BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5526

Length=855
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772211.1|  PREDICTED: probable serine/threonine-protein...    232   7e-67   Nicotiana sylvestris
ref|XP_009607019.1|  PREDICTED: probable serine/threonine-protein...    229   1e-65   Nicotiana tomentosiformis
ref|XP_006359171.1|  PREDICTED: probable serine/threonine-protein...    217   2e-61   Solanum tuberosum [potatoes]
ref|XP_004229357.1|  PREDICTED: probable serine/threonine-protein...    215   1e-60   Solanum lycopersicum
emb|CDP07693.1|  unnamed protein product                                203   9e-59   Coffea canephora [robusta coffee]
ref|XP_011087152.1|  PREDICTED: probable serine/threonine-protein...    207   5e-58   Sesamum indicum [beniseed]
ref|XP_011087160.1|  PREDICTED: AP2-associated protein kinase 1 i...    207   6e-58   Sesamum indicum [beniseed]
ref|XP_011087144.1|  PREDICTED: AP2-associated protein kinase 1 i...    207   8e-58   Sesamum indicum [beniseed]
ref|XP_011087141.1|  PREDICTED: AP2-associated protein kinase 1 i...    205   6e-57   Sesamum indicum [beniseed]
ref|XP_006482821.1|  PREDICTED: probable serine/threonine-protein...    201   1e-55   Citrus sinensis [apfelsine]
ref|XP_006439043.1|  hypothetical protein CICLE_v10030862mg             201   1e-55   Citrus clementina [clementine]
ref|XP_006482823.1|  PREDICTED: probable serine/threonine-protein...    201   2e-55   Citrus sinensis [apfelsine]
ref|XP_006439041.1|  hypothetical protein CICLE_v10030862mg             201   2e-55   Citrus clementina [clementine]
gb|KDO46087.1|  hypothetical protein CISIN_1g005558mg                   194   8e-55   Citrus sinensis [apfelsine]
ref|XP_004306499.1|  PREDICTED: AP2-associated protein kinase 1 i...    199   1e-54   Fragaria vesca subsp. vesca
ref|XP_011468799.1|  PREDICTED: AP2-associated protein kinase 1 i...    196   7e-54   Fragaria vesca subsp. vesca
ref|XP_006482824.1|  PREDICTED: probable serine/threonine-protein...    195   2e-53   Citrus sinensis [apfelsine]
gb|KDO46085.1|  hypothetical protein CISIN_1g005558mg                   195   2e-53   Citrus sinensis [apfelsine]
ref|XP_010095876.1|  putative serine/threonine-protein kinase           194   2e-53   
gb|KDO46086.1|  hypothetical protein CISIN_1g005558mg                   195   3e-53   Citrus sinensis [apfelsine]
ref|XP_006439040.1|  hypothetical protein CICLE_v10030862mg             195   3e-53   
ref|XP_008231320.1|  PREDICTED: AP2-associated protein kinase 1 i...    191   7e-52   Prunus mume [ume]
ref|XP_008231319.1|  PREDICTED: AP2-associated protein kinase 1 i...    191   7e-52   Prunus mume [ume]
emb|CBI32192.3|  unnamed protein product                                185   7e-52   Vitis vinifera
ref|XP_008231321.1|  PREDICTED: AP2-associated protein kinase 1 i...    187   2e-50   Prunus mume [ume]
ref|XP_010265879.1|  PREDICTED: probable serine/threonine-protein...    186   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010265881.1|  PREDICTED: probable serine/threonine-protein...    186   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010027724.1|  PREDICTED: AP2-associated protein kinase 1 i...    186   4e-50   
ref|XP_010027725.1|  PREDICTED: AP2-associated protein kinase 1 i...    185   7e-50   Eucalyptus grandis [rose gum]
ref|XP_010659601.1|  PREDICTED: probable serine/threonine-protein...    185   9e-50   Vitis vinifera
ref|XP_010659600.1|  PREDICTED: probable serine/threonine-protein...    185   9e-50   Vitis vinifera
ref|XP_010659599.1|  PREDICTED: probable serine/threonine-protein...    185   1e-49   Vitis vinifera
ref|XP_009339572.1|  PREDICTED: AP2-associated protein kinase 1         178   2e-47   Pyrus x bretschneideri [bai li]
gb|ABK92707.1|  unknown                                                 168   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007052604.1|  Serine/threonine-protein kinase DDB_G0280111...    173   1e-45   
ref|XP_007052606.1|  Serine/threonine-protein kinase DDB_G0280111...    173   1e-45   
gb|EYU27100.1|  hypothetical protein MIMGU_mgv1a022935mg                172   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_007220628.1|  hypothetical protein PRUPE_ppa002321mg             172   4e-45   
ref|XP_007052605.1|  Serine/threonine-protein kinase DDB_G0280111...    171   8e-45   
ref|XP_004149621.1|  PREDICTED: probable serine/threonine-protein...    170   1e-44   Cucumis sativus [cucumbers]
ref|XP_008392404.1|  PREDICTED: AP2-associated protein kinase 1         169   5e-44   Malus domestica [apple tree]
ref|XP_006369447.1|  hypothetical protein POPTR_0001s23520g             168   7e-44   
ref|XP_010522378.1|  PREDICTED: probable serine/threonine-protein...    166   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_008461768.1|  PREDICTED: probable serine/threonine-protein...    164   2e-42   Cucumis melo [Oriental melon]
ref|XP_010522383.1|  PREDICTED: probable serine/threonine-protein...    164   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_010670934.1|  PREDICTED: actin-regulating kinase PRK1-like       160   3e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007149359.1|  hypothetical protein PHAVU_005G063700g             159   7e-41   Phaseolus vulgaris [French bean]
ref|XP_007149360.1|  hypothetical protein PHAVU_005G063700g             159   8e-41   Phaseolus vulgaris [French bean]
ref|XP_002314227.1|  hypothetical protein POPTR_0009s02770g             147   6e-39   
gb|KHG06229.1|  putative serine/threonine-protein kinase                153   1e-38   Gossypium arboreum [tree cotton]
ref|XP_008805476.1|  PREDICTED: AP2-associated protein kinase 1-like    153   1e-38   Phoenix dactylifera
gb|KJB22767.1|  hypothetical protein B456_004G065000                    152   3e-38   Gossypium raimondii
gb|KJB22768.1|  hypothetical protein B456_004G065000                    152   3e-38   Gossypium raimondii
ref|XP_002512151.1|  serine/threonine protein kinase, putative          150   7e-38   Ricinus communis
ref|XP_006410418.1|  hypothetical protein EUTSA_v10016354mg             151   9e-38   Eutrema salsugineum [saltwater cress]
ref|XP_012092619.1|  PREDICTED: serine/threonine-protein kinase 10      150   1e-37   Jatropha curcas
gb|KJB22766.1|  hypothetical protein B456_004G065000                    150   1e-37   Gossypium raimondii
ref|XP_006293803.1|  hypothetical protein CARUB_v10022785mg             148   6e-37   Capsella rubella
ref|XP_010257449.1|  PREDICTED: serine/threonine-protein kinase p...    146   8e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010257450.1|  PREDICTED: serine/threonine-protein kinase p...    145   8e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010257448.1|  PREDICTED: serine/threonine-protein kinase p...    145   8e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010913910.1|  PREDICTED: probable serine/threonine-protein...    144   3e-35   Elaeis guineensis
ref|XP_010678702.1|  PREDICTED: probable serine/threonine-protein...    143   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003531422.1|  PREDICTED: probable serine/threonine-protein...    142   7e-35   Glycine max [soybeans]
ref|XP_010509956.1|  PREDICTED: probable serine/threonine-protein...    142   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_003546865.1|  PREDICTED: probable serine/threonine-protein...    142   1e-34   Glycine max [soybeans]
ref|XP_010413940.1|  PREDICTED: probable serine/threonine-protein...    140   7e-34   Camelina sativa [gold-of-pleasure]
emb|CDX79504.1|  BnaC03g18400D                                          139   8e-34   
ref|XP_010469538.1|  PREDICTED: probable serine/threonine-protein...    139   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002881248.1|  hypothetical protein ARALYDRAFT_482227             138   4e-33   
ref|XP_004513162.1|  PREDICTED: probable serine/threonine-protein...    138   5e-33   
ref|XP_009132906.1|  PREDICTED: probable serine/threonine-protein...    136   1e-32   Brassica rapa
emb|CDX84704.1|  BnaA03g15260D                                          136   1e-32   
gb|AFK34914.1|  unknown                                                 126   6e-31   Medicago truncatula
ref|NP_001047290.1|  Os02g0591900                                       129   8e-31   
dbj|BAD34080.1|  cyclin G-associated kinase-like protein                128   9e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_850199.1|  protein kinase superfamily protein                    128   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647439.1|  PREDICTED: probable serine/threonine-protein...    127   3e-29   Oryza brachyantha
ref|XP_008808088.1|  PREDICTED: AP2-associated protein kinase 1-like    126   6e-29   Phoenix dactylifera
gb|KEH33173.1|  Serine/Threonine kinase family protein                  125   1e-28   Medicago truncatula
ref|XP_010542987.1|  PREDICTED: AP2-associated protein kinase 1-l...    124   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_010542991.1|  PREDICTED: AP2-associated protein kinase 1-l...    124   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_003575255.1|  PREDICTED: probable serine/threonine-protein...    124   4e-28   Brachypodium distachyon [annual false brome]
ref|XP_008677437.1|  PREDICTED: uncharacterized protein LOC100304...    124   4e-28   
ref|XP_009394517.1|  PREDICTED: AP2-associated protein kinase 1 {...    124   5e-28   
ref|XP_006850020.1|  PREDICTED: probable serine/threonine-protein...    123   8e-28   Amborella trichopoda
ref|NP_565756.1|  protein kinase superfamily protein                    122   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAL60023.1|  putative serine/threonine protein kinase                122   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395097.1|  PREDICTED: AP2-associated protein kinase 1 {...    121   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943528.1|  PREDICTED: AP2-associated protein kinase 1-like    120   8e-27   Elaeis guineensis
ref|XP_004956476.1|  PREDICTED: probable serine/threonine-protein...    119   1e-26   Setaria italica
gb|EMT28285.1|  Putative serine/threonine-protein kinase                117   9e-26   
gb|EMT09791.1|  Putative serine/threonine-protein kinase                115   4e-25   
tpg|DAA39365.1|  TPA: putative protein kinase superfamily protein       114   9e-25   
ref|XP_008671591.1|  PREDICTED: probable serine/threonine-protein...    114   1e-24   
ref|XP_004952949.1|  PREDICTED: AP2-associated protein kinase 1-l...    112   2e-24   Setaria italica
ref|XP_004952948.1|  PREDICTED: AP2-associated protein kinase 1-l...    112   3e-24   Setaria italica
gb|AFW81246.1|  hypothetical protein ZEAMMB73_183204                    107   1e-22   
gb|EAZ08411.1|  hypothetical protein OsI_30675                          108   1e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAD26025.1|  putative AAK1 protein                                  108   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010237997.1|  PREDICTED: AP2-associated protein kinase 1-like    106   6e-22   Brachypodium distachyon [annual false brome]
ref|XP_006660487.1|  PREDICTED: AP2-associated protein kinase 1-like    104   2e-21   Oryza brachyantha
ref|NP_001159134.1|  uncharacterized protein LOC100304212             98.2    3e-21   
ref|XP_009143925.1|  PREDICTED: probable serine/threonine-protein...    101   2e-20   Brassica rapa
dbj|BAJ97005.1|  predicted protein                                      101   2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010469539.1|  PREDICTED: probable serine/threonine-protein...  99.4    9e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009408443.1|  PREDICTED: AP2-associated protein kinase 1 {...  98.6    2e-19   
emb|CDY12158.1|  BnaC04g11880D                                        96.7    6e-19   Brassica napus [oilseed rape]
ref|XP_010469540.1|  PREDICTED: probable serine/threonine-protein...  82.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010235619.1|  PREDICTED: probable serine/threonine-protein...  79.3    3e-13   Brachypodium distachyon [annual false brome]
ref|XP_001769351.1|  predicted protein                                72.8    5e-11   
emb|CBI24810.3|  unnamed protein product                              72.0    1e-10   Vitis vinifera
emb|CAN81086.1|  hypothetical protein VITISV_027167                   70.9    3e-10   Vitis vinifera
emb|CAN62110.1|  hypothetical protein VITISV_038734                   70.1    5e-10   Vitis vinifera
ref|XP_002972735.1|  hypothetical protein SELMODRAFT_98319            64.7    2e-08   
emb|CAN65496.1|  hypothetical protein VITISV_028322                   55.5    3e-05   Vitis vinifera



>ref|XP_009772211.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
 ref|XP_009772212.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
Length=699

 Score =   232 bits (592),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 155/199 (78%), Gaps = 3/199 (2%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            K++LLEAEVEKLKEQL+  NMEKAEITSKFEKLSAICRSQRQEIQELKQALA  TPSPNR
Sbjct  503  KKELLEAEVEKLKEQLSRANMEKAEITSKFEKLSAICRSQRQEIQELKQALAVSTPSPNR  562

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            DT R+Q+SP SQ  S PP +++ IEGTVWEL+QGL   S  SPD   WQAFADD PK   
Sbjct  563  DTSRDQASPGSQPSSVPPPRKDNIEGTVWELEQGLFGGSQVSPDSKPWQAFADDDPKQQP  622

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
            T   +N PRS+RT+N    N Q S  +  GFGTDSF AVP+++SQ+ A+F++  N QRFG
Sbjct  623  TSVNAN-PRSVRTKNGH-QNRQTSETNTSGFGTDSFRAVPASSSQIKATFNESKNYQRFG  680

Query  313  D-KRVDNKSASQPAGWAGF  260
            + K V++KSASQPAGWAGF
Sbjct  681  EPKNVNSKSASQPAGWAGF  699



>ref|XP_009607019.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
 ref|XP_009607020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
Length=700

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 154/199 (77%), Gaps = 3/199 (2%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            K++LLEAEVEKLKEQL+ +NMEKAEITSKFEKLS ICRSQRQEIQELKQALA  TPS NR
Sbjct  504  KKELLEAEVEKLKEQLSRSNMEKAEITSKFEKLSGICRSQRQEIQELKQALAVSTPSLNR  563

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            DT R+Q+SP SQ  S PP ++  IEGTVWEL+QGL   S  SPD   WQAFADD PK   
Sbjct  564  DTARDQASPGSQPSSIPPPRKVNIEGTVWELEQGLFGGSQVSPDSKPWQAFADDDPKQQP  623

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
            T   +N PRS+RT+N    N Q S  +  GFGTDSF AVP+++SQ+ A+F++  NSQRFG
Sbjct  624  TSVNAN-PRSVRTKNGH-QNRQTSETNTSGFGTDSFRAVPASSSQIKATFNESKNSQRFG  681

Query  313  D-KRVDNKSASQPAGWAGF  260
            + K V++KSASQPAGWAGF
Sbjct  682  EPKNVNSKSASQPAGWAGF  700



>ref|XP_006359171.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Solanum tuberosum]
Length=694

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 159/200 (80%), Gaps = 10/200 (5%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            K++L+EAEVEKLK+QL+  NMEKAEITSK+EKLSAICRSQRQE+QELKQALAA+TPSPNR
Sbjct  503  KKELMEAEVEKLKQQLSRANMEKAEITSKYEKLSAICRSQRQELQELKQALAARTPSPNR  562

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  R+ +SP SQ     P +++ IEGTVWELQQGL  QS  S D  +WQAFADD PK   
Sbjct  563  DNTRDHASPGSQI----PPKKDNIEGTVWELQQGLFGQSQVSSDSKSWQAFADD-PKQQA  617

Query  493  TPPPSNTPRSMRTRN-NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRF  317
            TP  S TPRS+RT+N +Q  +T ++  SA  FGTDSF AVP+++SQ+ A+F++  NSQRF
Sbjct  618  TPVNS-TPRSVRTKNGHQNRDTSETNTSA--FGTDSFRAVPASSSQIKANFNESKNSQRF  674

Query  316  GD-KRVDNKSASQPAGWAGF  260
            G+ K +D+KSASQPAGWAGF
Sbjct  675  GEPKNIDSKSASQPAGWAGF  694



>ref|XP_004229357.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Solanum lycopersicum]
Length=698

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 157/200 (79%), Gaps = 6/200 (3%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            K++L+EAEVEKLK+QL+  NMEKAEITSK+EKLSAICRSQRQE+QELKQALAA+TPSP+ 
Sbjct  503  KKELMEAEVEKLKQQLSRANMEKAEITSKYEKLSAICRSQRQELQELKQALAARTPSPHV  562

Query  673  DTLR-NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPL  497
            DT R + +SP SQ  STPP +++ IEGTVWELQQGL  QS  S D  +WQAFADD PK  
Sbjct  563  DTTRDHHASPGSQPSSTPP-KKDNIEGTVWELQQGLFGQSQVSSDSKSWQAFADD-PKQQ  620

Query  496  TTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRF  317
             TP  S TPRS+RT+N    N + S  +   FGTDSF AVP+ +SQ+ A+F++  NSQRF
Sbjct  621  ATPVNS-TPRSVRTKNGH-QNRETSETNTSAFGTDSFRAVPAFSSQIKATFNESKNSQRF  678

Query  316  GD-KRVDNKSASQPAGWAGF  260
            G+ K +D+KSASQPAGWAGF
Sbjct  679  GEPKNIDSKSASQPAGWAGF  698



>emb|CDP07693.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 153/206 (74%), Gaps = 18/206 (9%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+LL+AE+EKLKEQ+T  N+EKAEITSK+EKLSAICRSQRQEI ELKQALAA+TPSP R
Sbjct  189  KEELLQAEIEKLKEQVTQINVEKAEITSKYEKLSAICRSQRQEIHELKQALAARTPSPKR  248

