPHP ++   ++TE F+  +R
Sbjct  303  DFCLPPCYTDEHYLATLVTKVGPGINSNRTITWVDWSTGGPHPTTFVRKDVTENFLIRLR  362

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +C+YN G + IC+LFARKF PS LEPL K++  + GF
Sbjct  363  -NGFNCTYNGGMSSICHLFARKFHPSTLEPLLKIAPALFGF  402



>emb|CDX69735.1| BnaA10g20840D [Brassica napus]
Length=386

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+++F T+Y YL+ S
Sbjct  167  HQRQIPSQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLFNFTTIYSYLSRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPFGRGRYNDNMEPEVPITKWRKGSQWFEINRELAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY PT L +      ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  287  EFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGPHPATFGRSDITEKFFEKIL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  347  -DGKNCVYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>gb|AAD40142.1|AF149413_23 contains similarity to several Arabidopsis thaliana hypothetical 
proteins including GB:U95973 and GB:AC002392 [Arabidopsis 
thaliana]
Length=436

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 1/219 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R I SQ  EWG +++ DAERRLLANALLD SNE FVLLSESCIP+++F T+Y Y+T+S
Sbjct  217  YRRHIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSESCIPLFNFTTIYTYMTKS  276

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP  YGRGRY+  M P++ + +WRKGSQWFE+NR LA+ IV +T +Y  FK
Sbjct  277  EHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQWRKGSQWFEINRELAVSIVKDTLYYPKFK  336

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +      ANRSVT+VDWS GG HPA++ A +I E F   I 
Sbjct  337  EFCQPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGAHPATFGAQDINEEFFARIL  396

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  146
              G +C+YN G T +CYLFARKF PSALEPL +++ K++
Sbjct  397  -KGDNCTYNGGYTSMCYLFARKFSPSALEPLVQIAPKLL  434



>ref|XP_008806040.1| PREDICTED: uncharacterized protein LOC103718829 [Phoenix dactylifera]
Length=397

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 170/220 (77%), Gaps = 1/220 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ V WG +S+++AERRLLANALLDFSN+RF+LLSESCIP+++F T+Y YL  S
Sbjct  176  HGRRVPSKLVRWGQLSMMEAERRLLANALLDFSNQRFILLSESCIPLFNFSTIYSYLINS  235

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +++ SYDDP   GRGRYN RMKP +KL +WRKGSQWFE++R LAI I+S+ K++ +FK
Sbjct  236  TKTYVSSYDDPGPNGRGRYNIRMKPHVKLQQWRKGSQWFEVDRNLAIEIISDDKYFPVFK  295

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC+PSCY DEHY+ T++ +   + NANRS+T+VDWS  GPHPA +   ++T   ++ +R
Sbjct  296  RYCKPSCYVDEHYLSTFVSMRFWWRNANRSLTWVDWSKRGPHPARFGRLDVTIELLKGMR  355

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
             NG++C YN   T IC+LFARKF P++L  L + + KVMG
Sbjct  356  -NGSTCDYNGRTTSICFLFARKFLPNSLTRLMRFAPKVMG  394



>ref|XP_010049161.1| PREDICTED: uncharacterized protein LOC104437817 [Eucalyptus grandis]
 gb|KCW81640.1| hypothetical protein EUGRSUZ_C03002 [Eucalyptus grandis]
Length=385

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = -1

Query  799  KRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTEST  620
            +RQI SQ  EWG +S+ DAE+RLLANALLD SNERF+LLSESCIP+Y+F  +Y Y+ +S 
Sbjct  167  RRQIPSQVSEWGRMSMCDAEKRLLANALLDISNERFILLSESCIPLYNFSLIYHYIMKSG  226

Query  619  HSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKK  440
            +SF+ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+NR LAI IV +  ++  F+ 
Sbjct  227  YSFMGAFDDPGPYGRGRYNLNMAPEVNISQWRKGSQWFEINRKLAINIVEDATYHPKFET  286

Query  439  YCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRS  260
            +CRP+CY DEHY PT L +  G++ ANRS+T+VDWS GG HPA++  ++ITE F++ I  
Sbjct  287  FCRPACYVDEHYFPTMLTIQAGHLLANRSITWVDWSRGGAHPATFGRSDITEEFLRRISK  346

Query  259  NGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            N   C+YN+  +  C+LFARKF PSAL PL +L+ KV+G+
Sbjct  347  N-QRCTYNKRNSSTCFLFARKFAPSALHPLLELAPKVLGY  385



>gb|EEE59868.1| hypothetical protein OsJ_12453 [Oryza sativa Japonica Group]
Length=383

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP+++F T Y+YL  S
Sbjct  163  YRRQIPSKVAEWGEMTMCDAERRLLANALLDISNEWFVLVSESCIPIFNFNTTYRYLQNS  222

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+NR LAI IV +T +Y  FK
Sbjct  223  SQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEVNRELAIEIVRDTLYYPKFK  282

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +      ANRS+T+VDWS GG HPA++   +ITE F++ ++
Sbjct  283  EFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGAHPATFGRGDITEEFLRRVQ  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  343  -EGRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  382



>ref|XP_006344151.1| PREDICTED: uncharacterized protein LOC102582712 [Solanum tuberosum]
Length=305

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKR+I SQ V+WG  +++DAERRLLANALLD SNERF+LLSESCIP ++F T+Y YLT S
Sbjct  85   YKRRIPSQAVQWGRSTMIDAERRLLANALLDISNERFILLSESCIPFFNFTTIYTYLTNS  144

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN RM P+I L +WRKGSQWFE++R LA+ IVS+  +Y +FK
Sbjct  145  DQSFLGSFDDPRKIGRGRYNKRMYPNITLSDWRKGSQWFEVHRKLAVKIVSDVMYYPVFK  204

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC P CY DEHY+PT +      + +NRSVT+ DWS GG HP ++   ++TE F++S+ 
Sbjct  205  NYCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWADWSAGGSHPMTFLKKDVTEEFLKSVG  264

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S   +CSYN   + IC+LF RKF PS L+PL +++ K++GF
Sbjct  265  SE-LNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  304



>ref|XP_002515894.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46314.1| conserved hypothetical protein [Ricinus communis]
Length=385

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ VEWG +S+ D ERRLLANALLD SNE F+LLSE+CIP+++F  +Y+Y++ S
Sbjct  166  YRRQIPSQIVEWGRMSMCDGERRLLANALLDISNEWFILLSEACIPLHNFSIIYRYISRS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+D+ + YGRGRYN  M+P++ L +WRKGSQWFE+NR  A+ IV +T +Y  F+
Sbjct  226  RHSFMGSFDENSPYGRGRYNWNMQPEVTLEQWRKGSQWFEVNRRFAVNIVEDTTYYPKFR  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P+CY DEHY PT L +   ++ ANR++T+ DWS GG HPA++  A+ITE F + + 
Sbjct  286  DFCQPACYVDEHYFPTMLTIQVPHLLANRTLTWTDWSRGGAHPATFGKADITEEFFKRM-  344

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC+YN   T +CYLFARKF PSALEPL  LS KV GF
Sbjct  345  FEGQSCTYNNQPTTVCYLFARKFAPSALEPLLGLSSKVFGF  385



