BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5512

Length=885
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            369   1e-121   Nicotiana sylvestris
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            363   1e-119   Nicotiana tomentosiformis
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       353   9e-116   Solanum tuberosum [potatoes]
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            352   5e-115   Solanum lycopersicum
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                347   4e-113   Erythranthe guttata [common monkey flower]
emb|CDP02851.1|  unnamed protein product                                339   4e-110   Coffea canephora [robusta coffee]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            339   6e-110   Sesamum indicum [beniseed]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             323   8e-104   Prunus persica
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            323   1e-103   Vitis vinifera
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            322   2e-103   Prunus mume [ume]
emb|CAN75200.1|  hypothetical protein VITISV_014887                     323   3e-103   Vitis vinifera
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    322   4e-103   Theobroma cacao [chocolate]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            321   5e-103   Fragaria vesca subsp. vesca
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            320   2e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    319   6e-102   
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    317   2e-101   Citrus sinensis [apfelsine]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             316   4e-101   Citrus clementina [clementine]
gb|EPS71160.1|  hypothetical protein M569_03591                         314   7e-101   Genlisea aurea
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like       311   2e-100   Populus euphratica
ref|XP_002528403.1|  serine carboxypeptidase, putative                  312   2e-99    Ricinus communis
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    311   3e-99    Populus euphratica
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            311   3e-99    Pyrus x bretschneideri [bai li]
ref|XP_012071557.1|  PREDICTED: serine carboxypeptidase II-2-like       310   7e-99    Jatropha curcas
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       308   4e-98    Eucalyptus grandis [rose gum]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            309   4e-98    
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            308   4e-98    Eucalyptus grandis [rose gum]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    308   8e-98    Phoenix dactylifera
gb|AFK34001.1|  unknown                                                 299   1e-97    Medicago truncatula
emb|CBI36578.3|  unnamed protein product                                306   2e-97    Vitis vinifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            307   4e-97    Vitis vinifera
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             305   1e-96    Citrus clementina [clementine]
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            304   3e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       303   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         303   8e-96    Gossypium arboreum [tree cotton]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       302   1e-95    Setaria italica
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               302   1e-95    Medicago truncatula
gb|KEH38195.1|  serine carboxypeptidase-like protein                    301   2e-95    Medicago truncatula
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       301   2e-95    Medicago truncatula
gb|ACF84647.1|  unknown                                                 294   3e-95    Zea mays [maize]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            301   3e-95    Elaeis guineensis
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             301   4e-95    Phaseolus vulgaris [French bean]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       301   4e-95    Medicago truncatula
ref|NP_001057009.1|  Os06g0186400                                       301   6e-95    
gb|KHN02055.1|  Serine carboxypeptidase II-2                            298   4e-94    Glycine soja [wild soybean]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             298   5e-94    
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       298   6e-94    Glycine max [soybeans]
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       296   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT26558.1|  putative Serine carboxypeptidase II-2                   291   1e-92    
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          294   2e-92    Zea mays [maize]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    292   3e-92    Hordeum vulgare [barley]
dbj|BAJ99024.1|  predicted protein                                      293   4e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       293   7e-92    Oryza brachyantha
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            291   2e-91    Brachypodium distachyon [annual false brome]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    291   2e-91    Gossypium raimondii
dbj|BAK02147.1|  predicted protein                                      291   3e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006845388.1|  PREDICTED: serine carboxypeptidase II-2            290   5e-91    Amborella trichopoda
gb|ABK24285.1|  unknown                                                 288   1e-90    Picea sitchensis
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase II-2            288   3e-90    Cucumis sativus [cucumbers]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       288   3e-90    Cicer arietinum [garbanzo]
ref|XP_003596536.1|  Serine carboxypeptidase                            290   6e-90    
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like       282   8e-90    
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       289   9e-90    Cucumis sativus [cucumbers]
gb|AES66787.2|  serine carboxypeptidase-like protein                    286   1e-89    Medicago truncatula
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            286   1e-89    Cucumis melo [Oriental melon]