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            ++ + Q+S  S   + P   +E +EGTVWELQQGLL+QSS+SPDP AWQAFADD      
Sbjct  249  ESFKTQASFASHPSTAP---KEKVEGTVWELQQGLLDQSSTSPDPRAWQAFADD------  299

Query  493  TPPP----SNTPRSMRTRNNQPPNT---QDSTASAWGFGTDSFTAVPSATSQMNASFSDR  335
             PPP    ++  RS+RTRN +  N     +S A+ WGFGTD+F A P+A+S +NA   + 
Sbjct  300  -PPPQTSVNSNSRSVRTRNGRQNNHVSEVNSGANTWGFGTDNFKAAPAASSHINAHTVEA  358

Query  334  NNSQRFGDKR-VDNKSASQPAGWAGF  260
             NSQRF +++ +++   SQPAGWAGF
Sbjct  359  TNSQRFSERKDIESSQTSQPAGWAGF  384



>ref|XP_011087152.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X3 [Sesamum indicum]
Length=669

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 149/202 (74%), Gaps = 9/202 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE++LEAEVEKLKEQL H + EKAEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R
Sbjct  473  KEEMLEAEVEKLKEQLAHVSAEKAEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSR  532

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            +  RN +S  SQT ST PQQ+E IEGTVWELQQG  ++ S SPD   WQAF DD PKP T
Sbjct  533  EPSRNLASSGSQTSST-PQQKEKIEGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQT  590

Query  493  TPPPSNTPRSMRTRNNQPPNTQ---DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
              P +N  RS +TRN Q  N      S AS WGFGTDSF    SAT ++N    + NNSQ
Sbjct  591  M-PTNNASRSAQTRNGQQSNQAAELSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQ  647

Query  322  RFGD-KRVDNKSASQPAGWAGF  260
            RFG+ K  ++K  SQPAGWAGF
Sbjct  648  RFGESKSTESKLESQPAGWAGF  669



>ref|XP_011087160.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
 ref|XP_011087168.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
Length=626

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 149/202 (74%), Gaps = 9/202 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE++LEAEVEKLKEQL H + EKAEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R
Sbjct  430  KEEMLEAEVEKLKEQLAHVSAEKAEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSR  489

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            +  RN +S  SQT ST PQQ+E IEGTVWELQQG  ++ S SPD   WQAF DD PKP T
Sbjct  490  EPSRNLASSGSQTSST-PQQKEKIEGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQT  547

Query  493  TPPPSNTPRSMRTRNNQPPNTQ---DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
              P +N  RS +TRN Q  N      S AS WGFGTDSF    SAT ++N    + NNSQ
Sbjct  548  M-PTNNASRSAQTRNGQQSNQAAELSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQ  604

Query  322  RFGD-KRVDNKSASQPAGWAGF  260
            RFG+ K  ++K  SQPAGWAGF
Sbjct  605  RFGESKSTESKLESQPAGWAGF  626



>ref|XP_011087144.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Sesamum 
indicum]
Length=690

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 149/202 (74%), Gaps = 9/202 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE++LEAEVEKLKEQL H + EKAEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R
Sbjct  494  KEEMLEAEVEKLKEQLAHVSAEKAEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSR  553

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            +  RN +S  SQT ST PQQ+E IEGTVWELQQG  ++ S SPD   WQAF DD PKP T
Sbjct  554  EPSRNLASSGSQTSST-PQQKEKIEGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQT  611

Query  493  TPPPSNTPRSMRTRNNQPPNTQ---DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
              P +N  RS +TRN Q  N      S AS WGFGTDSF    SAT ++N    + NNSQ
Sbjct  612  M-PTNNASRSAQTRNGQQSNQAAELSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQ  668

Query  322  RFGD-KRVDNKSASQPAGWAGF  260
            RFG+ K  ++K  SQPAGWAGF
Sbjct  669  RFGESKSTESKLESQPAGWAGF  690



>ref|XP_011087141.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Sesamum 
indicum]
Length=695

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 148/202 (73%), Gaps = 10/202 (5%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE++LEAEVEKLKEQL H + EKAEITSK+EKL+AICRSQRQEIQ+LKQALAA+TPSP+R
Sbjct  500  KEEMLEAEVEKLKEQLAHVSAEKAEITSKYEKLTAICRSQRQEIQDLKQALAARTPSPSR  559

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            +  RN +S  SQT STP  Q+E IEGTVWELQQG  ++ S SPD   WQAF DD PKP T
Sbjct  560  EPSRNLASSGSQTSSTP--QKEKIEGTVWELQQGFFDRGSPSPDTQQWQAFTDD-PKPQT  616

Query  493  TPPPSNTPRSMRTRNNQPPNTQ---DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
              P +N  RS +TRN Q  N      S AS WGFGTDSF    SAT ++N    + NNSQ
Sbjct  617  M-PTNNASRSAQTRNGQQSNQAAELSSGASTWGFGTDSFKV--SATPKINLPVGEFNNSQ  673

Query  322  RFGD-KRVDNKSASQPAGWAGF  260
            RFG+ K  ++K  SQPAGWAGF
Sbjct  674  RFGESKSTESKLESQPAGWAGF  695



>ref|XP_006482821.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482822.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X2 [Citrus sinensis]
Length=693

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 146/202 (72%), Gaps = 12/202 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  500  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  559

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP QRE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  560  DAAINQTSPGNESFATPPLQREKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  612

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  613  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  671

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  672  SIGRSKTTENQPSAQPAGWAGF  693



>ref|XP_006439043.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52283.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=693

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 146/202 (72%), Gaps = 12/202 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  500  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  559

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP QRE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  560  DAAINQTSPGNESFATPPLQREKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  612

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  613  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  671

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  672  SIGRSKTTENQPSAQPAGWAGF  693



>ref|XP_006482823.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X3 [Citrus sinensis]
Length=692

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 146/202 (72%), Gaps = 12/202 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  499  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  558

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP QRE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  559  DAAINQTSPGNESFATPPLQREKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  611

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  612  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  670

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  671  SIGRSKTTENQPSAQPAGWAGF  692



>ref|XP_006439041.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439042.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52281.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52282.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=692

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 146/202 (72%), Gaps = 12/202 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  499  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  558

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP QRE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  559  DAAINQTSPGNESFATPPLQREKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  611

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  612  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  670

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  671  SIGRSKTTENQPSAQPAGWAGF  692



>gb|KDO46087.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=422

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  231  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  290

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP  RE IEGT+WE         + SP+  +WQAFA+D PKP  
Sbjct  291  DAAINQTSPGNESFATPP--REKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PKPQQ  344

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  345  ----QNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  400

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  401  SIGRSKTTENQPSAQPAGWAGF  422



>ref|XP_004306499.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468798.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=682

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 148/203 (73%), Gaps = 10/203 (5%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LE EVE+LKEQL   N+EKAEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+
Sbjct  485  KEEALETEVERLKEQLNQANLEKAEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNK  544

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D +RNQ SP  Q+ +TPP QRE IEG ++ELQQ   ++ + SP+  +WQ FA+    PL 
Sbjct  545  DAMRNQMSPGIQSSATPP-QREKIEGPIYELQQDKSDRKTPSPETKSWQPFAE----PLQ  599

Query  493  TPPPSNTPRSMRTRN---NQPPNTQ-DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNS  326
                 N+ +S+RTRN   N+   TQ +S   +WGFGT+SF+A P+ ++Q+     + N S
Sbjct  600  PSSTDNSVKSVRTRNGHQNKQATTQVNSGFDSWGFGTESFSAAPTGSTQIPRPMGEGNIS  659

Query  325  QRFGD-KRVDNKSASQPAGWAGF  260
            QRFGD K +++K ASQPAGWAGF
Sbjct  660  QRFGDTKAMESKPASQPAGWAGF  682



>ref|XP_011468799.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=681

 Score =   196 bits (499),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 147/203 (72%), Gaps = 11/203 (5%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LE EVE+LKEQL   N+EKAEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+
Sbjct  485  KEEALETEVERLKEQLNQANLEKAEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNK  544

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D +RNQ SP  Q+ +TPP  RE IEG ++ELQQ   ++ + SP+  +WQ FA+    PL 
Sbjct  545  DAMRNQMSPGIQSSATPP--REKIEGPIYELQQDKSDRKTPSPETKSWQPFAE----PLQ  598

Query  493  TPPPSNTPRSMRTRN---NQPPNTQ-DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNS  326
                 N+ +S+RTRN   N+   TQ +S   +WGFGT+SF+A P+ ++Q+     + N S
Sbjct  599  PSSTDNSVKSVRTRNGHQNKQATTQVNSGFDSWGFGTESFSAAPTGSTQIPRPMGEGNIS  658

Query  325  QRFGD-KRVDNKSASQPAGWAGF  260
            QRFGD K +++K ASQPAGWAGF
Sbjct  659  QRFGDTKAMESKPASQPAGWAGF  681



>ref|XP_006482824.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X4 [Citrus sinensis]
Length=691

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  500  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  559

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP  RE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  560  DAAINQTSPGNESFATPP--REKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  610

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  611  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  669

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  670  SIGRSKTTENQPSAQPAGWAGF  691



>gb|KDO46085.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=690

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  499  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  558

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP  RE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  559  DAAINQTSPGNESFATPP--REKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  609

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  610  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  668

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  669  SIGRSKTTENQPSAQPAGWAGF  690



>ref|XP_010095876.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC42162.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=652

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 148/203 (73%), Gaps = 8/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E  LEAE+EKLK QL   N+EKAEITSKFEKLS ICRSQRQEIQELKQA+AA TPSPN+
Sbjct  453  REQALEAELEKLKGQLKEANLEKAEITSKFEKLSTICRSQRQEIQELKQAVAATTPSPNK  512

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            DT RNQ+SP  +  S  P Q++ IEGTV ELQQ   ++++ SP P  WQAF ++      
Sbjct  513  DTSRNQTSPGVRP-SAAPLQKDNIEGTVRELQQEKDSRNTMSPKPRMWQAFPEEPKPQ-Q  570

Query  493  TPPPSNTPRSMRTRNNQPPNTQ----DSTASAWGFGTDSFTAVPSATSQMNASFSDRNNS  326
             PP SNT +S+RTRN  P N Q    +S   +WGFGT+SFTA+P+ +SQM+ S ++ NNS
Sbjct  571  PPPSSNTVKSVRTRNG-PQNKQATQVNSGFDSWGFGTESFTAIPTGSSQMSRSLAEGNNS  629

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            Q  G+ ++ ++K ASQPAGWAGF
Sbjct  630  QHTGEAKIMESKPASQPAGWAGF  652



>gb|KDO46086.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=691

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  500  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  559

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP  RE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  560  DAAINQTSPGNESFATPP--REKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  610

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  611  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  669

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  670  SIGRSKTTENQPSAQPAGWAGF  691



>ref|XP_006439040.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439044.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52280.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52284.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=690

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 14/202 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ EVE+LK QL  TN+EKAEITSKFEKLSAICRSQRQEIQELKQALAA+ PSPN+
Sbjct  499  KEEALQNEVERLKGQLKQTNLEKAEITSKFEKLSAICRSQRQEIQELKQALAARLPSPNK  558

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D   NQ+SP +++F+TPP  RE IEGT+WE         + SP+  +WQAFA+D PK   
Sbjct  559  DAAINQTSPGNESFATPP--REKIEGTIWE---LKSEWGTPSPESKSWQAFAED-PK---  609

Query  493  TPPPSNTPRSMRTRNNQP-PNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
             P   NT +S+RTRN     +T  ST+   +WGFGT+SFTA+P+A SQ +   ++ N+SQ
Sbjct  610  -PQQQNTAQSVRTRNGHLNKHTAQSTSGFDSWGFGTESFTAIPAANSQRSKPITEGNSSQ  668

Query  322  RFG-DKRVDNKSASQPAGWAGF  260
              G  K  +N+ ++QPAGWAGF
Sbjct  669  SIGRSKTTENQPSAQPAGWAGF  690



>ref|XP_008231320.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Prunus 
mume]
Length=698

 Score =   191 bits (485),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 145/202 (72%), Gaps = 8/202 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEVE+LKEQL   N+EK EITSKFEKLSAICRSQRQE+QELKQ LAA+T SPN+
Sbjct  501  KEEALEAEVERLKEQLKQANLEKGEITSKFEKLSAICRSQRQELQELKQTLAARTLSPNK  560

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  RNQ+SP +   S  P QRE IEG+ WE  QG  ++S+ SP+P+ WQ F ++ PK   
Sbjct  561  DASRNQTSPGNLP-SANPLQREKIEGSFWE--QGKSDRSTPSPEPNPWQPFVEE-PKSQQ  616

Query  493  TPPPSNTPRSMRTRNNQ--PPNTQDSTA-SAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 NT +S+RTRN       TQ +T   +WGFG +SFTAVP+ ++Q++    + NNSQ
Sbjct  617  PSSTDNTMKSVRTRNGHQNKQTTQVNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQ  676

Query  322  RFGDKRV-DNKSASQPAGWAGF  260
            RFG+ +V ++K ASQPAGWAGF
Sbjct  677  RFGEAKVMESKPASQPAGWAGF  698



>ref|XP_008231319.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Prunus 
mume]
Length=699

 Score =   191 bits (485),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 145/202 (72%), Gaps = 8/202 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEVE+LKEQL   N+EK EITSKFEKLSAICRSQRQE+QELKQ LAA+T SPN+
Sbjct  502  KEEALEAEVERLKEQLKQANLEKGEITSKFEKLSAICRSQRQELQELKQTLAARTLSPNK  561

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  RNQ+SP +   S  P QRE IEG+ WE  QG  ++S+ SP+P+ WQ F ++ PK   
Sbjct  562  DASRNQTSPGNLP-SANPLQREKIEGSFWE--QGKSDRSTPSPEPNPWQPFVEE-PKSQQ  617

Query  493  TPPPSNTPRSMRTRNNQ--PPNTQDSTA-SAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 NT +S+RTRN       TQ +T   +WGFG +SFTAVP+ ++Q++    + NNSQ
Sbjct  618  PSSTDNTMKSVRTRNGHQNKQTTQVNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQ  677

Query  322  RFGDKRV-DNKSASQPAGWAGF  260
            RFG+ +V ++K ASQPAGWAGF
Sbjct  678  RFGEAKVMESKPASQPAGWAGF  699



>emb|CBI32192.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 133/194 (69%), Gaps = 12/194 (6%)
 Frame = -3

Query  823  KLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPK  644
            +LKEQL   N+EK+EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S  
Sbjct  179  RLKEQLKQANLEKSEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTG  238

Query  643  SQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTP  470
             Q+ +TPP   E IEGTVWE         S +PD   WQAF D+    +PL+     NT 
Sbjct  239  LQSAATPPHG-EKIEGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTS  292

Query  469  RSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRV  302
            +S+RTRN   N+P     S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+
Sbjct  293  KSVRTRNGHHNKPATEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRI  352

Query  301  DNKSASQPAGWAGF  260
            ++K A+QPAGWAGF
Sbjct  353  ESKPATQPAGWAGF  366



>ref|XP_008231321.1| PREDICTED: AP2-associated protein kinase 1 isoform X3 [Prunus 
mume]
Length=697

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 144/202 (71%), Gaps = 9/202 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEVE+LKEQL   N+EK EITSKFEKLSAICRSQRQE+QELKQ LAA+T SPN+
Sbjct  501  KEEALEAEVERLKEQLKQANLEKGEITSKFEKLSAICRSQRQELQELKQTLAARTLSPNK  560

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  RNQ+SP +   + P   RE IEG+ WE  QG  ++S+ SP+P+ WQ F ++ PK   
Sbjct  561  DASRNQTSPGNLPSANP--LREKIEGSFWE--QGKSDRSTPSPEPNPWQPFVEE-PKSQQ  615

Query  493  TPPPSNTPRSMRTRNNQ--PPNTQDSTA-SAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 NT +S+RTRN       TQ +T   +WGFG +SFTAVP+ ++Q++    + NNSQ
Sbjct  616  PSSTDNTMKSVRTRNGHQNKQTTQVNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQ  675

Query  322  RFGDKRV-DNKSASQPAGWAGF  260
            RFG+ +V ++K ASQPAGWAGF
Sbjct  676  RFGEAKVMESKPASQPAGWAGF  697



>ref|XP_010265879.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
 ref|XP_010265880.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
Length=701

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 144/206 (70%), Gaps = 19/206 (9%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEV++LK+QL   N EKAEITSK+EKLSAICRSQR EIQELKQALAA+TPSPN+
Sbjct  507  KEEALEAEVDRLKDQLKQANTEKAEITSKYEKLSAICRSQRLEIQELKQALAARTPSPNK  566

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  +  S   SQ  +TP  QRE IEGTVWELQQGL   SS SPD   W AF+DD     T
Sbjct  567  DYSKTTSG--SQQSTTP--QREKIEGTVWELQQGLFANSSPSPDSKPWNAFSDD-----T  617

Query  493  TPPPS---NTPRSMRTRNN----QPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR  335
             P PS   NTPRS+RT N     Q P+ +      WGFG+D+FTAVPS+T Q+  + S  
Sbjct  618  KPQPSLKNNTPRSVRTTNGRQKKQAPD-ESHGLETWGFGSDNFTAVPSST-QVTQTSSQV  675