>ref|NP_001169393.1| uncharacterized protein LOC100383262 [Zea mays]
 gb|ACN33611.1| unknown [Zea mays]
 tpg|DAA51166.1| TPA: hypothetical protein ZEAMMB73_632462 [Zea mays]
Length=403

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 166/224 (74%), Gaps = 4/224 (2%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+ V+WG +++ DAERRLLANALLD SNE FVL+SESCIP++DF T Y+Y   S
Sbjct  180  YRRQIPSKAVQWGQMTMCDAERRLLANALLDISNEWFVLVSESCIPLFDFNTTYEYFQNS  239

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            +HSF+ S DDP R GRGRYN  M P+++L +WRKG QWFE +R LA+ IV +T +Y  FK
Sbjct  240  SHSFVMSIDDPGRDGRGRYNLNMAPEVELEQWRKGWQWFEADRDLAVAIVEDTVYYPKFK  299

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP---HPASYTAANITEGFIQ  272
            ++CRP CY DEHYI T L++   +  ANR+ T+VDWS GGP   HPA++   +ITE F++
Sbjct  300  QFCRPGCYADEHYIQTMLKIEAPHKLANRTATWVDWSRGGPNSAHPATFGRGDITEEFLK  359

Query  271  SIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +R  G +C YN   T +C+LFARKF PSAL+PL +L+  V+GF
Sbjct  360  GVR-GGETCLYNGRNTTVCFLFARKFAPSALQPLLELAPTVLGF  402



>ref|XP_002516477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45818.1| conserved hypothetical protein [Ricinus communis]
Length=371

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAERRLLANALLD SNERF+LLSESCIP+Y+F  +Y Y+ +S
Sbjct  152  HRRQIPSQISEWGKMSMCDAERRLLANALLDISNERFILLSESCIPLYNFSVIYHYIMKS  211

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+NR LA+ IV +T FY  F+
Sbjct  212  RYSFIGAFDDHGPYGRGRYNENMAPEVNITQWRKGSQWFEINRRLAVNIVEDTTFYPKFE  271

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P CY DEHY PT L +   ++ ANRS+T+VDWS GG HPA++   +ITE F + I 
Sbjct  272  EFCKPHCYVDEHYFPTMLTIQAAHLLANRSITWVDWSRGGAHPATFGRGDITEDFFRRIH  331

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G +C+YN   +  C+LFARKF PSALEPL  +S K +GF
Sbjct  332  A-GQNCTYNNQPSSTCFLFARKFAPSALEPLLLVSSKFLGF  371



>ref|XP_010267069.1| PREDICTED: uncharacterized protein LOC104604439 isoform X1 [Nelumbo 
nucifera]
Length=385

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +S+ DAERRLLANALLD SNERFVL+SESCIP+Y+F  VY ++  S
Sbjct  166  YRRQIPSQVAEWGKMSMCDAERRLLANALLDISNERFVLVSESCIPLYNFSIVYHHIASS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+NR LA+ IV +  FY  F+
Sbjct  226  RYSFMGAFDDPGPYGRGRYNQNMAPEVNITQWRKGSQWFEINRRLAVNIVEDVTFYPKFE  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG HPA++  A+ITE F++ I 
Sbjct  286  EFCKPACYVDEHYFPTMLTIQTPQLLANRSITWVDWSRGGAHPATFGNADITEDFLKRIL  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN   + +C+LFARKF PSALEPL  L+ K  G+
Sbjct  346  -EGNSCLYNNLPSSVCFLFARKFSPSALEPLLLLASKYFGY  385



>ref|XP_006651782.1| PREDICTED: uncharacterized protein LOC102702183 [Oryza brachyantha]
Length=330

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP+++F T Y+YL  S
Sbjct  110  YRRQIPSKVAEWGEMTMCDAERRLLANALLDISNEWFVLVSESCIPIFNFNTTYRYLQNS  169

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE++R LAI IV +T +Y  FK
Sbjct  170  SQSFVMAFDDPGPYGRGRYNWNMTPEVELEQWRKGSQWFEVDRELAIAIVKDTLYYPKFK  229

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +      ANRS+T+VDWS GG HPA++   +ITE F++ ++
Sbjct  230  EFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGAHPATFGRGDITEEFLRRVQ  289

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   + +C+LFARKF PS+LEPL +L+  V+GF
Sbjct  290  E-GRTCLYNGQNSTMCFLFARKFAPSSLEPLLELAPTVLGF  329



>ref|XP_009624653.1| PREDICTED: uncharacterized protein LOC104115679 [Nicotiana tomentosiformis]
Length=408

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 164/219 (75%), Gaps = 1/219 (0%)
 Frame = -1

Query  796  RQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTH  617
            R+I S+ VEWG  ++V+AERRLLANALLD SNERFVLLSESCIP+Y+F T+Y Y+  ST 
Sbjct  190  RRIPSKRVEWGKFNMVEAERRLLANALLDLSNERFVLLSESCIPLYNFTTIYNYIMNSTK  249

Query  616  SFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKY  437
            +F+ESYD P+  GRGRYN +M+P I L +WRKGSQWFE++R +AI I+S+ K++ +FK+Y
Sbjct  250  TFMESYDLPSPVGRGRYNKKMRPWITLDQWRKGSQWFEVDREMAIDIISDQKYFQLFKRY  309

Query  436  CRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSN  257
            C+P+CY DEHY+PT   + + + N NR++T+VDWS GGPHP  +    +T   +  +R N
Sbjct  310  CKPACYSDEHYLPTVATMRYWWKNGNRTLTWVDWSKGGPHPTRFIRTEVTADLLNRMR-N  368

Query  256  GTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            GT C YN   T +CYLFARKF PS L+ L + + K+M F
Sbjct  369  GTKCEYNGEPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  407



>gb|KHG05757.1| hypothetical protein F383_31190 [Gossypium arboreum]
Length=387

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 1/218 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ VEWG +S+ +AERRLLANALLD SNE F+LLSESCIP+++F  +Y Y++ S
Sbjct  168  YGRQIPSQMVEWGRMSMCEAERRLLANALLDISNEWFILLSESCIPLHNFSIIYHYISRS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S+D+P  YGRGRYN  M+P++ L +WRKGSQWFE+NR LAI IV +T +Y  FK
Sbjct  228  RYSFMGSFDEPGPYGRGRYNPHMEPEVTLSQWRKGSQWFEVNRKLAIDIVVDTTYYPKFK  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            K+CRP+CY DEHY PT L +   ++ ANR++T+ DWS GG HPA++  A+ITEGF + I 
Sbjct  288  KFCRPACYVDEHYFPTMLTIQSPHLLANRTLTWTDWSRGGAHPATFGKADITEGFFKKI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  149
              G  C YN   + +CYLFARKF PSAL+PL  L+ KV
Sbjct  347  FEGQVCLYNGQPSTVCYLFARKFAPSALDPLLGLASKV  384



>gb|AAT77886.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98696.1| expressed protein [Oryza sativa Japonica Group]
Length=398