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         282   5e-88    
ref|XP_010525795.1|  PREDICTED: serine carboxypeptidase-like 29         272   2e-86    Tarenaya hassleriana [spider flower]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         278   2e-86    Tarenaya hassleriana [spider flower]
dbj|BAH20278.1|  AT4G30810                                              270   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         272   4e-84    Camelina sativa [gold-of-pleasure]
emb|CDY23258.1|  BnaA08g12880D                                          271   1e-83    Brassica napus [oilseed rape]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             271   2e-83    Eutrema salsugineum [saltwater cress]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       270   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         270   3e-83    Brassica rapa
ref|XP_010541227.1|  PREDICTED: serine carboxypeptidase-like 29         266   4e-83    
emb|CDY13387.1|  BnaA03g51050D                                          270   5e-83    Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          269   6e-83    Brassica napus [oilseed rape]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    268   3e-82    Arabis alpina [alpine rockcress]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         268   3e-82    Brassica rapa
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             268   3e-82    
emb|CDX72270.1|  BnaC07g42920D                                          271   9e-82    
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             266   1e-81    Capsella rubella
emb|CDX68696.1|  BnaC01g07570D                                          267   1e-81    
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               266   1e-81    Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    266   1e-81    
gb|ACF79757.1|  unknown                                                 265   1e-81    Zea mays [maize]
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          266   2e-81    Setaria italica
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         264   6e-81    
emb|CDY28216.1|  BnaA01g06330D                                          264   6e-81    Brassica napus [oilseed rape]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         265   8e-81    Camelina sativa [gold-of-pleasure]
ref|XP_006850617.1|  PREDICTED: serine carboxypeptidase-like 27         263   9e-81    Amborella trichopoda
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         264   9e-81    Brassica rapa
emb|CDY28217.1|  BnaA01g06320D                                          263   1e-80    Brassica napus [oilseed rape]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         261   4e-80    Nelumbo nucifera [Indian lotus]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         262   5e-80    Camelina sativa [gold-of-pleasure]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         261   8e-80    Sesamum indicum [beniseed]
dbj|BAO04184.1|  hypothetical protein                                   261   8e-80    Delphinium grandiflorum
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          260   1e-79    Sorghum bicolor [broomcorn]
emb|CDX68695.1|  BnaC01g07580D                                          261   1e-79    
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          260   1e-79    Sorghum bicolor [broomcorn]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         259   4e-79    Populus trichocarpa [western balsam poplar]
ref|XP_006645520.1|  PREDICTED: serine carboxypeptidase II-1-like       257   4e-79    Oryza brachyantha
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    259   6e-79    Setaria italica
ref|NP_001042076.1|  Os01g0158200                                       258   9e-79    
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         258   1e-78    Nelumbo nucifera [Indian lotus]
emb|CDO99730.1|  unnamed protein product                                258   1e-78    Coffea canephora [robusta coffee]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         258   1e-78    Populus euphratica
dbj|BAB08188.1|  unnamed protein product                                258   2e-78    Oryza sativa Japonica Group [Japonica rice]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    257   3e-78    Gossypium raimondii
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    257   3e-78    Glycine max [soybeans]
gb|EEC69980.1|  hypothetical protein OsI_00486                          256   5e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         256   5e-78    Pyrus x bretschneideri [bai li]
gb|ABK21145.1|  unknown                                                 252   6e-78    Picea sitchensis
emb|CAN74854.1|  hypothetical protein VITISV_028701                     256   6e-78    Vitis vinifera
ref|XP_012086498.1|  PREDICTED: serine carboxypeptidase-like 27         256   6e-78    Jatropha curcas
dbj|BAK06862.1|  predicted protein                                      248   6e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         256   7e-78    Populus euphratica
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         255   8e-78    Malus domestica [apple tree]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         255   9e-78    Beta vulgaris subsp. vulgaris [field beet]
gb|AFK43035.1|  unknown                                                 255   1e-77    Medicago truncatula
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               255   1e-77    Medicago truncatula
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         255   2e-77    Gossypium arboreum [tree cotton]
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         254   2e-77    Vitis vinifera
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             254   2e-77    Eutrema salsugineum [saltwater cress]
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         254   4e-77    Phoenix dactylifera
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             251   6e-77    
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         253   8e-77    Populus trichocarpa [western balsam poplar]
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         253   1e-76    Nicotiana sylvestris