Query  334  NNSQRFGDKR-VDNKSASQPAGWAGF  260
            ++ +R GD R V+ K ASQPAGWAGF
Sbjct  676  HSFERIGDSRSVERKKASQPAGWAGF  701



>ref|XP_010265881.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X2 [Nelumbo nucifera]
Length=700

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 144/206 (70%), Gaps = 19/206 (9%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEV++LK+QL   N EKAEITSK+EKLSAICRSQR EIQELKQALAA+TPSPN+
Sbjct  506  KEEALEAEVDRLKDQLKQANTEKAEITSKYEKLSAICRSQRLEIQELKQALAARTPSPNK  565

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  +  S   SQ  +TP  QRE IEGTVWELQQGL   SS SPD   W AF+DD     T
Sbjct  566  DYSKTTSG--SQQSTTP--QREKIEGTVWELQQGLFANSSPSPDSKPWNAFSDD-----T  616

Query  493  TPPPS---NTPRSMRTRNN----QPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR  335
             P PS   NTPRS+RT N     Q P+ +      WGFG+D+FTAVPS+T Q+  + S  
Sbjct  617  KPQPSLKNNTPRSVRTTNGRQKKQAPD-ESHGLETWGFGSDNFTAVPSST-QVTQTSSQV  674

Query  334  NNSQRFGDKR-VDNKSASQPAGWAGF  260
            ++ +R GD R V+ K ASQPAGWAGF
Sbjct  675  HSFERIGDSRSVERKKASQPAGWAGF  700



>ref|XP_010027724.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Eucalyptus 
grandis]
Length=703

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 141/208 (68%), Gaps = 12/208 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ E+E+LKEQL   N+EK E+TSK+EKLSAICRSQRQEIQELKQ+LAA+ PSP+R
Sbjct  498  KEEDLDVELERLKEQLKQANLEKTEMTSKYEKLSAICRSQRQEIQELKQSLAARAPSPSR  557

Query  673  DTLRNQ------SSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADD  512
            D +RNQ      SS  + TF       ET   T W+  Q  + ++  SP+P++WQAFADD
Sbjct  558  DAMRNQTPTRIESSAAAMTFRLIQPSEET-RKTNWDTHQEKVEKNFQSPEPTSWQAFADD  616

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPNTQDSTAS---AWGFGTDSFTAVPSATSQMNASFS  341
             PKP        T RS+RTRN Q        AS    WGFG++SFTA+P+A+SQ++    
Sbjct  617  -PKPRQPLSRDTTSRSVRTRNGQQSKQGTQAASKNETWGFGSESFTAMPNASSQISKPIR  675

Query  340  DRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            + + SQRFGD +  +NKS+SQPAGWAGF
Sbjct  676  EGSTSQRFGDSKFRENKSSSQPAGWAGF  703



>ref|XP_010027725.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54314.1| hypothetical protein EUGRSUZ_I00278 [Eucalyptus grandis]
Length=697

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L+ E+E+LKEQL   N+EK E+TSK+EKLSAICRSQRQEIQELKQ+LAA+ PSP+R
Sbjct  498  KEEDLDVELERLKEQLKQANLEKTEMTSKYEKLSAICRSQRQEIQELKQSLAARAPSPSR  557

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D +RNQ+  + ++ S      E    T W+  Q  + ++  SP+P++WQAFADD PKP  
Sbjct  558  DAMRNQTPTRIES-SAAAMPSEETRKTNWDTHQEKVEKNFQSPEPTSWQAFADD-PKPRQ  615

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTAS---AWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                  T RS+RTRN Q        AS    WGFG++SFTA+P+A+SQ++    + + SQ
Sbjct  616  PLSRDTTSRSVRTRNGQQSKQGTQAASKNETWGFGSESFTAMPNASSQISKPIREGSTSQ  675

Query  322  RFGDKRV-DNKSASQPAGWAGF  260
            RFGD +  +NKS+SQPAGWAGF
Sbjct  676  RFGDSKFRENKSSSQPAGWAGF  697



>ref|XP_010659601.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Vitis vinifera]
Length=698

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 133/194 (69%), Gaps = 12/194 (6%)
 Frame = -3

Query  823  KLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPK  644
            +LKEQL   N+EK+EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S  
Sbjct  511  RLKEQLKQANLEKSEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTG  570

Query  643  SQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTP  470
             Q+ +TPP   E IEGTVWE         S +PD   WQAF D+    +PL+     NT 
Sbjct  571  LQSAATPPHG-EKIEGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTS  624

Query  469  RSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRV  302
            +S+RTRN   N+P     S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+
Sbjct  625  KSVRTRNGHHNKPATEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRI  684

Query  301  DNKSASQPAGWAGF  260
            ++K A+QPAGWAGF
Sbjct  685  ESKPATQPAGWAGF  698



>ref|XP_010659600.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Vitis vinifera]
Length=710

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 133/194 (69%), Gaps = 12/194 (6%)
 Frame = -3

Query  823  KLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPK  644
            +LKEQL   N+EK+EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S  
Sbjct  523  RLKEQLKQANLEKSEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTG  582

Query  643  SQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTP  470
             Q+ +TPP   E IEGTVWE         S +PD   WQAF D+    +PL+     NT 
Sbjct  583  LQSAATPPHG-EKIEGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTS  636

Query  469  RSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRV  302
            +S+RTRN   N+P     S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+
Sbjct  637  KSVRTRNGHHNKPATEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRI  696

Query  301  DNKSASQPAGWAGF  260
            ++K A+QPAGWAGF
Sbjct  697  ESKPATQPAGWAGF  710



>ref|XP_010659599.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Vitis vinifera]
Length=711

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 133/194 (69%), Gaps = 12/194 (6%)
 Frame = -3

Query  823  KLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPK  644
            +LKEQL   N+EK+EITSKFEKLSAICRSQRQEIQELKQALAA+TPSPNRD  +NQ+S  
Sbjct  524  RLKEQLKQANLEKSEITSKFEKLSAICRSQRQEIQELKQALAARTPSPNRDASKNQTSTG  583

Query  643  SQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPLTTPPPSNTP  470
             Q+ +TPP   E IEGTVWE         S +PD   WQAF D+    +PL+     NT 
Sbjct  584  LQSAATPPHG-EKIEGTVWE--LQQGKSDSPAPDSKPWQAFPDELKQHQPLSR---DNTS  637

Query  469  RSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRV  302
            +S+RTRN   N+P     S    WGFGT+SFTA P+A+S  +      NN+Q FGD KR+
Sbjct  638  KSVRTRNGHHNKPATEATSGPETWGFGTESFTATPAASSSFSRPTVGGNNAQLFGDSKRI  697

Query  301  DNKSASQPAGWAGF  260
            ++K A+QPAGWAGF
Sbjct  698  ESKPATQPAGWAGF  711



>ref|XP_009339572.1| PREDICTED: AP2-associated protein kinase 1 [Pyrus x bretschneideri]
Length=688

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 139/203 (68%), Gaps = 18/203 (9%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LEAEVE+LKEQL   N+EKAEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D  R
Sbjct  495  LEAEVERLKEQLKQVNLEKAEITSKFEKLSAICRSQRQELQELKQMLAARTPSPNKDASR  554

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            NQ+SP  Q     P  RE IEG +W+       +S+ SP+   WQ FA++ PKP   P P
Sbjct  555  NQTSPGKQPSPNLP-HREKIEGNIWK---LQQGKSTPSPESKPWQPFAEE-PKP---PQP  606

Query  481  SNTP---RSMRTRNNQPPNTQDSTASA----WGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
            S+T    +S RTRN    N Q +  +A    WGFG DSF+A  + ++Q++   S+ NNSQ
Sbjct  607  SSTANAFKSARTRNGH-QNKQGTQVNAGFDSWGFGADSFSAASTESAQISRPMSEGNNSQ  665

Query  322  RFGD-KRVDN-KSASQPAGWAGF  260
            R G+ K ++N K ASQPAGWAGF
Sbjct  666  RLGEAKGMENSKPASQPAGWAGF  688



>gb|ABK92707.1| unknown [Populus trichocarpa]
Length=226

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 135/201 (67%), Gaps = 24/201 (12%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAE+E+LKEQL   N EKAEITSKFEKLSAICRSQRQEIQELKQ LAA+TPSPN 
Sbjct  47   KEEALEAEIERLKEQLKQVNSEKAEITSKFEKLSAICRSQRQEIQELKQTLAARTPSPN-  105

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
               + Q+S + Q  ++PPQ++     + W         S+ SP+  +WQAFADD      
Sbjct  106  ---KYQASSRIQPSASPPQEK-----SDW---------STPSPESKSWQAFADDNKSRQK  148

Query  493  TPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 N+P+S+RTRN   N+      S   +WGFG++SFTAVP+A+SQ++ S ++ ++  
Sbjct  149  PVSKGNSPQSVRTRNAHQNKQAAELTSNIDSWGFGSESFTAVPAASSQISGSNTEAHSG-  207

Query  322  RFGDKRVDNKSASQPAGWAGF  260
              G K +++K A+QPAGWAGF
Sbjct  208  --GSKIMESKPATQPAGWAGF  226



>ref|XP_007052604.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
 gb|EOX96761.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
Length=688

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 134/203 (66%), Gaps = 8/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAE+E+LKEQL  +N+EK E+TSKFEKLSAICRSQRQEIQELKQALAA+TPSPN+
Sbjct  489  KEEALEAEIERLKEQLQQSNLEKVEMTSKFEKLSAICRSQRQEIQELKQALAARTPSPNK  548

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T   Q+ P S    +   QRE +EG +WE  Q    + +++SP+   WQAF++D     
Sbjct  549  STSIKQNLPGSHHAGSV--QREKVEGKLWEFPQEKSAEWTTASPEAKPWQAFSEDAKLQQ  606

Query  496  TTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNS  326
             +    N  RS+RTRN   N+      S    W FGTDSFTA P+A+ Q     S+ ++S
Sbjct  607  QSLSKDNV-RSVRTRNGHSNKHVAEATSGLDTWSFGTDSFTAAPAASPQRLKPMSEGSSS  665

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            QRFG+  + +N   SQPAGWAGF
Sbjct  666  QRFGESMIKENHPTSQPAGWAGF  688



>ref|XP_007052606.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
 gb|EOX96763.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
Length=679

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 134/203 (66%), Gaps = 8/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAE+E+LKEQL  +N+EK E+TSKFEKLSAICRSQRQEIQELKQALAA+TPSPN+
Sbjct  480  KEEALEAEIERLKEQLQQSNLEKVEMTSKFEKLSAICRSQRQEIQELKQALAARTPSPNK  539

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T   Q+ P S    +   QRE +EG +WE  Q    + +++SP+   WQAF++D     
Sbjct  540  STSIKQNLPGSHHAGSV--QREKVEGKLWEFPQEKSAEWTTASPEAKPWQAFSEDAKLQQ  597

Query  496  TTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNS  326
             +    N  RS+RTRN   N+      S    W FGTDSFTA P+A+ Q     S+ ++S
Sbjct  598  QSLSKDNV-RSVRTRNGHSNKHVAEATSGLDTWSFGTDSFTAAPAASPQRLKPMSEGSSS  656

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            QRFG+  + +N   SQPAGWAGF
Sbjct  657  QRFGESMIKENHPTSQPAGWAGF  679



>gb|EYU27100.1| hypothetical protein MIMGU_mgv1a022935mg [Erythranthe guttata]
Length=634

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 136/200 (68%), Gaps = 22/200 (11%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE++LEAEVEKLKEQL   + EK EITSK+EKLSAICRSQRQEIQELKQ+LAA+TPSP+R
Sbjct  455  KEEVLEAEVEKLKEQLALISAEKTEITSKYEKLSAICRSQRQEIQELKQSLAARTPSPSR  514

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D+ RN  SP            E IEGTVWELQQGL ++SS S D   WQAF+DD      
Sbjct  515  DSSRNLVSPN-----------EKIEGTVWELQQGLFDRSSKSSDSQQWQAFSDD------  557

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVP-SATSQMNASFSDRNNSQRF  317
               PS+ P+S+RTRN  P N Q    ++WGF T+SF  VP +A+S ++      N SQRF
Sbjct  558  --KPSSAPKSVRTRNT-PQNNQKVETNSWGFETESFKVVPNAASSNVSVPVGGLNVSQRF  614

Query  316  GDKRVD-NKSASQPAGWAGF  260
             +++ +  K  + PAGWAGF
Sbjct  615  VEQKSNKGKLDAPPAGWAGF  634



>ref|XP_007220628.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
 gb|EMJ21827.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
Length=687

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 134/202 (66%), Gaps = 19/202 (9%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEVE+LKEQL   N+EK EITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+
Sbjct  501  KEEALEAEVERLKEQLKQANLEKGEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNK  560

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D  RNQ+SP     +   Q +               ++S+ SP+P+ WQ F ++ PK   
Sbjct  561  DASRNQTSPGILPSANLLQGK--------------SDRSTPSPEPNPWQPFVEE-PKSQQ  605

Query  493  TPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 NT +S+RTRN   N+     ++   +WGFG +SFTAVP+ ++Q++    + NNSQ
Sbjct  606  PSSTDNTMKSVRTRNGHQNKQSTKVNTGFDSWGFGAESFTAVPTGSTQISRPMGEGNNSQ  665

Query  322  RFGDKRV-DNKSASQPAGWAGF  260
             FG+ +V ++K ASQPAGWAGF
Sbjct  666  HFGEAKVMESKPASQPAGWAGF  687



>ref|XP_007052605.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
 gb|EOX96762.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
Length=678

 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 133/203 (66%), Gaps = 9/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAE+E+LKEQL  +N+EK E+TSKFEKLSAICRSQRQEIQELKQALAA+TPSPN+
Sbjct  480  KEEALEAEIERLKEQLQQSNLEKVEMTSKFEKLSAICRSQRQEIQELKQALAARTPSPNK  539

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T   Q+ P S    +    RE +EG +WE  Q    + +++SP+   WQAF++D     
Sbjct  540  STSIKQNLPGSHHAGSV---REKVEGKLWEFPQEKSAEWTTASPEAKPWQAFSEDAKLQQ  596

Query  496  TTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNS  326
             +    N  RS+RTRN   N+      S    W FGTDSFTA P+A+ Q     S+ ++S
Sbjct  597  QSLSKDNV-RSVRTRNGHSNKHVAEATSGLDTWSFGTDSFTAAPAASPQRLKPMSEGSSS  655

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            QRFG+  + +N   SQPAGWAGF
Sbjct  656  QRFGESMIKENHPTSQPAGWAGF  678



>ref|XP_004149621.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis sativus]
 ref|XP_011651798.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis sativus]
 gb|KGN58620.1| hypothetical protein Csa_3G702580 [Cucumis sativus]
Length=676

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 134/206 (65%), Gaps = 28/206 (14%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEVEKLKEQL H N+EK+EITSKFEKLSAICRSQRQEIQELKQALAA++PSPN+
Sbjct  491  KEVALEAEVEKLKEQLKHANVEKSEITSKFEKLSAICRSQRQEIQELKQALAARSPSPNK  550

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGP--KP  500
              ++NQ+S ++Q  + P  Q+  +              ++ SPD  AWQAFA++ P  +P
Sbjct  551  LEMKNQNSREAQPSAVPRLQKADV--------------TTPSPDAKAWQAFAEESPNQQP  596

Query  499  LTTPPPSNTPRSMRTRNNQ-----PPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR  335
            +T   P    +SMRTR+ Q     P NT      +WGFG +SFTAV + +S  +    +R
Sbjct  597  VT---PEKGVKSMRTRSVQRKQASPENT---GFESWGFGAESFTAVSAGSSNKSGLTGER  650

Query  334  NNSQRFGDKR-VDNKSASQPAGWAGF  260
            N+SQR G      N  +SQPAGWAGF
Sbjct  651  NSSQRTGGGEPKSNDISSQPAGWAGF  676



>ref|XP_008392404.1| PREDICTED: AP2-associated protein kinase 1 [Malus domestica]
Length=681

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 138/203 (68%), Gaps = 24/203 (12%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LEAEVE+LKEQL   N+EKAEITSKFEKLSAICRSQRQE+QELKQ LAA+TPSPN+D  R
Sbjct  494  LEAEVERLKEQLKQANLEKAEITSKFEKLSAICRSQRQELQELKQTLAARTPSPNKDASR  553

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            NQ+SP  Q   +PP  RE I    W+       +S+ SP+   WQ FA++ PKP   P P
Sbjct  554  NQTSPGKQP--SPP-HRENI----WK---LQQGKSTPSPESKPWQPFAEE-PKP---PQP  599

Query  481  SNTP---RSMRTRNNQPPNTQDSTASA----WGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
            S+T    +S RTRN    N Q +  +A    WGFG DSF+A  + ++Q++   S+ NNSQ
Sbjct  600  SSTANAFKSARTRNGH-QNKQGTQVNAGFDSWGFGADSFSAASTGSTQISRPMSEGNNSQ  658

Query  322  RFGD-KRVDN-KSASQPAGWAGF  260
            R G+ K ++N K ASQPAGWAGF
Sbjct  659  RLGEAKGMENSKPASQPAGWAGF  681



>ref|XP_006369447.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
 gb|ERP66016.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
Length=666

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (67%), Gaps = 24/201 (12%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAE+E+LKEQL   N EKAEITSKFEKLSAICRSQRQEIQELKQ LAA+TPSPN 
Sbjct  487  KEEALEAEIERLKEQLKQVNSEKAEITSKFEKLSAICRSQRQEIQELKQTLAARTPSPN-  545