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP+++F T Y+YL  S
Sbjct  178  YRRQIPSKVAEWGEMTMCDAERRLLANALLDISNEWFVLVSESCIPIFNFNTTYRYLQNS  237

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+NR LAI IV +T +Y  FK
Sbjct  238  SQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEVNRELAIEIVRDTLYYPKFK  297

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +      ANRS+T+VDWS GG HPA++   +ITE F++ ++
Sbjct  298  EFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGAHPATFGRGDITEEFLRRVQ  357

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  358  -EGRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  397



>ref|XP_002309520.1| hypothetical protein POPTR_0006s24970g [Populus trichocarpa]
 gb|EEE93043.1| hypothetical protein POPTR_0006s24970g [Populus trichocarpa]
Length=385

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAERRLLANALLD SNERFVL+SESCIP+Y+F  +Y Y+  S
Sbjct  166  HRRQIPSQVAEWGRMSMCDAERRLLANALLDISNERFVLVSESCIPLYNFSVIYDYMMRS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+NR LA+ +V + ++Y  F+
Sbjct  226  KYSFIGAFDDHGPYGRGRYNENMAPEVNITQWRKGSQWFEINRKLAVNVVEDARYYPKFE  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+PSCY DEHY PT L +    + ANR++T+VDWS GG HPA++  A+IT+ F + IR
Sbjct  286  EFCKPSCYVDEHYFPTMLTIEAAPLLANRTLTWVDWSRGGAHPATFGRADITKEFFKKIR  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             + T C YN   + +C+LFARKF PSALEPL ++S  V+GF
Sbjct  346  ED-THCVYNNQSSPVCFLFARKFAPSALEPLLQVSQNVLGF  385



>ref|XP_010265068.1| PREDICTED: uncharacterized protein LOC104602905 [Nelumbo nucifera]
Length=409

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+R+I S+ VEWG  +++DAERRLLANALLDFSNERFVLLSESCIP+++F TVY YL  S
Sbjct  188  YRRRIPSKAVEWGRSTMIDAERRLLANALLDFSNERFVLLSESCIPLFNFTTVYNYLINS  247

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN  M P + + EWRKGSQWFE++R LA+ I+++ K+Y +F+
Sbjct  248  NVSFLGSFDDPRKAGRGRYNRLMWPIVNITEWRKGSQWFEVHRDLAVEIIADRKYYPVFQ  307

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YC PSCY DEHY+PT + +    +N+NRSVT+VDWS  GPHP  +   ++T+ F+  IR
Sbjct  308  NYCTPSCYMDEHYLPTLVNMIAPELNSNRSVTWVDWSRPGPHPGKFGWNDMTDEFLNRIR  367

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
              GT+C+YN   T IC+LFARKF PSALEPL +++  ++G
Sbjct  368  Y-GTNCTYNGLPTSICFLFARKFLPSALEPLLRITPLLLG  406



>ref|XP_008812373.1| PREDICTED: uncharacterized protein LOC103723273 [Phoenix dactylifera]
Length=406

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ V+WG +S+++AERRLLANALLDFSN+RF+LLSESCIP+++F T+Y YL  S
Sbjct  185  HGRRVPSKVVKWGQLSMMEAERRLLANALLDFSNQRFILLSESCIPLFNFSTIYSYLINS  244

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +++ S+DD    GRGRYN RMKP +KL EWRKGSQW E++R LAI I+S+ K++ +FK
Sbjct  245  TKTYVSSFDDRGPNGRGRYNIRMKPQVKLQEWRKGSQWLEVDRDLAIEIISDEKYFPVFK  304

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+ SCY DEHY+PT++ +   + N+NRS+T+VDWS GGPHPA +   ++T   ++ +R
Sbjct  305  KYCKRSCYVDEHYLPTFVSMRFWWSNSNRSLTWVDWSKGGPHPARFGRLDVTIELLERMR  364

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG++C YN   T +C+LFARKF P++L  L + + KVMGF
Sbjct  365  -NGSTCKYNGRTTNVCFLFARKFLPNSLTRLMRFAPKVMGF  404



>ref|XP_006442617.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
 gb|ESR55857.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
Length=419

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 170/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ V+WG  S+++AERRLLANALLD +N+RFVLLSESCIP+++F T+Y YL  S
Sbjct  199  HGRRIPSKEVQWGKFSMLEAERRLLANALLDITNQRFVLLSESCIPLFNFSTIYNYLINS  258

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + +FIE+YD P   GRGRYN  M+P I+L +WRKGSQWFEM+RALA+ ++S+ K++  FK
Sbjct  259  SKAFIEAYDLPGPVGRGRYNRPMRPVIRLEQWRKGSQWFEMDRALALEVISDKKYFVTFK  318

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+ SCY DEHY+PT++ +     N+NRS+T+VDWS GGPHPA +   ++T  F++ +R
Sbjct  319  RHCKASCYADEHYLPTFVSVKFWKRNSNRSLTWVDWSKGGPHPAKFQRRDVTIEFLKRLR  378

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S G+ C YN   T IC+LFARKF P+AL+ L + + KVMGF
Sbjct  379  S-GSHCEYNGKSTNICFLFARKFLPNALDRLLRFAPKVMGF  418



>ref|XP_007217120.1| hypothetical protein PRUPE_ppa015089m1g, partial [Prunus persica]
 gb|EMJ18319.1| hypothetical protein PRUPE_ppa015089m1g, partial [Prunus persica]
Length=214

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -1

Query  775  VEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYD  596
            V WG+ +++DAERRLLANALLDFSN+RFVLLSESCIP+++F T Y YL  S  SF+ S+D
Sbjct  2    VYWGTSTMLDAERRLLANALLDFSNQRFVLLSESCIPLFNFTTTYDYLINSNLSFLSSFD  61

Query  595  DPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYP  416
            DP + GRGRYN +M P I +  WRKGSQWFE++R LAI IVS+ K+Y +F++YCRPSCY 
Sbjct  62   DPRKPGRGRYNPKMYPIINITNWRKGSQWFEVHRELAIHIVSDCKYYPIFQEYCRPSCYI  121

Query  415  DEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYN  236
            DEHYIPT + + +  +N+ RS+T+VDWS GGPHP  +  ++IT+ F+  IR  G+ C YN
Sbjct  122  DEHYIPTLVNILYSELNSKRSITWVDWSRGGPHPGKFEWSDITDEFLNRIRF-GSECEYN  180

Query  235  RGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
               T IC+LFARKF P+ LEPL +++  ++GF
Sbjct  181  GNTTSICFLFARKFMPNTLEPLLRVAPLLLGF  212



>ref|XP_008244554.1| PREDICTED: uncharacterized protein LOC103342693 [Prunus mume]
Length=341

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + ++I SQ V WG+ +++DAERRLLANALLDFSN+RFVLLSESCIP+++F T Y YL  S
Sbjct  120  HGKRIHSQPVYWGTSTMLDAERRLLANALLDFSNQRFVLLSESCIPLFNFTTTYDYLINS  179

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN +M P I +  WRKGSQWFE++R LAI IVS+ K+Y +F+
Sbjct  180  NLSFLSSFDDPRKPGRGRYNPQMYPIINITNWRKGSQWFEVHRELAIHIVSDCKYYPIFQ  239