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
               + Q+S + Q  ++PPQ++       W         S+ SP+  +WQAFADD      
Sbjct  546  ---KYQASSRIQPSASPPQEKSD-----W---------STPSPESKSWQAFADDNKSRQK  588

Query  493  TPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 N+P+S+RTRN   N+      S   +WGFG++SFTAVP+A+SQ++ S ++ ++  
Sbjct  589  PVSKGNSPQSVRTRNAHQNKQAAELTSNIDSWGFGSESFTAVPAASSQISGSNTEAHSG-  647

Query  322  RFGDKRVDNKSASQPAGWAGF  260
              G K +++K A+QPAGWAGF
Sbjct  648  --GSKIMESKPATQPAGWAGF  666



>ref|XP_010522378.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522379.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522380.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522382.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
Length=649

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 137/214 (64%), Gaps = 23/214 (11%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KED L AE+E+LK+QL   N EKAEIT+KFEKLSAICRSQRQE+QELKQ LA+KT S + 
Sbjct  443  KEDALGAEIERLKQQLEQANSEKAEITAKFEKLSAICRSQRQELQELKQTLASKTASSS-  501

Query  673  DTLRNQSSPKSQTFS----TPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGP  506
                ++ SP+++T S    T P QRE IEGT+WELQQ   + ++   D   WQAF+DD P
Sbjct  502  ----SRESPQTRTSSGARATSP-QREKIEGTMWELQQDRSDWATGKSDLKPWQAFSDD-P  555

Query  505  KP-LTTPPPSN---TPRSMRTRNNQPPNTQDSTA-------SAWGFGTDSFTAVPSATSQ  359
            KP L T    N   T +S  TRN+QP      TA        +WGF TDSF A P++ S 
Sbjct  556  KPNLQTASKGNNTSTNQSFGTRNSQPSKQTTLTAVPTSQGFDSWGFETDSFRATPTSASA  615

Query  358  MNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
                    N SQRFG+ RV DN+ A+QPAGW+GF
Sbjct  616  TQRPLGSGNTSQRFGNSRVRDNQQAAQPAGWSGF  649



>ref|XP_008461768.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis melo]
Length=665

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 130/201 (65%), Gaps = 18/201 (9%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEVEKLKEQL   N+EK+EITSKFEKLSAICRSQRQEIQELKQALAA++PSPN+
Sbjct  480  KEVALEAEVEKLKEQLKQANVEKSEITSKFEKLSAICRSQRQEIQELKQALAARSPSPNK  539

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
              ++N +S ++Q  + P  Q+  +              ++ SPD  AWQAFA++ P   +
Sbjct  540  LEMKNHNSREAQPSAMPRLQKADV--------------TTPSPDAKAWQAFAEESPNQQS  585

Query  493  TPPPSNTPRSMRTRNNQPPNT--QDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQR  320
              P     +SMRTR+ Q      +++   +WGFG +SF+AV + +S  +    +RN+SQR
Sbjct  586  VTPEKGV-KSMRTRSLQKKQASPENTGFESWGFGAESFSAVSAGSSNKSGLTGERNSSQR  644

Query  319  FGDKR-VDNKSASQPAGWAGF  260
             G      N+ +SQPAGWAGF
Sbjct  645  TGGGEPKSNEVSSQPAGWAGF  665



>ref|XP_010522383.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 136/214 (64%), Gaps = 24/214 (11%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KED L AE+E+LK+QL   N EKAEIT+KFEKLSAICRSQRQE+QELKQ LA+KT S + 
Sbjct  443  KEDALGAEIERLKQQLEQANSEKAEITAKFEKLSAICRSQRQELQELKQTLASKTASSS-  501

Query  673  DTLRNQSSPKSQTFS----TPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGP  506
                ++ SP+++T S    T P  RE IEGT+WELQQ   + ++   D   WQAF+DD P
Sbjct  502  ----SRESPQTRTSSGARATSP--REKIEGTMWELQQDRSDWATGKSDLKPWQAFSDD-P  554

Query  505  KP-LTTPPPSN---TPRSMRTRNNQPPNTQDSTA-------SAWGFGTDSFTAVPSATSQ  359
            KP L T    N   T +S  TRN+QP      TA        +WGF TDSF A P++ S 
Sbjct  555  KPNLQTASKGNNTSTNQSFGTRNSQPSKQTTLTAVPTSQGFDSWGFETDSFRATPTSASA  614

Query  358  MNASFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
                    N SQRFG+ RV DN+ A+QPAGW+GF
Sbjct  615  TQRPLGSGNTSQRFGNSRVRDNQQAAQPAGWSGF  648



>ref|XP_010670934.1| PREDICTED: actin-regulating kinase PRK1-like [Beta vulgaris subsp. 
vulgaris]
Length=656

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 134/196 (68%), Gaps = 6/196 (3%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LEA + +L+EQL   N E AE+TSK++KL+AICRSQR E++ELKQALAA++ SP R+  R
Sbjct  465  LEAGIGRLREQLKQANAEIAEMTSKYDKLTAICRSQRHELKELKQALAARSSSPKREAAR  524

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            NQSS + Q  ++   QR  IEGTVWELQ+GL +++S++P+P  WQAFA+D   P +   P
Sbjct  525  NQSSSRYQATNS---QRVKIEGTVWELQEGLFDKNSTNPEPKTWQAFANDTSTPTSIGHP  581

Query  481  SNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD--K  308
            S + ++    +++   +  ST + WGFG D+F AV +A+S++    +  + S RFGD  K
Sbjct  582  SKSVKNRSGHSSKQDASVGSTKNGWGFGNDNFAAVSAASSRIIRPGAG-STSLRFGDSNK  640

Query  307  RVDNKSASQPAGWAGF  260
                 +ASQPAGWAGF
Sbjct  641  LASKNTASQPAGWAGF  656



>ref|XP_007149359.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21353.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=673

 Score =   159 bits (403),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 131/202 (65%), Gaps = 22/202 (11%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E  L+AEVEKLKEQL   N+EKAEITSKF+KLSAICRSQRQE+Q+LKQALAA+TPSP+R
Sbjct  490  REQALQAEVEKLKEQLKEANVEKAEITSKFDKLSAICRSQRQELQDLKQALAARTPSPSR  549

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            + L+  +SP + T S P Q R     T W+             +P +WQAF ++ P+   
Sbjct  550  EGLK--TSP-AVTSSQPMQDR-----TEWKTPSS---------EPKSWQAFPEE-PQQQK  591

Query  493  TPPPSNTPRSMRT---RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
            +    NT +S RT   R N+ P    +T  +WGFGTDSF+AVPS +SQM    S    SQ
Sbjct  592  SLSAENTTKSARTNNGRQNKQPVPLATTFDSWGFGTDSFSAVPSGSSQMQRPSSAGGKSQ  651

Query  322  RFGD-KRVDNKSASQPAGWAGF  260
             FG+ K  ++K  SQPAGWAGF
Sbjct  652  GFGEAKAFESKPTSQPAGWAGF  673



>ref|XP_007149360.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21354.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=674

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 132/202 (65%), Gaps = 21/202 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E  L+AEVEKLKEQL   N+EKAEITSKF+KLSAICRSQRQE+Q+LKQALAA+TPSP+R
Sbjct  490  REQALQAEVEKLKEQLKEANVEKAEITSKFDKLSAICRSQRQELQDLKQALAARTPSPSR  549

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            + L+  +SP + T S P QQ    + T W+             +P +WQAF ++ P+   
Sbjct  550  EGLK--TSP-AVTSSQPMQQ----DRTEWKTPSS---------EPKSWQAFPEE-PQQQK  592

Query  493  TPPPSNTPRSMRT---RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
            +    NT +S RT   R N+ P    +T  +WGFGTDSF+AVPS +SQM    S    SQ
Sbjct  593  SLSAENTTKSARTNNGRQNKQPVPLATTFDSWGFGTDSFSAVPSGSSQMQRPSSAGGKSQ  652

Query  322  RFGD-KRVDNKSASQPAGWAGF  260
             FG+ K  ++K  SQPAGWAGF
Sbjct  653  GFGEAKAFESKPTSQPAGWAGF  674



>ref|XP_002314227.1| hypothetical protein POPTR_0009s02770g [Populus trichocarpa]
 gb|EEE88182.1| hypothetical protein POPTR_0009s02770g [Populus trichocarpa]
Length=210

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 119/201 (59%), Gaps = 36/201 (18%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAE+EKLKEQL   N EKAEITSKFEKLSAICRSQRQEIQELKQ LA++TPSPN+
Sbjct  43   KEEALEAEIEKLKEQLKQVNSEKAEITSKFEKLSAICRSQRQEIQELKQTLASRTPSPNK  102

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
                              QQ ++   T+             S +  +WQAFADD      
Sbjct  103  -----------------YQQEKSDWSTL-------------SLETKSWQAFADDKKSQKQ  132

Query  493  TPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
                 N+P+S+RTRN   N+      S   +WGFG+++FTAVP+ +SQ+  S ++ +   
Sbjct  133  HLSKGNSPQSVRTRNAHQNKQAAELTSDFDSWGFGSENFTAVPATSSQIPVSNTEVSVG-  191

Query  322  RFGDKRVDNKSASQPAGWAGF  260
              G K   +K A+QPAGWAGF
Sbjct  192  --GYKITVSKPATQPAGWAGF  210



>gb|KHG06229.1| putative serine/threonine-protein kinase [Gossypium arboreum]
Length=653

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 128/204 (63%), Gaps = 16/204 (8%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAE+ +LKEQL  +N+EKAE+TSKFEKLSAICRSQRQEIQELKQ LAA+TPSPN+
Sbjct  460  KEKALEAEIVRLKEQLKQSNLEKAEMTSKFEKLSAICRSQRQEIQELKQTLAARTPSPNK  519

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T R  +SP S          E +EGT  E  Q       ++SP+   WQAF +D     
Sbjct  520  STSRYHNSPGSLG--------EKVEGTFSEFAQEKAGNWKTASPEAKPWQAFPEDAKPQQ  571

Query  496  TTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFGTDSFTAVPSATSQ-MNASFSDRN  332
              P   +  +S+RTRN    N   + A+     WGFG D+FTA P+A+SQ + ++ ++ +
Sbjct  572  QQPLSKDNVQSVRTRNGH-SNMHAAQATFGMETWGFGADNFTAAPTASSQRLKSTINEGS  630

Query  331  NSQRFGDKRVDNKSASQPAGWAGF  260
            +SQR   K  ++   SQPAGWAGF
Sbjct  631  SSQR-ESKIKESNPVSQPAGWAGF  653



>ref|XP_008805476.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008805477.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=702

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 133/205 (65%), Gaps = 17/205 (8%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSP-NRDTL  665
            LEAE+ +LKE+L   NMEK EITSK+EKLSAICRSQRQEIQELK+ALAA T SP  +D  
Sbjct  504  LEAELCRLKEELKQANMEKEEITSKYEKLSAICRSQRQEIQELKRALAAATSSPAGKDGS  563

Query  664  RNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsss--SPDPSAWQAFADDGPKPLTT  491
            + Q+SP S    TPP  RE I G+VWELQQG+   S +  SPDP  WQAFA++ PK   T
Sbjct  564  KAQTSPGSTQSDTPP--REKI-GSVWELQQGMFADSPATPSPDPKPWQAFAEE-PKVQGT  619

Query  490  PPPSNTPRSMRT----RNNQPPNTQDSTASA---WGFGTDSFTAVPSATSQMNASFSDRN  332
             P S  PRS+RT      ++    Q +T SA   WGF  DSF AVPS +     S    N
Sbjct  620  -PKSIHPRSVRTVRAANGSRDTTKQAATYSANEPWGFDNDSFRAVPSGSEVPRTSVQG-N  677

Query  331  NSQRFGDKRVDNKS-ASQPAGWAGF  260
             SQRFG  R   K+ A+QPAGWAGF
Sbjct  678  TSQRFGGGREMKKAEANQPAGWAGF  702



>gb|KJB22767.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
 gb|KJB22769.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=661

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 122/203 (60%), Gaps = 14/203 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAE+ +LKEQL  +N+EKAE+T KFEKLSAICRSQRQEIQELKQ LAA+TPSPN+
Sbjct  468  KEKALEAEIVRLKEQLKQSNLEKAEMTMKFEKLSAICRSQRQEIQELKQTLAARTPSPNK  527

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T R  +SP S          E +EGT  E  Q       ++SP+   WQAF +D     
Sbjct  528  STSRYHNSPGSLG--------EKVEGTFSEFTQEKAGNWKTASPEAKPWQAFPEDAKPQQ  579

Query  496  TTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFGTDSFTAVPSATSQMNASFSDRNN  329
              P   +  +S+RTRN    N   + A+     WGFG D+FTA P+A+SQ   S  +  +
Sbjct  580  QQPLSKDNVQSVRTRNGH-SNMHAAQATFGMETWGFGADNFTAAPTASSQRLKSMINEGS  638

Query  328  SQRFGDKRVDNKSASQPAGWAGF  260
            S +   K  ++   SQPAGWAGF
Sbjct  639  SSQRESKIKESNPVSQPAGWAGF  661



>gb|KJB22768.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=662

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 122/203 (60%), Gaps = 14/203 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAE+ +LKEQL  +N+EKAE+T KFEKLSAICRSQRQEIQELKQ LAA+TPSPN+
Sbjct  469  KEKALEAEIVRLKEQLKQSNLEKAEMTMKFEKLSAICRSQRQEIQELKQTLAARTPSPNK  528

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T R  +SP S          E +EGT  E  Q       ++SP+   WQAF +D     
Sbjct  529  STSRYHNSPGSLG--------EKVEGTFSEFTQEKAGNWKTASPEAKPWQAFPEDAKPQQ  580

Query  496  TTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFGTDSFTAVPSATSQMNASFSDRNN  329
              P   +  +S+RTRN    N   + A+     WGFG D+FTA P+A+SQ   S  +  +
Sbjct  581  QQPLSKDNVQSVRTRNGH-SNMHAAQATFGMETWGFGADNFTAAPTASSQRLKSMINEGS  639

Query  328  SQRFGDKRVDNKSASQPAGWAGF  260
            S +   K  ++   SQPAGWAGF
Sbjct  640  SSQRESKIKESNPVSQPAGWAGF  662



>ref|XP_002512151.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50185.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=622

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 27/190 (14%)
 Frame = -3

Query  817  KEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQ  638
            K+QL   NMEKAE+TSK+EKLSAICRSQRQEIQELKQ +AA+TPSPN    + Q+SPK+Q
Sbjct  456  KDQLKQANMEKAEMTSKYEKLSAICRSQRQEIQELKQVVAARTPSPN----KYQASPKTQ  511

Query  637  TFSTPPQQRETIEG-TVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPP-PSNTPRS  464
              +       T++G + W         S  SPD   W AFADD  KP   PP   N+P+S
Sbjct  512  PSTN------TLQGESDW---------SIPSPDQKPWHAFADDS-KPQQQPPSKGNSPQS  555

Query  463  MRTRN-NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRF-GDKRVDNKS  290
            +RTRN NQ    + + + +WGFG DSFTA P+A++Q +   ++ N+SQ F G K +++++
Sbjct  556  VRTRNANQ---RKQAESESWGFGADSFTAAPAASTQTSRPINEGNSSQHFSGTKIMESQA  612

Query  289  ASQPAGWAGF  260
            A+QPAGWAGF
Sbjct  613  ATQPAGWAGF  622



>ref|XP_006410418.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
 gb|ESQ51871.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
Length=674

 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 145/213 (68%), Gaps = 17/213 (8%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAK--TPSP  680
            KE+ LEAE+E+LKE+L  TN EKAEIT+KFEKLSAICRSQRQE+Q+LK  LA+K  T SP
Sbjct  464  KEEALEAEIERLKEELKKTNSEKAEITAKFEKLSAICRSQRQELQDLKHTLASKTVTSSP  523

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD  +NQSSP   + S+ P  R+ +EGT+WELQQ   N S+ S DP++WQ F+D+ PKP
Sbjct  524  SRDFSQNQSSPGMCSISSTP-SRDKVEGTMWELQQDRSNWSTGSSDPNSWQPFSDE-PKP  581

Query  499  L---TTPPPSNT-PRSMRTRNNQPPNTQDSTASA---WGFGTDSFTAVPSATSQMNA---  350
            +    +   +NT  +S+RT++    +     +     WGF T+SF A  ++++  +A   
Sbjct  582  VLESVSKGNNNTFNQSVRTKSKPASSAPAPASQGTEPWGFETESFRAAATSSASASASST  641

Query  349  --SFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
              S S  N +QRFG+ ++ DN+ A+QPAGWAGF
Sbjct  642  QRSVSSGNTAQRFGNSKMRDNQKAAQPAGWAGF  674



>ref|XP_012092619.1| PREDICTED: serine/threonine-protein kinase 10 [Jatropha curcas]
 gb|KDP20398.1| hypothetical protein JCGZ_05281 [Jatropha curcas]
Length=669

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 129/205 (63%), Gaps = 26/205 (13%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ L  E+E+LK+QL   N+EKAE+T K+EKLSAICRSQRQEIQELKQA+AA TP PN 
Sbjct  484  KEEELNVEIERLKDQLKQANLEKAEMTLKYEKLSAICRSQRQEIQELKQAVAAGTP-PN-  541

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
               + Q+SPK Q  +T  QQ E+   T              SP+  AWQAFA D     +
Sbjct  542  ---KYQTSPKIQPLTT-TQQGESDWST-------------PSPETKAWQAFAVDPKTHQS  584