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P CY DEHYIPT + L +  +N+ RS+T+VDWS GGPHP  +  ++IT+ F+  IR
Sbjct  240  EYCHPPCYIDEHYIPTLVNLLYSELNSKRSITWVDWSRGGPHPGKFGGSDITDEFLNRIR  299

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G+ C YN   T IC+LFARKF P+ LEPL +++  ++GF
Sbjct  300  F-GSECEYNGNTTSICFLFARKFMPNTLEPLLRVAPLLLGF  339



>gb|KEH39949.1| core-2/I-branching enzyme [Medicago truncatula]
Length=376

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 160/222 (72%), Gaps = 2/222 (1%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRLLANALLD SNERF+LLSESCIP+Y F  VY YL +S
Sbjct  156  YKRQIPSQIAEWGRMSMCDAERRLLANALLDISNERFILLSESCIPLYKFSLVYNYLMKS  215

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ ++DDP  YGRGRYN  M P + + +WRKGSQWFE++R LAI IV +T FY  F+
Sbjct  216  KFSFVGAFDDPGPYGRGRYNPNMAPLVDVAKWRKGSQWFEVSRKLAINIVEDTAFYPKFE  275

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YCRP+CY DEHY PT L +  G   ANRSVT+VDWS GG HPA++   +IT  F   +R
Sbjct  276  QYCRPACYVDEHYFPTMLTIQAGSALANRSVTWVDWSRGGAHPATFGRTDITNEFFDRVR  335

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEP-LEKLSLKVMGF  140
              G  C YN   + +C LFARKF PSALEP L+ ++ KV+ F
Sbjct  336  -GGQKCLYNNRNSTLCSLFARKFAPSALEPLLDMVNSKVLDF  376



>ref|XP_004986256.1| PREDICTED: uncharacterized protein LOC101760830 [Setaria italica]
Length=407

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 165/224 (74%), Gaps = 4/224 (2%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+ VEWG +++ DAERRLLANALLD SNE FVL+SESCIP++DF T Y+Y   S
Sbjct  184  YRRQIPSKVVEWGQMTMCDAERRLLANALLDISNEWFVLVSESCIPLFDFNTTYQYFQNS  243

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+ S DDP R GRGRYN  M P++ L +WRKG QWFE++R LAI IV +T +Y  FK
Sbjct  244  SQSFVMSIDDPGRDGRGRYNLNMAPEVYLEQWRKGWQWFEVDRELAIAIVRDTLYYPKFK  303

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP---HPASYTAANITEGFIQ  272
            K+CRP CY DEHYI T L +   +  ANR+VT+VDWS GGP   HPA++   +ITE F++
Sbjct  304  KFCRPGCYADEHYIQTMLTIEATHSLANRTVTWVDWSRGGPHAAHPATFGRGDITEEFLR  363

Query  271  SIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             IR  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  364  GIR-GGETCMYNNQNSTMCHLFARKFAPSALEPLLELAPTVLGF  406



>ref|XP_006369242.1| hypothetical protein POPTR_0001s20050g [Populus trichocarpa]
 gb|ERP65811.1| hypothetical protein POPTR_0001s20050g [Populus trichocarpa]
Length=383

 Score =   273 bits (698),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKRQI SQ  EWG +S+ DAERRLLANALLD SNE F+LLSESCIP+++F  +Y+Y+++S
Sbjct  164  YKRQIPSQVAEWGMMSMCDAERRLLANALLDISNEWFILLSESCIPLHNFGIIYRYISKS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+  +DDP  YGRGRYN  M+P++ L +WRKGSQWFE++R LA+ ++ ++ +Y  FK
Sbjct  224  RYSFMGVFDDPGPYGRGRYNWNMQPEVTLEQWRKGSQWFEVDRKLAVSVIEDSTYYPKFK  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP CY DEHY PT L +   ++ ANRSVT+ DWS GG HPA++  ++IT+ F + + 
Sbjct  284  DFCRPGCYVDEHYFPTMLSIQFPHLLANRSVTWTDWSRGGAHPATFGNSDITDEFFKRM-  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G SC YN     +C+LFARKF PSALEPL  LS KV+GF
Sbjct  343  FEGQSCLYNNQPDNVCFLFARKFSPSALEPLLDLSPKVLGF  383



>emb|CDX97141.1| BnaC09g44840D [Brassica napus]
Length=386

 Score =   273 bits (698),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+++F T+Y YL+ S
Sbjct  167  HQRQIPSQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLFNFTTIYSYLSRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPFGRGRYNHNMEPEVPITKWRKGSQWFEINRELAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY PT L +      ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  287  DFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGPHPATFGRSDITERFFEKIL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  347  -DGKNCIYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>ref|XP_004238913.2| PREDICTED: uncharacterized protein LOC101249916 [Solanum lycopersicum]
Length=351

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            YKR+I SQ V+WG  +++DAERRLLANALLD SNERF+LLSESCIP+++F T+Y YLT S
Sbjct  131  YKRRIPSQAVQWGRSTMIDAERRLLANALLDISNERFILLSESCIPLFNFTTIYTYLTNS  190

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN RM P+I L +WRKGSQWFE++R LA+ IVS+  +Y +FK
Sbjct  191  DQSFLGSFDDPRKIGRGRYNKRMYPNITLFDWRKGSQWFEIHRELAVKIVSDVLYYPVFK  250

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C P CY DEHY+PT +      + +NRSVT+VDWS GG HP ++   ++TE F++S+ 
Sbjct  251  NHCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWVDWSAGGSHPMTFLKKDVTEEFLKSVG  310

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S   +CSYN   + IC+LF RKF PS L+PL +++ K++GF
Sbjct  311  SE-LNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  350



>emb|CDX97139.1| BnaC09g44860D [Brassica napus]
Length=386

 Score =   273 bits (697),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+++F T+Y YL+ S
Sbjct  167  HQRQIPSQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLFNFTTIYSYLSRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+NR LA  IV +T +Y  FK
Sbjct  227  KHSFMGAFDDPGPFGRGRYNHNMEPEVPITKWRKGSQWFEINRELAATIVKDTLYYPKFK  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY PT L +      ANRS+T+VDWS GGPHPA++  ++ITE F + I 
Sbjct  287  DFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGPHPATFGRSDITERFFEKIL  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  347  -DGKNCIYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>ref|XP_006353820.1| PREDICTED: uncharacterized protein LOC102581987 [Solanum tuberosum]
Length=325

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ V+WG  S+VDAERRLLANALLD SNERFVLLSE+CIP+Y+F T+Y Y+  S
Sbjct  105  HARRVPSKRVDWGEFSMVDAERRLLANALLDMSNERFVLLSEACIPLYNFTTIYTYIMNS  164

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +F+ESYD+    GRGRYN++M P + + +WRKGSQWFE++R +A+ ++++TKF+ +FK
Sbjct  165  TKTFVESYDEWGPVGRGRYNSQMTPWVTIEQWRKGSQWFELDREIALDMITDTKFFNLFK  224

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY+PT++ + + + N NR++T+VDW+ GGPHP  +    +T   +  +R
Sbjct  225  DFCRPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGPHPTKFARTEVTRELLHQMR  284

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G  C YN   T +CYLFARKF PSAL+ L K + KVM F
Sbjct  285  T-GIQCMYNGEPTSMCYLFARKFLPSALDRLLKFAPKVMMF  324



>ref|XP_010099264.1| hypothetical protein L484_015454 [Morus notabilis]
 gb|EXB77528.1| hypothetical protein L484_015454 [Morus notabilis]
Length=423

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 165/221 (75%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S+ V WG V++++AERRLL NALLD SNERF+LLSE+CIP+Y+F T+Y YL  +
Sbjct  201  HGRRIPSKEVGWGKVNMIEAERRLLTNALLDVSNERFILLSEACIPLYNFKTIYNYLINA  260

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T + + +YD+P   GRGRYN  M PDI L +WRKGSQWFEMNR LAI +VS++K++ +F+
Sbjct  261  TKNHVMAYDEPGVVGRGRYNYHMYPDISLKQWRKGSQWFEMNRELAIEVVSDSKYFPIFQ  320

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYCR +CY DEHY+PT + +     N+NRS+T+VDWS GGPHPA +   ++T   ++S+R
Sbjct  321  KYCRGNCYSDEHYLPTLVSIKFWEGNSNRSLTWVDWSKGGPHPARFWRTDVTLELLRSMR  380

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             N T C+YN   T +CYLFARKF PS ++ L K + K+M F
Sbjct  381  RNNTGCAYNENSTNLCYLFARKFLPSTVDRLLKFAPKIMHF  421



>ref|XP_009356238.1| PREDICTED: uncharacterized protein LOC103947108 [Pyrus x bretschneideri]
Length=400

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ VEWG V++++AERRLLANALLD SN+RF+LLSESC+P+++FPTVY YL  S
Sbjct  179  HGRRIPSQEVEWGKVNMIEAERRLLANALLDISNQRFILLSESCVPLHNFPTVYNYLIRS  238

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              +F+  YDDP+  GRGRY++ M P I L +WRKGSQWFE++R+LAI +VS+ K++ +F+
Sbjct  239  NETFVGVYDDPSSVGRGRYSSHMYPQISLSQWRKGSQWFEIDRSLAIEVVSDKKYFPVFQ  298

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             YCR SCY DEHY+PTY+ +     N+NRS+T+VDWS GG HPA +T  ++T   ++S+R
Sbjct  299  TYCRGSCYADEHYLPTYVNIKFAQKNSNRSLTWVDWSRGGAHPAKFTRTDVTVEVLKSLR  358

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGT+C YN   + +C+LFARKF P  LE L + + K+M F
Sbjct  359  -NGTACIYNGRVSNVCFLFARKFGPGTLERLLRFAPKLMRF  398



>ref|XP_002447391.1| hypothetical protein SORBIDRAFT_06g034240 [Sorghum bicolor]
 gb|EES11719.1| hypothetical protein SORBIDRAFT_06g034240 [Sorghum bicolor]
Length=446

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQI S  V WGS++LVDAE+RLLANALLD+SN+RFVL+SESC+PV++F TVY+YL  S
Sbjct  226  HGRQIPSGEVSWGSITLVDAEKRLLANALLDWSNQRFVLVSESCVPVFNFRTVYEYLVNS  285

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              S++ESY+       GRYN RM P++    WRKGS+WFEM+R LA+ +V++ ++Y +F+
Sbjct  286  AMSYVESYNIDVPQCAGRYNPRMAPEVLEEHWRKGSEWFEMSRDLAVDVVADQRYYVLFR  345

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C PSCYPDEHYIPT+L L HG  NANR+VT+VDWS GGPHPA +  A  T   + +IR
Sbjct  346  RHCTPSCYPDEHYIPTFLHLRHGAGNANRTVTWVDWSRGGPHPARFGKAATTSDLMAAIR  405

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSA  182
            SNGT C YN   T +CYLFARKF PSA
Sbjct  406  SNGTLCLYNGKPTTVCYLFARKFAPSA  432



>ref|XP_010936142.1| PREDICTED: uncharacterized protein LOC105055840 [Elaeis guineensis]
Length=395

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+  EWG +S+ DAERRLLANALLD SNE FVLLSESCIP+ +F   YK+L  S
Sbjct  175  YRRQIPSKVSEWGQMSMCDAERRLLANALLDLSNEWFVLLSESCIPLSNFSIAYKHLMRS  234

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI + DDP  YGRGRYN  M P++ + +WRKGSQWF ++R  A+ IV +T +Y  F+
Sbjct  235  RHSFIGAMDDPGPYGRGRYNLNMAPEVNITQWRKGSQWFAVSRKSAVSIVKDTTYYPKFE  294

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +C+P+CY DEHY PT L +   ++ ANRS+T+VDWS GG HPA++  A+ITE FI+SI 
Sbjct  295  NFCKPNCYVDEHYFPTLLTIESPHLLANRSITWVDWSRGGAHPATFGGADITETFIRSIL  354

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C YN   T +C+LFARKF PSALEPL +++ K++GF
Sbjct  355  -EGHTCLYNNQSTSLCHLFARKFAPSALEPLLQVAPKMLGF  394



>ref|XP_010926004.1| PREDICTED: uncharacterized protein LOC105048408 [Elaeis guineensis]
Length=407

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 170/220 (77%), Gaps = 1/220 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ V+WG +S+++AERRLLANALLDFSN+RFVLLSESCIP+++FPT+Y YL  S
Sbjct  186  HGRRVPSKPVKWGQLSMMEAERRLLANALLDFSNQRFVLLSESCIPLFNFPTIYSYLINS  245

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +++ SYDDP   GRGRY  +M+P ++L +WRKGSQWFE++R LAI I+S+ K++ +FK
Sbjct  246  TKTYVSSYDDPGPNGRGRYRIKMRPYLELQQWRKGSQWFEVDRNLAIEIISDEKYFPVFK  305

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+PSCY DEHY+ T++ +     NANRS+T+VDWS GGPHPA +   ++T   ++ +R
Sbjct  306  KYCKPSCYVDEHYLSTFVSISFWGRNANRSLTWVDWSKGGPHPARFGRLDVTIELLERLR  365

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
             NG++C YN   T IC+LFARKF P++L    + + KVMG
Sbjct  366  -NGSTCDYNGRTTNICFLFARKFLPNSLTRFLRFAPKVMG  404



>gb|AAM63616.1| unknown [Arabidopsis thaliana]
Length=381

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ+V WG +S+ DAERRLLANALLD SNE FVLLSE+CIP+  F  VY+Y++ S
Sbjct  162  YRRQIPSQHVAWGEMSMCDAERRLLANALLDISNEWFVLLSEACIPLRGFNFVYRYVSRS  221

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S D+   YGRGRY+  M P++ L+EWRKGSQWFE+NRALA+ IV +  +Y  FK
Sbjct  222  RYSFMGSVDEDGPYGRGRYSYAMGPEVSLNEWRKGSQWFEINRALAVDIVEDMVYYNKFK  281