Query  493  TPPPSNTPRSMRTRN-NQPPNTQDSTA--SAWGFGTDSFTAVPSATSQ----MNASFSDR  335
            +   SN+P S+RTRN NQ      +++   +WGFG DSF+AVP A++Q    +N   S R
Sbjct  585  SLSKSNSPLSVRTRNANQKKLAAQASSEFESWGFGADSFSAVPGASTQTSRLINEGNSSR  644

Query  334  NNSQRFGDKRVDNKSASQPAGWAGF  260
            ++ Q  G K V+ + ASQPAGWAGF
Sbjct  645  SSQQLAGTKVVEGQPASQPAGWAGF  669



>gb|KJB22766.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=658

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 121/203 (60%), Gaps = 17/203 (8%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAE+ +LKEQL  +N+EKAE+T KFEKLSAICRSQRQEIQELKQ LAA+TPSPN+
Sbjct  468  KEKALEAEIVRLKEQLKQSNLEKAEMTMKFEKLSAICRSQRQEIQELKQTLAARTPSPNK  527

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPKPL  497
             T R  +SP S            +EGT  E  Q       ++SP+   WQAF +D     
Sbjct  528  STSRYHNSPGS-----------LVEGTFSEFTQEKAGNWKTASPEAKPWQAFPEDAKPQQ  576

Query  496  TTPPPSNTPRSMRTRNNQPPNTQDSTAS----AWGFGTDSFTAVPSATSQMNASFSDRNN  329
              P   +  +S+RTRN    N   + A+     WGFG D+FTA P+A+SQ   S  +  +
Sbjct  577  QQPLSKDNVQSVRTRNGH-SNMHAAQATFGMETWGFGADNFTAAPTASSQRLKSMINEGS  635

Query  328  SQRFGDKRVDNKSASQPAGWAGF  260
            S +   K  ++   SQPAGWAGF
Sbjct  636  SSQRESKIKESNPVSQPAGWAGF  658



>ref|XP_006293803.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
 gb|EOA26701.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
Length=672

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 141/211 (67%), Gaps = 16/211 (8%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ L AE+E+LK++L  TN+EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  465  KEEALVAEIERLKDELKQTNLEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  524

Query  679  NRDTLRNQSSPKSQTF-STPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPK  503
            +RD+ +NQ SP   +  STPP  RE +EGT+WELQ+   + S+ S DP++WQ F+ DG K
Sbjct  525  SRDSSQNQPSPGMHSISSTPP--REKMEGTMWELQKDRSDWSTGSSDPNSWQPFS-DGVK  581

Query  502  PL---TTPPPSNTP-RSMRTRNNQPPNTQDSTASAWGFGTDSFTAV---PSAT--SQMNA  350
            P+    +   SNT  +S+RTR+            AWGF T+SF A    P+AT  S    
Sbjct  582  PVLESASKGNSNTMNQSVRTRSKPASAAGTQGFDAWGFETESFRAATPSPAATSASATQR  641

Query  349  SFSDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            S    N++QR+G  ++ DN+  +QPAGWAGF
Sbjct  642  SMGSGNSAQRYGSSKMRDNQKTAQPAGWAGF  672



>ref|XP_010257449.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X2 [Nelumbo nucifera]
Length=708

 Score =   146 bits (368),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 129/199 (65%), Gaps = 12/199 (6%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
             EAEV++LKEQL   N EKAEI SK+EKLSAICRSQ+ EIQEL+QALAAKT  PN++  +
Sbjct  517  FEAEVDRLKEQLKQANTEKAEIKSKYEKLSAICRSQQHEIQELRQALAAKT-VPNKEASK  575

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            NQ+S  +   S PP QRE IEGTV ELQQG+L  SS  PD   W+AF D+  KP  TPP 
Sbjct  576  NQNSFGNCQSSNPP-QREKIEGTVRELQQGILASSSPIPDSKPWRAFFDE-TKP-QTPPK  632

Query  481  SNTPRSMRT----RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
            S++PRS+RT    +N Q P+ +    + W F  +SF   PS+T      +    N Q   
Sbjct  633  SSSPRSVRTTNGHQNKQAPSGRHGPET-WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVA  689

Query  313  D-KRVDNKSASQPAGWAGF  260
            D K V+ K AS PAGWAGF
Sbjct  690  DSKSVERKQASLPAGWAGF  708



>ref|XP_010257450.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X3 [Nelumbo nucifera]
Length=707

 Score =   145 bits (367),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 129/199 (65%), Gaps = 12/199 (6%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
             EAEV++LKEQL   N EKAEI SK+EKLSAICRSQ+ EIQEL+QALAAKT  PN++  +
Sbjct  516  FEAEVDRLKEQLKQANTEKAEIKSKYEKLSAICRSQQHEIQELRQALAAKT-VPNKEASK  574

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            NQ+S  +   S PP QRE IEGTV ELQQG+L  SS  PD   W+AF D+  KP  TPP 
Sbjct  575  NQNSFGNCQSSNPP-QREKIEGTVRELQQGILASSSPIPDSKPWRAFFDE-TKP-QTPPK  631

Query  481  SNTPRSMRT----RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
            S++PRS+RT    +N Q P+ +    + W F  +SF   PS+T      +    N Q   
Sbjct  632  SSSPRSVRTTNGHQNKQAPSGRHGPET-WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVA  688

Query  313  D-KRVDNKSASQPAGWAGF  260
            D K V+ K AS PAGWAGF
Sbjct  689  DSKSVERKQASLPAGWAGF  707



>ref|XP_010257448.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X1 [Nelumbo nucifera]
Length=709

 Score =   145 bits (367),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 129/199 (65%), Gaps = 12/199 (6%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
             EAEV++LKEQL   N EKAEI SK+EKLSAICRSQ+ EIQEL+QALAAKT  PN++  +
Sbjct  518  FEAEVDRLKEQLKQANTEKAEIKSKYEKLSAICRSQQHEIQELRQALAAKT-VPNKEASK  576

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            NQ+S  +   S PP QRE IEGTV ELQQG+L  SS  PD   W+AF D+  KP  TPP 
Sbjct  577  NQNSFGNCQSSNPP-QREKIEGTVRELQQGILASSSPIPDSKPWRAFFDE-TKP-QTPPK  633

Query  481  SNTPRSMRT----RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
            S++PRS+RT    +N Q P+ +    + W F  +SF   PS+T      +    N Q   
Sbjct  634  SSSPRSVRTTNGHQNKQAPSGRHGPET-WNFEPNSFKEFPSSTQV--TQYGQVLNFQLVA  690

Query  313  D-KRVDNKSASQPAGWAGF  260
            D K V+ K AS PAGWAGF
Sbjct  691  DSKSVERKQASLPAGWAGF  709



>ref|XP_010913910.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Elaeis guineensis]
Length=702

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 126/205 (61%), Gaps = 17/205 (8%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPS-PNRDTL  665
            LEAE+ +LKE+L   NMEK EITSK+EKLSAICRSQRQEIQELK+ LAA T S   +D+ 
Sbjct  504  LEAELFRLKEELKQVNMEKEEITSKYEKLSAICRSQRQEIQELKRTLAATTSSHAGKDSS  563

Query  664  RNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsss--SPDPSAWQAFADDGPKPLTT  491
            + Q+SP S    TPP  RE I G+VWELQQG+   S +  SPDP  WQ FA++    + +
Sbjct  564  KAQASPGSTQSDTPP--REKI-GSVWELQQGMFADSPATPSPDPKPWQPFAEE--SKVQS  618

Query  490  PPPSNTPRSMRT-------RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRN  332
             P    PRS+RT       R++    T  S    WGF  DSF A+PS +     S    N
Sbjct  619  TPKGIHPRSVRTVRAANGSRDDTKQTTTYSANEPWGFDDDSFKAIPSGSGVSGTSVQG-N  677

Query  331  NSQRFGDKRVDNKS-ASQPAGWAGF  260
            +SQRFG      K+  SQPAGWAGF
Sbjct  678  SSQRFGGGGETKKAETSQPAGWAGF  702



>ref|XP_010678702.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Beta vulgaris subsp. vulgaris]
Length=664

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 124/200 (62%), Gaps = 10/200 (5%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            K++  EAE  KL+EQL   N EKAEIT+K+EKL+AICRSQRQE+QELKQALAA+TP P +
Sbjct  473  KDNSFEAEKVKLQEQLKQVNAEKAEITAKYEKLTAICRSQRQELQELKQALAARTPPPIK  532

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            ++ RNQ S  ++     P QR   E TV ELQ      S SS +   WQAFA     P +
Sbjct  533  ESTRNQPSSSNE---ATPSQRVKNEVTVRELQGLSDKSSKSS-ETKPWQAFAS---SPTS  585

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
                S + R+    +N+   +  +T   WGFG DSFTA PSA+S+++    + N SQRF 
Sbjct  586  IADRSKSVRTKNGHSNKQDASGGTTQDKWGFGDDSFTAAPSASSRISRP-GEGNTSQRFA  644

Query  313  D--KRVDNKSASQPAGWAGF  260
            D  K     +ASQPAGWAGF
Sbjct  645  DSNKLASKNTASQPAGWAGF  664



>ref|XP_003531422.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Glycine max]
 gb|KHN29185.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=662

 Score =   142 bits (359),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 120/201 (60%), Gaps = 32/201 (16%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E  LEAEVE LKE+L   N+EKAEITSK+EKLSAICRSQRQE+Q+LKQALAA+TPSP+R
Sbjct  491  REQALEAEVEILKEKLKEANLEKAEITSKYEKLSAICRSQRQELQDLKQALAARTPSPSR  550

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            + L+   SP   + ++     +                        +WQAF ++ P+   
Sbjct  551  EGLK--ISPAVTSSASASASSD-----------------------KSWQAFPEE-PQQQR  584

Query  493  TPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
            +    NT +S+R +N   N+ P    +   +WGFGTDSF+AVP+ + QM    S    SQ
Sbjct  585  SLSAENTSKSVRVKNGQQNKQPVPLATDFDSWGFGTDSFSAVPAGSPQMQRPSSAGTKSQ  644

Query  322  RFGDKRVDNKSASQPAGWAGF  260
             FG+    NKS SQPAGWAGF
Sbjct  645  AFGEA---NKSTSQPAGWAGF  662



>ref|XP_010509956.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
 ref|XP_010509957.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=673

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 132/210 (63%), Gaps = 13/210 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ L AE+E+LK++L  TN EKAEIT+KF+KLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  465  KEEALVAEIERLKDELKQTNAEKAEITAKFDKLSAICRSQRQELQDLKQTLASKSASPSP  524

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ +N  SP   + S+ P  RE +EG +WELQ+   + S+ S DP++WQ F+DD    
Sbjct  525  SRDSSQNHPSPGMHSVSSTP-SREKMEGNMWELQKDRSDWSTGSSDPNSWQPFSDDAKPV  583

Query  499  LTTPPPSN---TPRSMRTRNNQPPNTQDSTASAWGFGTDSFTA-----VPSATSQMNASF  344
            L +    N   + +S+RT++            AWGF T+SF A     V ++TS    S 
Sbjct  584  LESASKGNSNTSNQSVRTKSKPASAAGTQGFEAWGFETESFRAATPSSVATSTSATQRSM  643

Query  343  SDRNNSQRFGDKRV--DNKSASQPAGWAGF  260
               N SQR+G  +   +N+  +QPAGWAGF
Sbjct  644  GSGNTSQRYGSTKAMRENQKTAQPAGWAGF  673



>ref|XP_003546865.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Glycine max]
 ref|XP_006598247.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Glycine max]
Length=660

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 115/201 (57%), Gaps = 34/201 (17%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E  LEAEVEKLKEQL   N+EKAEITSK+EKLSAICRSQRQE+Q+LKQAL A+TPSP R
Sbjct  491  REQALEAEVEKLKEQLKEANLEKAEITSKYEKLSAICRSQRQELQDLKQALTARTPSPIR  550

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            D L+   +  S   ++                              +W AF ++ P+   
Sbjct  551  DGLKTSPAVTSSASAS---------------------------ANKSWHAFPEE-PQQQK  582

Query  493  TPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQ  323
            +    NT +S+R +N   N+ P    +   +WGFG+DSF+AVP+ +  M    S    SQ
Sbjct  583  SFSAENTSKSVRVKNGQQNKQPVALATDFDSWGFGSDSFSAVPAGSPHMQRPSSAGTKSQ  642

Query  322  RFGDKRVDNKSASQPAGWAGF  260
             FG+    NKS SQPAGWAGF
Sbjct  643  AFGEA---NKSTSQPAGWAGF  660



>ref|XP_010413940.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=671

 Score =   140 bits (352),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 133/208 (64%), Gaps = 11/208 (5%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ L AE+E+LK++L  TN EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  465  KEEALVAEIERLKDELKQTNAEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  524

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ +NQ SP   + S+ P  RE +EG +WELQ+   + S+ S DP++WQ F+DD    
Sbjct  525  SRDSSQNQPSPGMHSVSSTP-SREKMEGNMWELQKDRSDWSTGSSDPNSWQPFSDDAKPV  583

Query  499  LTTPPPSNTPRSMRTRNNQPPNTQDSTAS--AWGFGTDSFTAVPSATSQMNASFSDR---  335
            L +    N   +   R    P +   T    AWGF T+SF A   +++  +AS + R   
Sbjct  584  LESASKGNNTSNQSVRTKSKPASAAGTQGFEAWGFETESFRAATPSSAATSASATQRSMG  643

Query  334  --NNSQRFGDKRV-DNKSASQPAGWAGF  260
              N SQR+G  ++ +N+  +QPAGWAGF
Sbjct  644  SGNTSQRYGSTKMRENQKTAQPAGWAGF  671



>emb|CDX79504.1| BnaC03g18400D [Brassica napus]
Length=607

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+E+LK++L  T  EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + + SP
Sbjct  408  KEEALEAEIERLKDELKQTKSEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASASP  467

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPK  503
            +RD   NQ+SP  ++ S+ P  R+ +EG+VW+LQQ   +  S+ S DP++WQ F+D+ PK
Sbjct  468  SRDLSHNQTSPGMRSVSSTP-SRDRVEGSVWDLQQTDRSDWSTGSSDPNSWQPFSDE-PK  525

Query  502  PLTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMN-ASFSDRNNS  326
            P+    PS + R+     +  P         WGF T+SF A  ++++     S S  N+S
Sbjct  526  PVLE-TPSKSVRTKSKPASSAPAPASQGFEPWGFETESFRAAATSSASATPKSVSSGNSS  584

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            QRFG+ ++ DN+ A+QPAGWAGF
Sbjct  585  QRFGNTKMRDNQKAAQPAGWAGF  607



>ref|XP_010469538.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Camelina sativa]
Length=672

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 135/209 (65%), Gaps = 12/209 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ L AE+E+LK++L  TN EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  465  KEEALVAEIERLKDELKQTNAEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  524

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ +N  SP   + S+ P  RE  EG +WELQ+   + S+ S DP++WQ F+DD    
Sbjct  525  SRDSSQNHPSPGMHSVSSTP-SREKKEGNMWELQKDRSDWSTGSSDPNSWQPFSDDAKPV  583

Query  499  LTTPPPSN---TPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR--  335
            L +    N   + +S+RTR+            AWGF T+SF A   +++  +AS + R  
Sbjct  584  LESASKGNNSTSNQSVRTRSKPASGAGTQGFEAWGFETESFRAATPSSAATSASATQRNM  643

Query  334  ---NNSQRFGDKRV-DNKSASQPAGWAGF  260
               N SQR+G  ++ +N+ A+QPAGWAGF
Sbjct  644  GTGNTSQRYGSTKMRENQKAAQPAGWAGF  672



>ref|XP_002881248.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57507.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 137/209 (66%), Gaps = 12/209 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+E+LK++L  TN EKAEIT+KFEKLSAICRSQRQE+Q+LKQ+L   + +PSP
Sbjct  453  KEEALEAEIERLKDELKKTNSEKAEITAKFEKLSAICRSQRQELQDLKQSLASKSASPSP  512

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ ++Q SP   + S+ P  R+ IEGT+WELQQ   N S+ S D ++WQ F+D+    
Sbjct  513  SRDSSQSQPSPGMHSMSSTP-SRDKIEGTMWELQQDRSNWSTGSSDTNSWQPFSDEAKPV  571

Query  499  LTTPPPSN---TPRSMRTRNNQPPNTQDSTASAWGFGTDSF-----TAVPSATSQMNASF  344
            + +    N     +S+RTR+            AWGF T+SF     ++  +A++   +  
Sbjct  572  MESASKGNNNTINQSVRTRSKPASAAGTQGFEAWGFETESFRAAATSSATTASATQRSMG  631

Query  343  SDRNNSQRFGDKRV-DNKSASQPAGWAGF  260
            S  N SQR+G+ ++ DN+  +QPAGWAGF
Sbjct  632  SGNNTSQRYGNSKMRDNQKTAQPAGWAGF  660



>ref|XP_004513162.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Cicer arietinum]
 ref|XP_004513163.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Cicer arietinum]
 ref|XP_004513164.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X3 [Cicer arietinum]
 ref|XP_004513165.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X4 [Cicer arietinum]
 ref|XP_004513166.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X5 [Cicer arietinum]
 ref|XP_004513167.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X6 [Cicer arietinum]
 ref|XP_004513168.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X7 [Cicer arietinum]
 ref|XP_004513169.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X8 [Cicer arietinum]
Length=681

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 123/204 (60%), Gaps = 29/204 (14%)
 Frame = -3