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L + +    ANR++T+ DWS GG HPA++  A+ITE FI+ + 
Sbjct  282  EFCRPPCYVDEHYFPTMLSIGYPDFLANRTLTWTDWSRGGAHPATFGKADITEKFIKKL-  340

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S G +C YN   +Q+CYLFARKF PSAL+PL KL+ KV+GF
Sbjct  341  SRGKACFYNDQPSQVCYLFARKFAPSALKPLLKLAPKVLGF  381



>emb|CDX78439.1| BnaA03g03510D [Brassica napus]
Length=401

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 2/221 (1%)
 Frame = -1

Query  802  YKRQIKSQNV-EWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTE  626
            YKRQI SQ V EWG +++ DAE+RLLANALLD SNE FVL+SESCIP+Y+F T+Y YL++
Sbjct  167  YKRQIPSQQVAEWGRMTMCDAEKRLLANALLDISNEWFVLVSESCIPLYNFTTIYTYLSQ  226

Query  625  STHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMF  446
            S HSFI + DDP  +GRGRYN  M+P++ + +WRKG QWFE++R LA  IV +  ++  F
Sbjct  227  SKHSFIGAVDDPGPFGRGRYNDNMEPEVPITKWRKGPQWFELDRDLAATIVKDALYHHKF  286

Query  445  KKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSI  266
            +++CRP+CY DEHY PT L +      ANRSVT+ DWS GGPHPA++  ++ITE F   I
Sbjct  287  REFCRPACYSDEHYFPTMLTIEKPTALANRSVTWTDWSRGGPHPATFGRSDITEEFFGKI  346

Query  265  RSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  143
              +G +CSYN   T +CYLFARKF PSALEPL  ++ K+MG
Sbjct  347  -FDGENCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKIMG  386



>gb|EMT03400.1| hypothetical protein F775_00930 [Aegilops tauschii]
Length=266

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP++DF T Y Y   S
Sbjct  46   YHRQIPSKVAEWGQMTMCDAERRLLANALLDISNEWFVLVSESCIPIFDFNTTYDYFQNS  105

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+  +DDP  YGRGRYN  M P+++L +WRKGSQWFE++R LAI I+ +T++Y  FK
Sbjct  106  SQSFVMVFDDPGPYGRGRYNYNMTPEVELEQWRKGSQWFEVDRDLAIEIIRDTRYYPKFK  165

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +      ANRSVT+VDWS GG HPA++   +ITE F++ ++
Sbjct  166  EFCRPHCYVDEHYFPTMLTIEAPQSLANRSVTWVDWSRGGAHPATFGRGDITEEFLRRVQ  225

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + G +C YN   +  C+LFARKF PSAL+PL  L+  V+G+
Sbjct  226  T-GRTCLYNNQNSTTCFLFARKFAPSALQPLLVLAPTVLGY  265



>ref|XP_011081610.1| PREDICTED: uncharacterized protein LOC105164614 [Sesamum indicum]
Length=388

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI+SQ  EWG++S+ DAERRLLANALLD SNE F+LLSE+CIP+ +F T+Y YL+ S
Sbjct  169  YGRQIRSQVAEWGTMSMCDAERRLLANALLDISNEWFILLSEACIPLQNFTTIYNYLSRS  228

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SFI ++D+P  YGRGRYN +M+P+I +  WRKGSQWFE+NR LA+ I+ +T +Y+ F+
Sbjct  229  RFSFIGAFDEPGPYGRGRYNPKMRPEINISNWRKGSQWFEINRELAVNIIQDTFYYSKFE  288

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +   +M ANR++T+VDWS GGPHPA++   +IT+   ++I 
Sbjct  289  QFCRPDCYVDEHYFPTMLSIKSPHMLANRTLTWVDWSRGGPHPATFEETDITDELFKTIL  348

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NG +C YN   T +C+LFARKF P+AL+ L + S K +GF
Sbjct  349  -NGGTCMYNDQPTNLCFLFARKFAPNALDHLLQHSSKFLGF  388



>gb|KDP29448.1| hypothetical protein JCGZ_18369 [Jatropha curcas]
Length=258

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I S++V+WG+V++++AERRLLANALLD SN+RFVLLSE+CIP+++F T+Y YL  S
Sbjct  37   HGRRIPSKDVKWGNVNMIEAERRLLANALLDISNQRFVLLSEACIPLFNFSTIYSYLINS  96

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T +F+E+YD     GRGRYN +M P I + +WRKGSQWFEM+R LAI +VS+ K++ +F+
Sbjct  97   TKNFVEAYDLEGPVGRGRYNHQMSPQITIDQWRKGSQWFEMDRQLAIEVVSDQKYFPIFQ  156

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            KYC+ +CY DEHY+PT++ + H   N+NRS+T+VDWS GGPHP  +    +T  F++ +R
Sbjct  157  KYCKGNCYADEHYLPTFVSMKHWQRNSNRSLTWVDWSRGGPHPTRFIRTEVTVEFLEKLR  216

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S G+ C YN   + IC+LFARKF P+AL+ L + + K M F
Sbjct  217  S-GSKCLYNGKSSSICFLFARKFLPTALDRLLRFAPKAMHF  256



>ref|NP_566682.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|ABJ17144.1| At3g21310 [Arabidopsis thaliana]
 gb|AEE76491.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
Length=383

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ+V WG +S+ DAERRLLANALLD SNE FVLLSE+CIP+  F  VY+Y++ S
Sbjct  164  YRRQIPSQHVAWGEMSMCDAERRLLANALLDISNEWFVLLSEACIPLRGFNFVYRYVSRS  223

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ S D+   YGRGRY+  M P++ L+EWRKGSQWFE+NRALA+ IV +  +Y  FK
Sbjct  224  RYSFMGSVDEDGPYGRGRYSYAMGPEVSLNEWRKGSQWFEINRALAVDIVEDMVYYNKFK  283

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L + +    ANR++T+ DWS GG HPA++  A+ITE FI+ + 
Sbjct  284  EFCRPPCYVDEHYFPTMLSIGYPDFLANRTLTWTDWSRGGAHPATFGKADITEKFIKKL-  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S G +C YN   +Q+CYLFARKF PSAL+PL KL+ KV+GF
Sbjct  343  SRGKACFYNDQPSQVCYLFARKFAPSALKPLLKLAPKVLGF  383



>ref|XP_009344746.1| PREDICTED: uncharacterized protein LOC103936628 [Pyrus x bretschneideri]
Length=558

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ V WG+ S++DAERRLLANALLD SN+RFVLLSESCIP+++F T Y YL  S
Sbjct  337  HSRRIHSQPVYWGTSSMLDAERRLLANALLDISNQRFVLLSESCIPLFNFTTAYHYLINS  396

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE++R LA+ IVS+ K+Y +F+
Sbjct  397  NLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEVHRELAVHIVSDRKYYPIFQ  456

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P CY DEHYIPT + L +  +N+NRSVT+VDWS GGPHP  +   +IT+ F+  IR
Sbjct  457  QYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGPHPGKFGWMDITDEFLNRIR  516

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G+ C+YN   T +C+LFARKF P ALEPL +++  ++GF
Sbjct  517  F-GSECTYNGNTTSVCFLFARKFLPDALEPLLRVAPLLLGF  556