Query  850  EDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRD  671
            E+ LE+ VEKLK+QL   N+EKAEIT+K+EKL+AICRSQRQE+Q+LKQALAA+TPSPNR+
Sbjct  500  EEALESLVEKLKDQLKDANLEKAEITAKYEKLTAICRSQRQELQDLKQALAARTPSPNRE  559

Query  670  TLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADD--GPKPL  497
              R      S        +R+T                  + +P +WQAF +D  G K L
Sbjct  560  GFRVSPGVASSASLQDRNERKT-----------------PNSEPKSWQAFPEDAEGVKSL  602

Query  496  TTPPPSNTPRSMRTRNNQPPNTQ----DSTASAWGFGTDSFTAVPSATSQMNASFSDRNN  329
            +     N  +S+R+RN Q  N Q     S   +WGFGTD+F+AV + + QM     + + 
Sbjct  603  SA---DNAFKSVRSRNGQ-QNMQATQPASDFDSWGFGTDTFSAVHAGSPQMPRP-GEGSK  657

Query  328  SQRFGD-KRVDNKSASQPAGWAGF  260
            +  FG+ K  ++KS +QPAGWAGF
Sbjct  658  AHVFGEAKAFESKSNTQPAGWAGF  681



>ref|XP_009132906.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Brassica rapa]
Length=612

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 134/203 (66%), Gaps = 8/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+E+LK++L  T  EKAEIT+KFEKLSAICRSQRQE+QELKQ L   + + SP
Sbjct  413  KEEALEAEIERLKDELKQTKSEKAEITAKFEKLSAICRSQRQELQELKQTLASKSASASP  472

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPK  503
            +RD   NQ+SP  ++ S+ P  R+  EG+VW+LQQ   +  S+ S DP++WQ F+D+ PK
Sbjct  473  SRDLSHNQTSPGMRSVSSTP-SRDRAEGSVWDLQQTDRSDWSTGSSDPNSWQPFSDE-PK  530

Query  502  PLTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF-TAVPSATSQMNASFSDRNNS  326
            P+    PS + R+     +  P         WGF T+SF  A  S+ S    S S  N+S
Sbjct  531  PVLE-SPSKSVRTKSKPASSAPAPASQGFEPWGFETESFRAAATSSASATQRSASSGNSS  589

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            QRFG+ ++ +N+ A+QPAGWAGF
Sbjct  590  QRFGNTKMRENQKAAQPAGWAGF  612



>emb|CDX84704.1| BnaA03g15260D [Brassica napus]
Length=612

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 134/203 (66%), Gaps = 8/203 (4%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+E+LK++L  T  EKAEIT+KFEKLSAICRSQRQE+QELKQ L   + + SP
Sbjct  413  KEEALEAEIERLKDELKQTKSEKAEITAKFEKLSAICRSQRQELQELKQTLASKSASASP  472

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnq-sssSPDPSAWQAFADDGPK  503
            +RD   NQ+SP  ++ S+ P  R+  EG+VW+LQQ   +  S+ S DP++WQ F+D+ PK
Sbjct  473  SRDLSHNQTSPGMRSVSSTP-SRDRAEGSVWDLQQTDRSDWSTGSSDPNSWQPFSDE-PK  530

Query  502  PLTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF-TAVPSATSQMNASFSDRNNS  326
            P+    PS + R+     +  P         WGF T+SF  A  S+ S    S S  N+S
Sbjct  531  PVLE-SPSKSVRTKSKPASSAPAPASQGFEPWGFETESFRAAATSSASATQRSASSGNSS  589

Query  325  QRFGDKRV-DNKSASQPAGWAGF  260
            QRFG+ ++ +N+ A+QPAGWAGF
Sbjct  590  QRFGNTKMRENQKAAQPAGWAGF  612



>gb|AFK34914.1| unknown [Medicago truncatula]
Length=223

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 124/204 (61%), Gaps = 24/204 (12%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E+ LE+EVEKL+EQL   N+EK+EIT+K+EKL+AICRSQRQE+Q+LKQ LAAKTPSP+R
Sbjct  38   REEALESEVEKLREQLKEANLEKSEITAKYEKLTAICRSQRQELQDLKQTLAAKTPSPSR  97

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            +  R  +SP   + S   Q R     + W+               S+WQ F+++  +P  
Sbjct  98   EGFR--TSPGVAS-SASSQDR-----SEWKTPSSEPK--------SSWQPFSEES-EPFK  140

Query  493  TPPPSNTPRSMRTRNNQ--PPNTQDST-ASAWGFGTDSFTA--VPSATSQMNASFSDRNN  329
            +    N  +S+R+RN Q   P TQ +    +WGFG D+F+A    S + QM     + + 
Sbjct  141  SLSADNASKSVRSRNGQQSKPATQPAADFDSWGFGADTFSAARAGSGSPQMPRP-GEGST  199

Query  328  SQRFGD-KRVDNKSASQPAGWAGF  260
            +  F + K  ++KS SQPAGWAGF
Sbjct  200  AHVFREAKGFESKSTSQPAGWAGF  223



>ref|NP_001047290.1| Os02g0591900 [Oryza sativa Japonica Group]
 dbj|BAF09204.1| Os02g0591900, partial [Oryza sativa Japonica Group]
Length=379

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 118/207 (57%), Gaps = 28/207 (14%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL  T+ EKAE+T+KFEKLSAICRSQRQEIQELK+ LA  TP  ++
Sbjct  192  KESELEAEVSNLKEQLKKTSSEKAEMTAKFEKLSAICRSQRQEIQELKRTLAETTPPSSK  251

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
             + R   S         PQ++E IEGTVWEL+QG+L  S  S +   WQAF D   +P  
Sbjct  252  VSSRLPDS--------GPQRKEKIEGTVWELEQGMLANSLPSSEAKTWQAFPDPKSQPAQ  303

Query  493  TPP--------PSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSAT-SQMNASFS  341
              P          N  R+  +R  Q P+        WGFG DSF   P +T +Q+N   +
Sbjct  304  VRPKVDHSTNGAQNLARNANSR--QSPD-------GWGFGPDSFRTSPGSTAAQINRPTA  354

Query  340  DRNNSQRFGDKRVDNKSASQPAGWAGF  260
              ++SQRF       K   QP+GWAGF
Sbjct  355  QGSSSQRFSSGAA--KKVEQPSGWAGF  379



>dbj|BAD34080.1| cyclin G-associated kinase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAG93141.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73506.1| hypothetical protein OsI_07872 [Oryza sativa Indica Group]
 gb|EEE57282.1| hypothetical protein OsJ_07336 [Oryza sativa Japonica Group]
Length=667

 Score =   128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 117/208 (56%), Gaps = 30/208 (14%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL  T+ EKAE+T+KFEKLSAICRSQRQEIQELK+ LA  TP  ++
Sbjct  480  KESELEAEVSNLKEQLKKTSSEKAEMTAKFEKLSAICRSQRQEIQELKRTLAETTPPSSK  539

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
             + R   S         PQ++E IEGTVWEL+QG+L  S  S +   WQAF         
Sbjct  540  VSSRLPDS--------GPQRKEKIEGTVWELEQGMLANSLPSSEAKTWQAF---------  582

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTA---------SAWGFGTDSFTAVPSAT-SQMNASF  344
             P P + P  +R + +   N   + A           WGFG DSF   P +T +Q+N   
Sbjct  583  -PDPKSQPAQVRPKVDHSTNGAQNLARNANSRQSPDGWGFGPDSFRTSPGSTAAQINRPT  641

Query  343  SDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            +  ++SQRF       K   QP+GWAGF
Sbjct  642  AQGSSSQRFSSGAA--KKVEQPSGWAGF  667



>ref|NP_850199.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAN64167.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEC08752.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=670

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 135/210 (64%), Gaps = 13/210 (6%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+++LK++L  T  EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  462  KEEALEAEIQRLKDELKQTKSEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  521

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ +NQ SP   + S+ P  R+ +EGT+WELQQ   N S+ S D ++WQ F+D+    
Sbjct  522  SRDSSQNQPSPGMHSMSSTP-SRDKMEGTMWELQQDRSNWSTGSSDTNSWQPFSDEAKPV  580

Query  499  LTTPPPSN---TPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR--  335
            + +    N     +S+RTR+             WGF T+SF A  ++ +  +AS + R  
Sbjct  581  MESASKGNNNTINQSVRTRSKPASAAGTQGFEPWGFETESFRAAATSAAATSASGTQRSM  640

Query  334  ----NNSQRFGDKRV-DNKSASQPAGWAGF  260
                + SQR+G+ ++ +N+  +QPAGWAGF
Sbjct  641  GSGNSTSQRYGNSKMRENQKTAQPAGWAGF  670



>ref|XP_006647439.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
[Oryza brachyantha]
Length=666

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 122/206 (59%), Gaps = 24/206 (12%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL  T++EKAE+T+K+EKL+AICRSQRQEIQELK+ LA  TP P+ 
Sbjct  477  KESELEAEVSNLKEQLKKTSLEKAEMTAKYEKLTAICRSQRQEIQELKRTLAETTPPPSN  536

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKP  500
                +   P+S +      ++E IEGTVWEL+QG+L  +SS P   A  WQAF +   +P
Sbjct  537  KV--SSRIPESGSL-----RKEKIEGTVWELEQGMLANNSSLPSSEAKTWQAFPEPKSQP  589

Query  499  LTTPPP----SNTPRSM--RTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSD  338
                P     +N  +++   T + QPP         WGFG DSF    +A +Q+N + + 
Sbjct  590  AQVRPKVDHTANGGQNLGRNTNSRQPP-------EGWGFGPDSFRTSGTAAAQINRATAQ  642

Query  337  RNNSQRFGDKRVDNKSASQPAGWAGF  260
             ++S RF       K   QP+GWAGF
Sbjct  643  GSSSHRFSSGAA--KKVEQPSGWAGF  666



>ref|XP_008808088.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008808089.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=698

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 122/203 (60%), Gaps = 23/203 (11%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LEAE ++LKEQL   N+ KAEITSK+EKLSAICRSQRQEIQELK+ALAA TPSP+     
Sbjct  510  LEAEADRLKEQLKQANLGKAEITSKYEKLSAICRSQRQEIQELKRALAAATPSPSSKDSS  569

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSP--DPSAWQAFADDGPKPLTTP  488
                    +  +   Q++ IEGTVWELQQG+L  SS SP  +P  WQAF+ +        
Sbjct  570  KSHISLG-SLQSGTLQKDKIEGTVWELQQGMLANSSPSPSQEPKPWQAFSGE--------  620

Query  487  PPSNTPRSMRTRNNQPPNTQDSTAS----AWGFGTDSFTAVPSATSQMNASFSDRNNSQR  320
             P    R+  T N     T+ S A+     WGF  +SFTA P   +Q++ + +  N SQR
Sbjct  621  -PKAQSRAAGTTNGHQNLTKQSAAAPSSDVWGFNLESFTAAPFG-AQVSRTSAQANTSQR  678

Query  319  F---GDKRVDNKSASQPAGWAGF  260
                G K+V+    SQP+GWAGF
Sbjct  679  LSGGGTKKVET---SQPSGWAGF  698



>gb|KEH33173.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=678

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 124/204 (61%), Gaps = 24/204 (12%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            +E+ LE+EVEKL+EQL   N+EK+EIT+K+EKL+AICRSQRQE+Q+LKQ LAAKTPSP+R
Sbjct  493  REEALESEVEKLREQLKEANLEKSEITAKYEKLTAICRSQRQELQDLKQTLAAKTPSPSR  552

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
            +  R  +SP   + ++   + E      W+               S+WQ F+++  +P  
Sbjct  553  EGFR--TSPGVASSASSQDRSE------WKTPSSEPK--------SSWQPFSEES-EPFK  595

Query  493  TPPPSNTPRSMRTRNNQ--PPNTQDST-ASAWGFGTDSFTA--VPSATSQMNASFSDRNN  329
            +    N  +S+R+RN Q   P TQ +    +WGFG D+F+A    S + QM     + + 
Sbjct  596  SLSADNASKSVRSRNGQQSKPATQPAADFDSWGFGADTFSAARAGSGSPQMPRP-GEGST  654

Query  328  SQRFGD-KRVDNKSASQPAGWAGF  260
            +  F + K  ++KS SQPAGWAGF
Sbjct  655  AHVFREAKGFESKSTSQPAGWAGF  678



>ref|XP_010542987.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542988.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542989.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=633

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 113/206 (55%), Gaps = 38/206 (18%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKT-PSPN  677
            K++ LEAE+E+LKEQL   N EKAE+T+KFEKLS IC++QRQE+ ELKQ LAAKT  SP+
Sbjct  458  KDETLEAEIERLKEQLKQANTEKAEMTAKFEKLSCICKTQRQELHELKQRLAAKTSASPS  517

Query  676  RDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP-  500
            RD+ + Q S  ++  ST P+ R       W               P AW+AF+D+ PKP 
Sbjct  518  RDSPQIQISSGAR--STLPEDRSD-----WASGNSA---------PKAWKAFSDE-PKPG  560

Query  499  LTTPPPSNTP---RSMRTRNNQPPNTQDSTASAWGFGTDSF---TAVPSATSQMNASFSD  338
            L T    N     +S+ TRN+QP  T       WGF TDSF   T + S+ S M      
Sbjct  561  LQTASKGNNISNNQSVITRNSQPSKTASQGFDPWGFETDSFRAATTLSSSASAMQRPLGS  620

Query  337  RNNSQRFGDKRVDNKSASQPAGWAGF  260
             NN             A QPAGWAGF
Sbjct  621  DNN-------------APQPAGWAGF  633



>ref|XP_010542991.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=632

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 113/206 (55%), Gaps = 38/206 (18%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKT-PSPN  677
            K++ LEAE+E+LKEQL   N EKAE+T+KFEKLS IC++QRQE+ ELKQ LAAKT  SP+
Sbjct  457  KDETLEAEIERLKEQLKQANTEKAEMTAKFEKLSCICKTQRQELHELKQRLAAKTSASPS  516

Query  676  RDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP-  500
            RD+ + Q S  ++  ST P+ R       W               P AW+AF+D+ PKP 
Sbjct  517  RDSPQIQISSGAR--STLPEDRSD-----WASGNSA---------PKAWKAFSDE-PKPG  559

Query  499  LTTPPPSNTP---RSMRTRNNQPPNTQDSTASAWGFGTDSF---TAVPSATSQMNASFSD  338
            L T    N     +S+ TRN+QP  T       WGF TDSF   T + S+ S M      
Sbjct  560  LQTASKGNNISNNQSVITRNSQPSKTASQGFDPWGFETDSFRAATTLSSSASAMQRPLGS  619

Query  337  RNNSQRFGDKRVDNKSASQPAGWAGF  260
             NN             A QPAGWAGF
Sbjct  620  DNN-------------APQPAGWAGF  632



>ref|XP_003575255.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235618.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
Length=672

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 119/203 (59%), Gaps = 26/203 (13%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LEAEV  LKEQL  T +EKAE+T+K+EKLSAICRSQRQEIQELK+ +A  TP P+     
Sbjct  487  LEAEVSSLKEQLKKTTLEKAEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPPSIKV--  544

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTP  488
                  S+   +  Q++E IEGTVWEL+QG+L   SS P   A  WQAF +   +     
Sbjct  545  -----SSRIPESGSQRKEKIEGTVWELEQGMLAGKSSLPSSEAKTWQAFPEAKVQARPKV  599

Query  487  PPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPS----ATSQMNASFSDRNNSQR  320
              +   R   TRN     + D    AWGFG DSF  +PS    A +Q+N + +  ++SQR
Sbjct  600  DHATNGRQNLTRNTNAGPSPD----AWGFGPDSF-GMPSGSTAAAAQINRTSAQGSSSQR  654

Query  319  F---GDKRVDNKSASQPAGWAGF  260
            F     K+VD     QP+GWAGF
Sbjct  655  FSTGAAKKVD-----QPSGWAGF  672



>ref|XP_008677437.1| PREDICTED: uncharacterized protein LOC100304212 isoform X1 [Zea 
mays]
 gb|AFW62790.1| putative protein kinase superfamily protein [Zea mays]
Length=666

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 115/199 (58%), Gaps = 20/199 (10%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LE EV  LKEQL  T +EKAE+T+K+EKLSAICRSQRQEIQELK+ LA  TP  N+ + R
Sbjct  483  LELEVSSLKEQLKKTTLEKAEMTAKYEKLSAICRSQRQEIQELKRTLAEATPPSNKVSSR  542

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElq--qgllnqsssSPDPSAWQAFADDGPKPLTTP  488
             Q S          Q++E I+GT+WEL+      N SS+S D   WQAF    P   T  
Sbjct  543  TQDSGS--------QRKEKIQGTLWELEQGMLASNTSSASSDVKTWQAF----PDTQTQA  590

Query  487  PPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRF  317
             P     +  ++N     T  ++  AWGFGTDSF   +A   A +Q+N + +  ++SQRF
Sbjct  591  RPKVDHGTNGSQNITKNTTSGASPDAWGFGTDSFRTSSAPVKAATQINRA-AQGSSSQRF  649

Query  316  GDKRVDNKSASQPAGWAGF  260
                   K   QP+GWAGF
Sbjct  650  NSGVA--KKVEQPSGWAGF  666



>ref|XP_009394517.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394519.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394520.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
Length=704

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 121/209 (58%), Gaps = 18/209 (9%)
 Frame = -3

Query  850  EDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRD  671
            E  LE E+ +LK++L   N EK E+TSK EKLSAICRSQRQEIQELK+A+AA +PSP   
Sbjct  502  EKELEDELSRLKQELKQVNGEKEEMTSKCEKLSAICRSQRQEIQELKRAVAAASPSPPNK  561

Query  670  TLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgl--lnqsssSPDPSAWQAFADDGPKPL  497
              + Q SP S    TPP  RE IEG + ELQ+GL   N S+ SPDP  W AF D     +
Sbjct  562  ESKPQISPGSSQSDTPP--REKIEGNLPELQRGLFPNNPSTPSPDPKPWSAFGD---TMV  616

Query  496  TTPPPSNTPRSMRT-------RNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSD  338
               P S+ P+S+RT       RNN    +  S    WGF  DSF A  S +SQ+     +
Sbjct  617  QDTPKSSHPKSVRTIRGTNSNRNNIKQPSASSADEPWGFNQDSFRA-DSHSSQVPKPSFE  675

Query  337  RNNSQRFGD---KRVDNKSASQPAGWAGF  260
             N SQRFG     +V     ++P+GW GF
Sbjct  676  GNTSQRFGGGGPGKVKAVETNRPSGWTGF  704



>ref|XP_006850020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Amborella trichopoda]
 gb|ERN11601.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
Length=706

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 123/220 (56%), Gaps = 24/220 (11%)
 Frame = -3

Query  853  KEDL-LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPN  677
            KED  L+ EVE+L+EQL     EKAE+ SK+EKL+AICRSQRQEIQELKQA+AA +   N
Sbjct  489  KEDSSLQGEVERLREQLKQVVAEKAEVASKYEKLTAICRSQRQEIQELKQAIAAGSNRDN  548

Query  676  RDTLRNQSSPKSQTFSTPPQ-----QRETIEGTVWElqqglln--qsssSPDPSAWQAFA  518
                 +  S   Q+  +P       QR+ IEG++WELQ+G+     S+ SPD   WQAF 
Sbjct  549  SKVGASSQSQAQQSHKSPGSWQSGAQRDKIEGSIWELQEGMQTNNTSNISPDSKPWQAFT  608

Query  517  DDGPKPLTTPPPSNT-PRSMRTRNNQPPNTQD-----STASAWGFGTDSFTAVPSATSQM  356
            D  P  +  PP  N+ P+   TR      T+      S+A AWGFG D F A       +
Sbjct  609  DT-PAKIQPPPSKNSNPKQTSTRPTNGHQTKQTASLYSSADAWGFGQDGFVAANKDGPHI  667

Query  355  NASFSDRNNSQRFG--------DKRVDNKSASQPAGWAGF  260
              + +  + SQRF          K +D+ S +QPAGWAGF
Sbjct  668  TKTSTQASISQRFAPPNPHIAQPKSMDD-SRTQPAGWAGF  706



>ref|NP_565756.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAB91980.2| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAM14904.1| putative serine threonine protein kinase [Arabidopsis thaliana]
 gb|AAM67308.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN12961.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEC08751.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=650

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 133/207 (64%), Gaps = 27/207 (13%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+++LK++L  T  EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  462  KEEALEAEIQRLKDELKQTKSEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  521

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ +NQ SP   + S+ P  R+ +EGT+WELQQ   N S+ S D ++WQ F+D+  KP
Sbjct  522  SRDSSQNQPSPGMHSMSSTP-SRDKMEGTMWELQQDRSNWSTGSSDTNSWQPFSDEA-KP  579

Query  499  LTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR-----  335
            +          S  T+  +P          WGF T+SF A  ++ +  +AS + R     
Sbjct  580  VMESA------SKGTQGFEP----------WGFETESFRAAATSAAATSASGTQRSMGSG  623

Query  334  -NNSQRFGDKRV-DNKSASQPAGWAGF  260
             + SQR+G+ ++ +N+  +QPAGWAGF
Sbjct  624  NSTSQRYGNSKMRENQKTAQPAGWAGF  650



>gb|AAL60023.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=650

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 133/207 (64%), Gaps = 27/207 (13%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ LEAE+++LK++L  T  EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  462  KEEALEAEIQRLKDELKQTKSEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  521

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD+ +NQ SP   + S+ P  R+ +EGT+WELQQ   N S+ S D ++WQ F+D+  KP
Sbjct  522  SRDSSQNQPSPGMHSMSSTP-SRDKMEGTMWELQQDRSNWSTGSSDTNSWQPFSDEA-KP  579

Query  499  LTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDR-----  335
            +          S  T+  +P          WGF T+SF A  ++ +  +AS + R     
Sbjct  580  VMESA------SKGTQGFEP----------WGFETESFRAAATSAAATSASGTQRSMGSG  623

Query  334  -NNSQRFGDKRV-DNKSASQPAGWAGF  260
             + SQR+G+ ++ +N+  +QPAGWAGF
Sbjct  624  NSTSQRYGNSKMRENQKTAQPAGWAGF  650



>ref|XP_009395097.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395098.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
Length=670

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 119/201 (59%), Gaps = 34/201 (17%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPS-PNRDTL  665
            LEAEV++LK QL   N+EK EITS++EKLSA+CRSQRQEIQELK ALAA +PS P +D+ 
Sbjct  497  LEAEVDQLKGQLKQANLEKTEITSRYEKLSAVCRSQRQEIQELKHALAAVSPSPPGKDST  556

Query  664  RNQSSPKSQTFSTPPQQRETIEGTVWElqqglln-qsssSPDPSAWQAFADDGPKPLTTP  488
            +N   P S    TPP  R  IEGTVWELQQG+++   S  P+   W AF           
Sbjct  557  KNHEHPGSLQSITPP--RMKIEGTVWELQQGMMHPSPSPRPETKTWNAFG----------  604

Query  487  PPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTA-----VPSATSQMNASFSDRNNSQ  323
              +N  +++ +  N  P+T       WGF   SFTA     +  +++Q NAS   R NS 
Sbjct  605  -ATNGHQNVMSAVN--PST-----DLWGFNLGSFTASSGSQISGSSAQGNASM--RTNSG  654

Query  322  RFGDKRVDNKSASQPAGWAGF  260
                K+ D   A+QPAGWAGF
Sbjct  655  --ATKKAD---ANQPAGWAGF  670



>ref|XP_010943528.1| PREDICTED: AP2-associated protein kinase 1-like [Elaeis guineensis]
Length=698

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 121/197 (61%), Gaps = 11/197 (6%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKT-PSPNRDTL  665
            LE EV++LKEQL   N++K EITSK+EKLSAICRSQRQEIQELK+ALA  T   P++D+ 
Sbjct  510  LEGEVDRLKEQLKQANLKKDEITSKYEKLSAICRSQRQEIQELKRALAGATPSPPSKDSS  569

Query  664  RNQSSPKSQTFSTPPQQRETIEGTVWElqqglln--qsssSPDPSAWQAFADDGPKPLTT  491
            ++  SP S    T   Q++ IEGTVWELQQG+L     S SP+P  WQAF+ +       
Sbjct  570  KSHVSPGSLQPGT--LQKDKIEGTVWELQQGMLENSSPSPSPEPKPWQAFSGETKVQSIA  627

Query  490  PPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD  311
               +N  +++  +     +    ++  WGF  +SFTA PS  +Q++ +    N S+RFG 
Sbjct  628  AGMTNGHQNLTKQ-----SVAGLSSDVWGFNLESFTAAPSG-AQVSRTSIQANTSRRFGS  681

Query  310  KRVDNKSASQPAGWAGF  260
                    SQPAGWAGF
Sbjct  682  GGTKKVETSQPAGWAGF  698



>ref|XP_004956476.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Setaria italica]
Length=699

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 117/214 (55%), Gaps = 21/214 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL   N+EK EI+ KF+KLSAIC SQR+EIQELKQALA  + +P  
Sbjct  491  KECQLEAEVTLLKEQLKIANLEKEEISLKFDKLSAICSSQRREIQELKQALATASVTPPA  550

Query  673  DTLRNQS----SPKSQTFSTPPQQRETIEGTVWElqqgllnq--sssSPDPSAWQAFADD  512
               R  S    SP S +  TPP  RE IEGT  EL+QGL      + SPDP  W AF DD
Sbjct  551  KQFRENSKVELSPPSTSLDTPP--REKIEGTPPELRQGLFTSRPGTPSPDPKPWSAFPDD  608

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPN--------TQDSTASAWGFGTDSFTAVPSATSQM  356
             PKP      S  PRS+RT      N           S+A  + FG DSF A PS T   
Sbjct  609  -PKP-QAAVKSAHPRSVRTLRASNSNKASSLGQPNASSSADPFAFGQDSFKAAPSGTVPP  666

Query  355  NASFSDRNNSQRFGDKRVDNK--SASQPAGWAGF  260
              S +  N +Q   ++  + K   + QPAGW GF
Sbjct  667  KLS-NMGNTTQLLNNQNAEEKKDGSYQPAGWTGF  699



>gb|EMT28285.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=668

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 118/199 (59%), Gaps = 23/199 (12%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LEAEV  LKEQL  T  EKAE+T+K+EKLSAICRSQRQEIQELK+ +A  TP P+     
Sbjct  488  LEAEVSNLKEQLKKTTSEKAEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPPS-----  542

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSA--WQAFADDGPKPLTTP  488
              S   S+T     Q++E IEGTVWEL+QG+L+ +SS+P   A  WQ+F +   +     
Sbjct  543  --SKVSSRTPELGSQRKERIEGTVWELEQGMLSGNSSAPSSEAKTWQSFPEAKAQTRPKV  600

Query  487  PPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRF---  317
              +   R   TRN     + D    AWGFGT S +   +  +QMN + +  ++SQR    
Sbjct  601  DHATNGRQNLTRNTNAGPSPD----AWGFGTSSGSN--ATATQMNRTNAQGSSSQRLSMG  654

Query  316  GDKRVDNKSASQPAGWAGF  260
              K+VD     QP+GWAGF
Sbjct  655  AAKKVD-----QPSGWAGF  668



>gb|EMT09791.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=685

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 122/214 (57%), Gaps = 21/214 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALA-AKTPSPN  677
            KE  LEAEV  LKEQL   N+EK EI+ KF++LSAIC SQR+EIQELKQALA A  P+P 
Sbjct  477  KEQQLEAEVTLLKEQLKIANLEKEEISLKFDRLSAICSSQRREIQELKQALATASAPAPV  536

Query  676  RDT---LRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqs--ssSPDPSAWQAFADD  512
            ++    L+ + SP S +  TPP  RE I GT  EL+QGL   S  + SPDP  W AF ++
Sbjct  537  KELKENLKAEFSPPSTSLDTPP--REKIAGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE  594

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPNTQ--------DSTASAWGFGTDSFTAVPSAT--S  362
             PK       S  PRS+RT      N          +S A  + FG DSF AVPS T  S
Sbjct  595  -PKA-QAAVKSARPRSVRTLRASQSNKAGSLSQSKTNSGADPFAFGQDSFKAVPSGTVPS  652

Query  361  QMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            +M ++  + + S       V+  +  QPAGW GF
Sbjct  653  EM-SNLGNASQSLNTLKAEVEKDAPYQPAGWTGF  685



>tpg|DAA39365.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=603

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 115/214 (54%), Gaps = 22/214 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL   N+EK EI+ KF+KLSAIC SQR+EIQELKQALAA   +P  
Sbjct  396  KELQLEAEVTLLKEQLKIANLEKEEISLKFDKLSAICSSQRREIQELKQALAAAYVTPPA  455

Query  673  DTLRNQSS----PKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDP--SAWQAFADD  512
               R  SS    P S++  TPP  RE IEGT  EL+QGL   S  +P P    W AF ++
Sbjct  456  KQFRENSSVEVTPPSKSLDTPP--REKIEGTPPELRQGLFTSSPGTPSPDLKTWSAFLEE  513

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPNTQDSTASA--------WGFGTDSFTAVPSATSQM  356
             PK       S  PRS+RT      N   S   +        + FG DSF A PS T  +
Sbjct  514  -PKS-QAAVKSVHPRSVRTLRASNSNKASSLGQSNISSSTDPFAFGQDSFKAAPSGT--V  569

Query  355  NASFSDRNNSQRFGDKRVDNK--SASQPAGWAGF  260
                S+  N+ +  +  ++ K   + QP GW GF
Sbjct  570  LPLLSNMGNTSQLSNLNIEEKKDGSYQPDGWTGF  603



>ref|XP_008671591.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Zea mays]
Length=640

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 115/214 (54%), Gaps = 22/214 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL   N+EK EI+ KF+KLSAIC SQR+EIQELKQALAA   +P  
Sbjct  433  KELQLEAEVTLLKEQLKIANLEKEEISLKFDKLSAICSSQRREIQELKQALAAAYVTPPA  492

Query  673  DTLRNQSS----PKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSA--WQAFADD  512
               R  SS    P S++  TPP  RE IEGT  EL+QGL   S  +P P    W AF ++
Sbjct  493  KQFRENSSVEVTPPSKSLDTPP--REKIEGTPPELRQGLFTSSPGTPSPDLKTWSAFLEE  550

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPNTQDSTASA--------WGFGTDSFTAVPSATSQM  356
             PK       S  PRS+RT      N   S   +        + FG DSF A PS T  +
Sbjct  551  -PKS-QAAVKSVHPRSVRTLRASNSNKASSLGQSNISSSTDPFAFGQDSFKAAPSGT--V  606

Query  355  NASFSDRNNSQRFGDKRVDNK--SASQPAGWAGF  260
                S+  N+ +  +  ++ K   + QP GW GF
Sbjct  607  LPLLSNMGNTSQLSNLNIEEKKDGSYQPDGWTGF  640



>ref|XP_004952949.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Setaria 
italica]
Length=609

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 106/193 (55%), Gaps = 21/193 (11%)
 Frame = -3

Query  817  KEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQ  638
            KEQL  T +EK E+T+K+EKLSAICRSQRQE+QELK+ LA  TP  N+ + R Q S    
Sbjct  431  KEQLKKTTLEKDEMTAKYEKLSAICRSQRQELQELKRTLAETTPPSNKVSSRTQDS----  486

Query  637  TFSTPPQQRETIEGTVW--ElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTP--  470
                 PQ++E IEGTVW  E      N  S+S D   WQ F D   +    P   +    
Sbjct  487  ----GPQRKEKIEGTVWELEHGMLASNSKSASSDAKTWQVFPDTKTQAQARPKVDHATNG  542

Query  469  RSMRTRNNQPPNTQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVD  299
            R   T++  P  + D    AWGFGTD++    A  S  +Q+N + +  ++SQRF      
Sbjct  543  RQNLTKSTNPGPSPD----AWGFGTDNYRTSAAAASTATQINRTTAQGSSSQRFSTGVA-  597

Query  298  NKSASQPAGWAGF  260
             K   QP+GWAGF
Sbjct  598  -KKVEQPSGWAGF  609



>ref|XP_004952948.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Setaria 
italica]
Length=670

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 106/193 (55%), Gaps = 21/193 (11%)
 Frame = -3

Query  817  KEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQ  638
            KEQL  T +EK E+T+K+EKLSAICRSQRQE+QELK+ LA  TP  N+ + R Q S    
Sbjct  492  KEQLKKTTLEKDEMTAKYEKLSAICRSQRQELQELKRTLAETTPPSNKVSSRTQDS----  547

Query  637  TFSTPPQQRETIEGTVW--ElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTP--  470
                 PQ++E IEGTVW  E      N  S+S D   WQ F D   +    P   +    
Sbjct  548  ----GPQRKEKIEGTVWELEHGMLASNSKSASSDAKTWQVFPDTKTQAQARPKVDHATNG  603

Query  469  RSMRTRNNQPPNTQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVD  299
            R   T++  P  + D    AWGFGTD++    A  S  +Q+N + +  ++SQRF      
Sbjct  604  RQNLTKSTNPGPSPD----AWGFGTDNYRTSAAAASTATQINRTTAQGSSSQRFSTGVA-  658

Query  298  NKSASQPAGWAGF  260
             K   QP+GWAGF
Sbjct  659  -KKVEQPSGWAGF  670



>gb|AFW81246.1| hypothetical protein ZEAMMB73_183204 [Zea mays]
Length=509

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 106/182 (58%), Gaps = 19/182 (10%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            LE EV  LKEQL    +EKAE+T+K EKLSAICRSQRQEIQELK  L   TP  N+ + R
Sbjct  196  LELEVSNLKEQLKKITLEKAEMTTKHEKLSAICRSQRQEIQELKLTLVEPTPPSNKVSSR  255

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSA----WQAFADDGPKPLT  494
             Q S          Q++E I+GTVWEL+QG+L  +S+S   S+    WQAF    P   T
Sbjct  256  TQDSGS--------QRKEKIQGTVWELEQGMLAIASNSSSASSDAKTWQAF----PDTKT  303

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQ  323
               P     +  ++N     T  ++  AWGFGTD+F        AT+Q+N + + R++SQ
Sbjct  304  QARPKVDHATNGSQNITKNTTSGASPDAWGFGTDNFRTPATTLRATTQINRAAAQRSSSQ  363

Query  322  RF  317
            RF
Sbjct  364  RF  365



>gb|EAZ08411.1| hypothetical protein OsI_30675 [Oryza sativa Indica Group]
Length=703

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 116/225 (52%), Gaps = 29/225 (13%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL   N+EK EI  KF+KLS IC SQR+EIQELKQALA  + + + 
Sbjct  481  KEQQLEAEVTLLKEQLKIANLEKEEIALKFDKLSGICSSQRREIQELKQALATASATQSV  540

Query  673  DTLRNQS----SPKSQTFSTPPQQRETIEGTVWElqqgllnqs--ssSPDPSAWQAFADD  512
               +  S    SP S +  TPP  RE IEGT  EL+QGL   S  + SPDP  W AF ++
Sbjct  541  KEFKENSKAELSPPSTSLDTPP--REKIEGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE  598