>ref|XP_004236422.2| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318627.1| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R++ S+ VEWG  ++V+AERRLLANALLD SNERFVLLSESCIP+YDF T+Y Y+  S
Sbjct  206  HDRRVASKKVEWGKFNMVEAERRLLANALLDISNERFVLLSESCIPLYDFTTIYDYIINS  265

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             ++F+ESYD  +  GRGRYN +MKP + L +WRKGSQWFE++R +AI I+S+ K+  +FK
Sbjct  266  ANTFMESYDLISPVGRGRYNKKMKPLVTLAQWRKGSQWFEVDREIAIDIISDQKYSNLFK  325

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP+CY DEHY+PT++ + + + N NR++T+VDW+ GGPHP  +   ++TE  +  +R
Sbjct  326  RFCRPACYSDEHYLPTFVTMKYWWKNENRTLTWVDWAKGGPHPTKFIRPDVTEDLLYGMR  385

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             NGT C YN   + +CYLFARKF PS L+ L + + K+M F
Sbjct  386  -NGTKCEYNGQPSNMCYLFARKFLPSTLDRLLRFAPKIMKF  425



>ref|XP_006450782.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 ref|XP_006450783.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 ref|XP_006475972.1| PREDICTED: uncharacterized protein LOC102614541 isoform X1 [Citrus 
sinensis]
 ref|XP_006475973.1| PREDICTED: uncharacterized protein LOC102614541 isoform X2 [Citrus 
sinensis]
 gb|ESR64022.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 gb|ESR64023.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 gb|KDO79995.1| hypothetical protein CISIN_1g016651mg [Citrus sinensis]
 gb|KDO79996.1| hypothetical protein CISIN_1g016651mg [Citrus sinensis]
Length=385

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 159/221 (72%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ  EWG +S+ DAERRLLANALLD SNE F+L+SESCIP+Y+F  +Y Y+ +S
Sbjct  166  YNRQIPSQISEWGKMSMCDAERRLLANALLDISNEWFILVSESCIPLYNFSLIYHYIKKS  225

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSF+ S+DDP  YGRGRYN  M P + + +WRKGSQWFE+NR LA+ IV +T +Y  F 
Sbjct  226  KHSFMGSFDDPGPYGRGRYNANMAPVVNITQWRKGSQWFEINRRLAVNIVEDTTYYPKFA  285

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +    + ANRS T+VDWS GG HPA++  A+ITE F + + 
Sbjct  286  EFCRPPCYVDEHYFPTMLSIQMPNLLANRSSTWVDWSRGGAHPATFGRADITEEFFKKVY  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C YN   + +C+LF RKF PSAL+PL  +S KV+GF
Sbjct  346  G-GQHCKYNNQPSTVCFLFGRKFAPSALQPLMNISSKVLGF  385



>ref|XP_010230469.1| PREDICTED: uncharacterized protein LOC100843610 [Brachypodium 
distachyon]
Length=390

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI S+  EWG +++ DAERRLLANALLD SNE FVL+SESCIP++DF T Y+Y   S
Sbjct  170  YHRQIASKVAEWGQMTMCDAERRLLANALLDISNEWFVLVSESCIPIFDFNTTYEYFQNS  229

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            + SF+  +DDP  YGRGRYN  M P++++ +WRKGSQWFE++R LAI IV +T++Y  FK
Sbjct  230  SQSFVMVFDDPGPYGRGRYNDNMTPEVEITQWRKGSQWFEVDRELAIEIVKDTRYYPKFK  289

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++CRP CY DEHY PT L +      ANRSVT+VDWS GG HPA++   +ITE F++ ++
Sbjct  290  EFCRPHCYVDEHYFPTMLTIEAPQSLANRSVTWVDWSRGGAHPATFGRGDITEEFLRRVQ  349

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            S  T C YN   + +C+LFARKF PSALEPL  L+  V+G+
Sbjct  350  SKHT-CLYNNQNSTMCFLFARKFAPSALEPLLVLAPTVLGY  389



>ref|XP_012077329.1| PREDICTED: uncharacterized protein LOC105638179 [Jatropha curcas]
 gb|KDP34129.1| hypothetical protein JCGZ_07700 [Jatropha curcas]
Length=386

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + RQ+ SQ  EWG +++ DAERRLLANALLD SNE F+LLSESCIP+Y+F  +Y Y+  S
Sbjct  167  HGRQVPSQISEWGKMNMCDAERRLLANALLDISNEWFILLSESCIPLYNFTVIYHYIMRS  226

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+NR LA+ IV +TK+Y  F+
Sbjct  227  KYSFVGAFDDPGPYGRGRYNENMAPEVNISQWRKGSQWFEVNRRLAVTIVEDTKYYPKFE  286

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+P+CY DEHY PT L +   ++ ANRS+T+VDWS GG HPA++  A+ITE F +   
Sbjct  287  EFCKPNCYVDEHYFPTMLNIQAAHLIANRSLTWVDWSRGGAHPATFGRADITEDFFRKF-  345

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G  C+YN   + IC+LF RKF PSALEPL  ++  V+GF
Sbjct  346  FEGQHCTYNNQPSSICFLFGRKFAPSALEPLLHIAPSVLGF  386



>ref|XP_009345696.1| PREDICTED: uncharacterized protein LOC103937474 [Pyrus x bretschneideri]
Length=411

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 166/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            + R+I SQ V WG+ S++DAERRLLANALLD SN+RFVLLSESCIP+++F T Y YL  S
Sbjct  190  HSRRIHSQPVYWGTSSMLDAERRLLANALLDISNQRFVLLSESCIPLFNFTTAYHYLINS  249

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE++R LA+ IVS+ K+Y +F+
Sbjct  250  NLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEVHRELAVHIVSDRKYYPIFQ  309

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC P CY DEHYIPT + L +  +N+NRSVT+VDWS GGPHP  +   +IT+ F+  IR
Sbjct  310  QYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGPHPGKFGWMDITDEFLNRIR  369

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G+ C+YN   T + +LFARKF P ALEPL +++  ++GF
Sbjct  370  F-GSECTYNGNTTSVFFLFARKFLPDALEPLLRVAPLLLGF  409



>ref|XP_006426464.1| hypothetical protein CICLE_v100272021mg, partial [Citrus clementina]
 gb|ESR39704.1| hypothetical protein CICLE_v100272021mg, partial [Citrus clementina]
Length=212

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 159/212 (75%), Gaps = 1/212 (0%)
 Frame = -1

Query  775  VEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYD  596
             EWG +S+ +AERRLLANALLD SNE F+LLSESC+P+++F  VY Y+++S +SF+ESYD
Sbjct  2    AEWGEMSMCEAERRLLANALLDVSNEWFILLSESCVPLHNFSIVYYYISKSRYSFMESYD  61

Query  595  DPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYP  416
            DP  YGRGRYN  M+P++ L +WRKGSQWFE+NR LA+ I+ +T +Y  F+ +C+P CY 
Sbjct  62   DPGPYGRGRYNGNMEPEVTLSQWRKGSQWFEINRRLAVDIIEDTSYYPKFRDFCKPGCYV  121