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPN--------TQDSTASAWGFGTDSFTAVPSAT--S  362
                         PRS+RT      N           S+A  + FG DSF A PS    S
Sbjct  599  PKAQAAVTVKGAHPRSVRTLRASNSNKASSLGQSNTSSSADPFAFGQDSFKAAPSRALPS  658

Query  361  QM----NASFSDR-----NNSQRFGDKRVDNK--SASQPAGWAGF  260
            +M    N S S +     N SQ     + + K  S+ QPAGW GF
Sbjct  659  KMSNLGNGSQSSKMSNLGNGSQSLNALKAEAKQDSSYQPAGWTGF  703



>dbj|BAD26025.1| putative AAK1 protein [Oryza sativa Japonica Group]
Length=703

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 116/225 (52%), Gaps = 29/225 (13%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE  LEAEV  LKEQL   N+EK EI  KF+KLS IC SQR+EIQELKQALA  + + + 
Sbjct  481  KEQQLEAEVTLLKEQLKIANLEKEEIALKFDKLSGICSSQRREIQELKQALATASATQSV  540

Query  673  DTLRNQS----SPKSQTFSTPPQQRETIEGTVWElqqgllnqs--ssSPDPSAWQAFADD  512
               +  S    SP S +  TPP  RE IEGT  EL+QGL   S  + SPDP  W AF ++
Sbjct  541  KEFKENSKAELSPPSTSLDTPP--REKIEGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE  598

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPN--------TQDSTASAWGFGTDSFTAVPSAT--S  362
                         PRS+RT      N           S+A  + FG DSF A PS    S
Sbjct  599  PKAQAAVTVKGAHPRSVRTLRASNSNKASSLGQSNTSSSADPFAFGQDSFKAAPSRALPS  658

Query  361  QM----NASFSDR-----NNSQRFGDKRVDNK--SASQPAGWAGF  260
            +M    N S S +     N SQ     + + K  S+ QPAGW GF
Sbjct  659  KMSNLGNGSQSSKMSNLGNGSQSLNALKAEAKQDSSYQPAGWTGF  703



>ref|XP_010237997.1| PREDICTED: AP2-associated protein kinase 1-like [Brachypodium 
distachyon]
Length=697

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 112/212 (53%), Gaps = 22/212 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALA-AKTPSPN  677
            KE  LE EV  LKEQL   N+EK EI+ KF+KLSAIC SQR+EIQELKQALA A    P 
Sbjct  494  KEHQLETEVTLLKEQLKIANLEKEEISLKFDKLSAICSSQRREIQELKQALATASATLPV  553

Query  676  RDTLRNQS---SPKSQTFSTPPQQRETIEGTVWElqqgllnqs--ssSPDPSAWQAFADD  512
            ++   N     SP++ +  TPP  RE I GT  EL+QGL   S  + SPDP  W AF ++
Sbjct  554  KEFKENSKGVVSPQTASLDTPP--REKIAGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE  611

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPNTQDST--------ASAWGFGTDSFTAVPSATSQM  356
             PK       S  PRS+RT      N   S         A  + FG DSF AVPS  S +
Sbjct  612  -PKA-QAAMKSAHPRSVRTLRASNSNKVSSLGQSKTNPGADPFAFGQDSFKAVPSEMSNL  669

Query  355  NASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
              +    N  +      V   +  QPAGW GF
Sbjct  670  GNASQSPNTLK----AEVKKDAPYQPAGWTGF  697



>ref|XP_006660487.1| PREDICTED: AP2-associated protein kinase 1-like [Oryza brachyantha]
Length=710

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 94/225 (42%), Positives = 119/225 (53%), Gaps = 29/225 (13%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPN-  677
            KE  LEAEV  LKEQL   N+EK EI+ KF+KLSAIC SQR+EIQELKQALA  + + + 
Sbjct  488  KEQKLEAEVNLLKEQLKIANLEKEEISLKFDKLSAICSSQRREIQELKQALATASATQSA  547

Query  676  ---RDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqs--ssSPDPSAWQAFADD  512
               ++  + + SP   +  TPP  RE IEGT  EL+QGL   S  + SPDP  W AF ++
Sbjct  548  KEFKENPKAELSPPITSLDTPP--REKIEGTPPELRQGLFTSSPGTPSPDPKPWSAFPEE  605

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPN--------TQDSTASAWGFGTDSFTAVPS--ATS  362
                      S  PRS+RT      N           S+A  + FG DSF A PS  A S
Sbjct  606  PKAQAAVTVKSAHPRSVRTLRASNSNKASSLGQSNTSSSADPFAFGQDSFKAAPSQAAPS  665

Query  361  QM----NASFSDRNNSQRFGDKRVDNKSAS-------QPAGWAGF  260
            +M    N S S + ++   G   ++   A        QPAGW GF
Sbjct  666  KMSNLGNGSQSSKMSNLGNGSPSLNALKAEARQDSPYQPAGWTGF  710



>ref|NP_001159134.1| uncharacterized protein LOC100304212 [Zea mays]
 gb|ACN25170.1| unknown [Zea mays]
Length=163

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 98/178 (55%), Gaps = 20/178 (11%)
 Frame = -3

Query  778  ITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQQRETIE  599
            +T+K+EKLSAICRSQRQEIQELK+ LA  TP  N+ + R Q S          Q++E I+
Sbjct  1    MTAKYEKLSAICRSQRQEIQELKRTLAEATPPSNKVSSRTQDS--------GSQRKEKIQ  52

Query  598  GTVW--ElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRNNQPPNTQD  425
            GT+W  E      N SS+S D   WQAF    P   T   P     +  ++N     T  
Sbjct  53   GTLWELEQGMLASNTSSASSDVKTWQAF----PDTQTQARPKVDHGTNGSQNITKNTTSG  108

Query  424  STASAWGFGTDSF---TAVPSATSQMNASFSDRNNSQRFGDKRVDNKSASQPAGWAGF  260
            ++  AWGFGTDSF   +A   A +Q+N + +  ++SQRF       K   QP+GWAGF
Sbjct  109  ASPDAWGFGTDSFRTSSAPVKAATQINRA-AQGSSSQRFNSGVA--KKVEQPSGWAGF  163



>ref|XP_009143925.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Brassica rapa]
Length=583

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 110/207 (53%), Gaps = 53/207 (26%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAK--TPSP  680
            KE  LEAEVE+LKE+L  T  EKAEIT+KFEKLS ICRSQRQE+Q+LKQ LA+K  T SP
Sbjct  421  KEVALEAEVERLKEELKRTKSEKAEITAKFEKLSVICRSQRQELQDLKQTLASKTVTSSP  480

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKP  500
            +RD      SP  ++ S+ P + +    +  E  +     +S +P P      A  G +P
Sbjct  481  SRD------SPGMRSTSSTPSRDKGNNNSNNESVRSKSKTASLAPAP------ASQGFEP  528

Query  499  LTTPPPSNTPRSMRTRNNQPPNTQDSTASAWGFGTDSF------TAVPSATSQMNASFSD  338
                                          WGF T+SF      +   S T+Q + SF  
Sbjct  529  ------------------------------WGFETESFRAASQSSGSASTTAQRSVSFG-  557

Query  337  RNNSQRFGDKRV-DNKSASQPAGWAGF  260
             ++SQR G+ ++ +N+ A+QPAGWAGF
Sbjct  558  -SSSQRLGNTKMRENQKAAQPAGWAGF  583



>dbj|BAJ97005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 115/214 (54%), Gaps = 21/214 (10%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSP--  680
            KE  LEAEV  LKEQL   N+EK EI+ KF++LSAIC SQR+EIQELKQALA  + +   
Sbjct  485  KEQQLEAEVTLLKEQLKIANLEKEEISLKFDRLSAICSSQRREIQELKQALAIASAAAPV  544

Query  679  --NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSA--WQAFADD  512
               ++ L+ + SP S +  TPP  RE I GT  EL+QGL   S  +P P    W AF ++
Sbjct  545  KELKENLKAEFSPPSTSLDTPP--REKIAGTPPELRQGLFTSSPGTPSPDLKPWSAFPEE  602

Query  511  GPKPLTTPPPSNTPRSMRTRNNQPPNTQ--------DSTASAWGFGTDSFTAVPSATSQM  356
             PK       S  PRS+RT      N          +S A  + FG DSF AVPS T   
Sbjct  603  -PKA-QAAVKSAHPRSVRTLRASNSNKAGSLSQSKTNSGADPFAFGQDSFKAVPSGTVP-  659

Query  355  NASFSDRNNSQRFGDKRVDNKSAS--QPAGWAGF  260
            +   +  N SQ     + D K     QPAGW GF
Sbjct  660  SEILNLGNASQSLNTLKADVKKDEPYQPAGWTGF  693



>ref|XP_010469539.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Camelina sativa]
Length=598

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ L AE+E+LK++L  TN EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  465  KEEALVAEIERLKDELKQTNAEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  524

Query  679  NRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQ  527
            +RD+ +N  SP   + S+ P  RE +EG++WELQ+   + S+ S DP++WQ
Sbjct  525  SRDSSQNHPSPGMHSVSSTP-SREKMEGSMWELQKDRSDWSTESSDPNSWQ  574



>ref|XP_009408443.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like, 
partial [Musa acuminata subsp. malaccensis]
Length=632

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 90/134 (67%), Gaps = 9/134 (7%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPS-PN  677
            KEDL E+EV KLKEQL   N+EK ++TSK+EKLSAICRSQRQEIQELK AL+A +PS P+
Sbjct  491  KEDL-ESEVGKLKEQLKQANLEKVDMTSKYEKLSAICRSQRQEIQELKSALSALSPSLPS  549

Query  676  RDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgll---nqsssSPDPSAWQAFADDGP  506
            +D  ++ + P S   +  P  R+ +EG+VW+LQQG++   + SS  P+   W AF   G 
Sbjct  550  KDRSKSHNHPGSLESAALP--RDKMEGSVWDLQQGMMSNPSASSHRPELKTWNAF--HGE  605

Query  505  KPLTTPPPSNTPRS  464
              +   P SN P S
Sbjct  606  PKIQAAPRSNHPIS  619



>emb|CDY12158.1| BnaC04g11880D [Brassica napus]
Length=577

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 106/210 (50%), Gaps = 66/210 (31%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNR  674
            KE+ LEAEVE+LKE+L  T  EKAEIT+KFEKLSAICRSQRQE+Q+LKQ +A+KT S   
Sbjct  422  KEEALEAEVERLKEELKRTKSEKAEITAKFEKLSAICRSQRQELQDLKQTIASKTVS---  478

Query  673  DTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLT  494
                  SSP   +    P  R T                                     
Sbjct  479  ------SSPSRYS----PGMRST-------------------------------------  491

Query  493  TPPPSNTPRSMRTRNNQPPNTQDSTASA------WGFGTDSFTAVPSATSQMNASFSDR-  335
                S+TP   +  NN+   ++   ASA      WGF T+SF A  S +S    + + R 
Sbjct  492  ----SSTPSRDKGNNNESVRSKSKPASASQGFERWGFETESFRAAASPSSASATTTAQRS  547

Query  334  ----NNSQRFGDKRV-DNKSASQPAGWAGF  260
                ++SQR G+ ++ +N+ A+QPAGWAGF
Sbjct  548  VSSGSSSQRLGNTKMRENQKAAQPAGWAGF  577



>ref|XP_010469540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Camelina sativa]
Length=550

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = -3

Query  853  KEDLLEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQAL--AAKTPSP  680
            KE+ L AE+E+LK++L  TN EKAEIT+KFEKLSAICRSQRQE+Q+LKQ L   + +PSP
Sbjct  465  KEEALVAEIERLKDELKQTNAEKAEITAKFEKLSAICRSQRQELQDLKQTLASKSASPSP  524

Query  679  NRDTLRNQSSPKSQTFSTPP  620
            +RD+ +N  SP   + S+ P
Sbjct  525  SRDSSQNHPSPGMHSVSSTP  544



>ref|XP_010235619.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Brachypodium distachyon]
Length=612

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSP  680
            LEAEV  LKEQL  T +EKAE+T+K+EKLSAICRSQRQEIQELK+ +A  TP P
Sbjct  487  LEAEVSSLKEQLKKTTLEKAEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPP  540



>ref|XP_001769351.1| predicted protein [Physcomitrella patens]
 gb|EDQ65720.1| predicted protein [Physcomitrella patens]
Length=666

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 100/211 (47%), Gaps = 35/211 (17%)
 Frame = -3

Query  841  LEAEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPSPNRDTLR  662
            L+ EV++L   L     EK+ I SKFEKL+ ICRSQRQEIQ+LK  L +        T +
Sbjct  474  LKDEVDRLNAALKQALEEKSVIASKFEKLTVICRSQRQEIQDLKSQLGSGAGKNTSPTQQ  533

Query  661  NQSSPKSQTFSTPPQQRETIEGTVWElqqgllnqsssSPDPSAWQAFADDGPKPLTTPPP  482
            + SS +++      Q  ET  GT+W+LQ+GL   S++    S+W AF D   +  +T PP
Sbjct  534  HSSSSRAKKLQAFEQGVETQGGTIWDLQEGLSTNSAN--QQSSWAAFEDPPKQVNSTRPP  591

Query  481  SNTPR----SMRTRNNQPPN------TQDSTAS-----AWGFGTDSFTAVPSATSQMNAS  347
               PR    S+   + + P+       QD  AS      W    +   +V +A       
Sbjct  592  QGNPRASTDSLFNSSGKIPDRKRSVRQQDVRASNPGGERWSMAQERSPSVGTA-------  644

Query  346  FSDRNNSQRFGDKRVD--NKSASQPAGWAGF  260
                     F   +V+      +QPAGWAGF
Sbjct  645  ---------FNGAKVEPPTNRMNQPAGWAGF  666



>emb|CBI24810.3| unnamed protein product [Vitis vinifera]
Length=1100

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 7/85 (8%)
 Frame = -3

Query  484   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
             P N  +S+RTRN   N+P     S    WGFGT SFTA P+A+S ++      NN   FG
Sbjct  932   PDNNSKSVRTRNGHHNKPATEATSGPETWGFGTQSFTATPAASSNISKPPVGGNNVHLFG  991

Query  313   D-KRVDNKSASQPAGWAGF*ASALC  242
             D K+++ K A QPA WA    SALC
Sbjct  992   DSKKIEGKLAPQPAEWA---VSALC  1013



>emb|CAN81086.1| hypothetical protein VITISV_027167 [Vitis vinifera]
Length=1756

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 46/78 (59%), Gaps = 4/78 (5%)
 Frame = -3

Query  484   PSNTPRSMRTRN---NQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFG  314
             P N  +S+RTRN   N+P     S    WGFGT SFTA P+A+S ++      NN   FG
Sbjct  1316  PDNNSKSVRTRNGHHNKPATEATSGPETWGFGTQSFTATPAASSNISKPPVGGNNVHLFG  1375

Query  313   D-KRVDNKSASQPAGWAG  263
             D K+++ K A QPA WAG
Sbjct  1376  DSKKIEGKLAPQPAEWAG  1393



>emb|CAN62110.1| hypothetical protein VITISV_038734 [Vitis vinifera]
Length=1625

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 51/165 (31%), Positives = 75/165 (45%), Gaps = 36/165 (22%)
 Frame = -3

Query  742   RSQRQEIQELKQALAAKTPSPNRDTLRNQSSPKSQTFSTPPQQRETIEGTVWElqqglln  563
             +++ ++I    + ++ +T SPN  TL     P S   +  P  R TI  TV         
Sbjct  1493  KAEAEDIMYKNRGISIET-SPNDGTL---CHPASSEIAAWPMXRLTIPSTV---------  1539

Query  562   qsssSPDPSAWQAFADDGPKPLTTPPPSNTPRSMRTRN---NQPPNTQDSTASAWGFGTD  392
                                K      P N  +S+RT+N   N+P     S    WGFGT+
Sbjct  1540  -------------------KQFLMRCPDNNSKSVRTQNGHHNKPATEGTSGPETWGFGTE  1580

Query  391   SFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSASQPAGWAGF  260
             SFTA P+A+S ++      NN+Q F D K+++ K A+QP  WAGF
Sbjct  1581  SFTATPAASSNISRPSIGGNNAQLFVDSKKIEGKLATQPVEWAGF  1625



>ref|XP_002972735.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
 gb|EFJ25956.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
Length=543

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  835  AEVEKLKEQLTHTNMEKAEITSKFEKLSAICRSQRQEIQELKQALAAKTPS  683
             E EKLK QL     EK E   K+EKL+AICRSQRQEI ELK ALAA T S
Sbjct  448  VETEKLKLQLKQALAEKTEFAGKYEKLTAICRSQRQEIHELKSALAAATVS  498



>emb|CAN65496.1| hypothetical protein VITISV_028322 [Vitis vinifera]
Length=1137

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 8/68 (12%)
 Frame = -3

Query  460   RTRNNQPPNTQDSTASAWGFGTDSFTAVPSATSQMNASFSDRNNSQRFGD-KRVDNKSAS  284
             R R N  P T       WGFGT+SF A P+A+S ++      NN+Q F D K+++ K A+
Sbjct  1077  RHRRNFCPET-------WGFGTESFRATPAASSNISRPSIGGNNAQLFVDSKKIEGKLAT  1129

Query  283   QPAGWAGF  260
             QP  WAGF
Sbjct  1130  QPTEWAGF  1137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1881220847521