Query  415  DEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYN  236
            DEHY PT L +H   + ANR++T+ DWS GG HPA+Y  A+I+E F + I ++ + C YN
Sbjct  122  DEHYFPTMLTIHFSRLLANRTLTWTDWSRGGAHPATYGGADISEEFFRKITAS-SQCYYN  180

Query  235  RGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            +  T  CYLFARKF PSAL PL +LSL   GF
Sbjct  181  KQVTSFCYLFARKFAPSALGPLLELSLSAFGF  212



>ref|XP_011072929.1| PREDICTED: uncharacterized protein LOC105158025 [Sesamum indicum]
Length=425

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI S+ V WG  ++V+AERRLLANALLDF+N+RF+LLSE+CIP+++F T+Y YLT S
Sbjct  205  YRRQIPSKEVAWGEFNMVEAERRLLANALLDFANQRFILLSEACIPLFNFNTIYNYLTRS  264

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
            T SFIESYD     GRGRYN  M+P + L +WRKG+QWFE+NR LA+ +VS+ K+Y +FK
Sbjct  265  TTSFIESYDQWGPVGRGRYNKNMEPHVTLDQWRKGAQWFEVNRELAVEVVSDQKYYNLFK  324

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            +YC+P CY DEHY+PT++ +   +MN NR++T+VDWS GGPHP  +  +++T   ++ +R
Sbjct  325  EYCKPECYSDEHYLPTFVTMKFPWMNGNRTLTWVDWSKGGPHPTQFLRSDVTVDRLKRMR  384

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
            + GT+C YN   T IC+LFARKF  + L+ L +L+ ++M F
Sbjct  385  T-GTTCLYNGKPTNICFLFARKFTANGLDRLLRLAPQIMHF  424



>ref|XP_006357367.1| PREDICTED: uncharacterized protein LOC102582902 [Solanum tuberosum]
Length=380

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 162/221 (73%), Gaps = 0/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y RQI SQ  EWG +S+ DAERRLLANALLD SNE F++LSESCIP+++F  +Y+Y++ES
Sbjct  160  YGRQIPSQVAEWGDISITDAERRLLANALLDISNEWFIILSESCIPLHNFSVIYRYISES  219

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             +SF+  +DDP   GRGRYN +M P +K+ +WRKGSQWFE+NR LA+ IV++  +Y  FK
Sbjct  220  RYSFVSVFDDPRSVGRGRYNWKMSPVVKITQWRKGSQWFEVNRKLAVDIVTDEVYYPKFK  279

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+PSCY DEHY PT L +   ++  N S+T+VDW  GG HPA++  A++T+ F++ + 
Sbjct  280  QFCKPSCYVDEHYFPTMLHIQSPHLLTNTSLTWVDWHRGGAHPATFGKADVTDKFLKQLS  339

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
                +C YN   T  C LFARKF PSAL+PL KLS K +GF
Sbjct  340  EGQRTCVYNNQTTSYCLLFARKFSPSALDPLLKLSSKYLGF  380



>ref|XP_010536211.1| PREDICTED: uncharacterized protein LOC104811254 [Tarenaya hassleriana]
Length=387

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            Y+RQI SQ  EWG +++ DAERRLLANALLD SNE FVLLSE+CIP+++F T+Y+Y+++S
Sbjct  168  YRRQIPSQVAEWGRMTMCDAERRLLANALLDISNEWFVLLSETCIPLFNFTTIYRYISKS  227

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
              SFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+NR LA  IV +T +Y  F+
Sbjct  228  KQSFIGAFDDHGPYGRGRYNDNMAPEVGITQWRKGSQWFEINRELAATIVKDTVYYPKFR  287

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
             +CRP+CY DEHY PT L +    + ANRSVT+VDWS GG HPA++  A+I E F + I 
Sbjct  288  DFCRPACYVDEHYFPTMLTIEKPSLLANRSVTWVDWSRGGAHPATFGRADIKEEFFRRI-  346

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              G +C+YN   T +CY+FARKF PS+LEPL  ++ K++GF
Sbjct  347  YGGHNCTYNGRNTSMCYVFARKFAPSSLEPLLHIAPKILGF  387



>ref|XP_009625225.1| PREDICTED: uncharacterized protein LOC104116132 [Nicotiana tomentosiformis]
Length=382

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -1

Query  802  YKRQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTES  623
            ++RQI SQ  EWG +S+ DAERRLLANALLD SNE FVLLSESCIP+++F  VY+Y++ES
Sbjct  163  HRRQIPSQVAEWGKMSVCDAERRLLANALLDISNEWFVLLSESCIPLHNFSVVYRYISES  222

Query  622  THSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFK  443
             HSFI  +DD    GRGRYN  M P++ + EWRKGSQWFE+NR LAI IV +  +Y  F+
Sbjct  223  RHSFISVFDDHGPVGRGRYNKNMSPEVIITEWRKGSQWFEVNRKLAIDIVKDHVYYPKFE  282

Query  442  KYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIR  263
            ++C+PSCY DEHY PT L +   ++ ANRS+T VDWS GG HPA++  A+IT+ F++ I 
Sbjct  283  QFCKPSCYVDEHYFPTMLHIQSPHLLANRSLTLVDWSRGGAHPATFGKADITDQFLKKIV  342

Query  262  SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
              GT C YN   T +C LFARKF PS LEPL + S K +GF
Sbjct  343  EGGT-CVYNNQTTSLCSLFARKFSPSTLEPLLERSSKYLGF  382



>ref|XP_010264609.1| PREDICTED: uncharacterized protein LOC104602574 [Nelumbo nucifera]
Length=404

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 168/219 (77%), Gaps = 1/219 (0%)
 Frame = -1

Query  796  RQIKSQNVEWGSVSLVDAERRLLANALLDFSNERFVLLSESCIPVYDFPTVYKYLTESTH  617
            R+I S+ V+WG  +++ AERRLLANALLDFSN+RF+LLSE+CIP+++F TVY YL  S  
Sbjct  185  RRIPSKEVQWGKFNMIQAERRLLANALLDFSNQRFILLSEACIPLFNFSTVYNYLIGSNM  244

Query  616  SFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEMNRALAIIIVSETKFYAMFKKY  437
            +F+E+YD+P   GRGRYN RMKP I L +WRKG+QWFEM+R LAI IVS+ K++++F KY
Sbjct  245  TFVEAYDEPGPVGRGRYNHRMKPLITLDQWRKGAQWFEMDRDLAIEIVSDVKYFSVFGKY  304

Query  436  CRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGPHPASYTAANITEGFIQSIRSN  257
            C+ SCY DEHYIPT++ ++    N+NR++T+VDWS GGPHP  +   ++T   ++ +R+ 
Sbjct  305  CKGSCYSDEHYIPTFVSVNFWEKNSNRTLTWVDWSRGGPHPTRFIRTDVTIELLEMMRT-  363

Query  256  GTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  140
             T+C YN   T ICYLFARKF+P++L+ L + + KVM F
Sbjct  364  ATTCKYNGNTTNICYLFARKFYPNSLDRLLRFAPKVMMF  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480