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         253   1e-76    Nicotiana tomentosiformis
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         252   2e-76    Elaeis guineensis
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                251   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    252   2e-76    Glycine max [soybeans]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         251   3e-76    Glycine soja [wild soybean]
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         251   3e-76    Brachypodium distachyon [annual false brome]
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    252   4e-76    
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         251   5e-76    Brassica rapa
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    251   5e-76    Cicer arietinum [garbanzo]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               251   5e-76    Medicago truncatula
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         252   6e-76    Elaeis guineensis
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         251   6e-76    Prunus mume [ume]
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               250   8e-76    
emb|CDY32091.1|  BnaC04g44750D                                          250   8e-76    Brassica napus [oilseed rape]
emb|CDY40438.1|  BnaA04g20790D                                          250   8e-76    Brassica napus [oilseed rape]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             250   9e-76    Phaseolus vulgaris [French bean]
gb|KJB76568.1|  hypothetical protein B456_012G094900                    245   9e-76    Gossypium raimondii
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          250   1e-75    Brachypodium distachyon [annual false brome]
dbj|BAJ99174.1|  predicted protein                                      249   1e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA53383.1|  TPA: hypothetical protein ZEAMMB73_784297              246   1e-75    
ref|NP_001044713.1|  Os01g0833500                                       249   2e-75    
gb|EAY76388.1|  hypothetical protein OsI_04319                          249   2e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         250   2e-75    Elaeis guineensis
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    249   2e-75    Solanum tuberosum [potatoes]
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    249   2e-75    Phoenix dactylifera
ref|XP_003560871.1|  PREDICTED: serine carboxypeptidase 2-like          249   3e-75    Brachypodium distachyon [annual false brome]
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         249   3e-75    Cucumis melo [Oriental melon]
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         249   4e-75    Triticum urartu
gb|EMT21139.1|  putative Serine carboxypeptidase II-1                   246   8e-75    
ref|XP_006644961.1|  PREDICTED: serine carboxypeptidase-like 27-like    247   1e-74    Oryza brachyantha
ref|XP_008649461.1|  PREDICTED: serine carboxypeptidase 2-like is...    248   1e-74    Zea mays [maize]
sp|P55747.1|CBP21_HORVU  RecName: Full=Serine carboxypeptidase II...    243   1e-74    Hordeum vulgare [barley]
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          248   2e-74    Sorghum bicolor [broomcorn]
gb|EMS66624.1|  Serine carboxypeptidase II-1                            244   2e-74    Triticum urartu
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         247   2e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         246   2e-74    Gossypium arboreum [tree cotton]
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         247   2e-74    Pyrus x bretschneideri [bai li]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27         246   2e-74    Cucumis sativus [cucumbers]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         246   2e-74    Solanum lycopersicum
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            247   3e-74    
gb|KJB76563.1|  hypothetical protein B456_012G094900                    246   3e-74    Gossypium raimondii
gb|KJB76569.1|  hypothetical protein B456_012G094900                    246   3e-74    Gossypium raimondii
ref|XP_006655142.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    246   4e-74    
gb|AAV43957.1|  putative serine carboxypeptidase II                     246   5e-74    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   246   6e-74    
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    246   6e-74    
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          246   6e-74    Zea mays [maize]
emb|CDM82001.1|  unnamed protein product                                245   7e-74    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         245   7e-74    
ref|XP_008649460.1|  PREDICTED: serine carboxypeptidase 2-like is...    246   7e-74    Zea mays [maize]
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         246   8e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    245   8e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             245   8e-74    Citrus clementina [clementine]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   244   1e-73    Citrus sinensis [apfelsine]
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         244   2e-73    Fragaria vesca subsp. vesca
gb|AIN39846.1|  hypothetical protein                                    234   2e-73    Zoysia matrella [Japanese carpet grass]
gb|EMT12249.1|  Serine carboxypeptidase 2                               244   2e-73    
dbj|BAK02399.1|  predicted protein                                      243   4e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU19747.1|  unknown                                                 238   5e-73    Glycine max [soybeans]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     243   8e-73    Eucalyptus grandis [rose gum]
ref|NP_001151874.1|  LOC100285510 precursor                             242   1e-72    
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 242   1e-72    
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          242   1e-72    Sorghum bicolor [broomcorn]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          241   2e-72    Arabidopsis lyrata subsp. petraea
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    241   2e-72    Setaria italica
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         243   3e-72    Eucalyptus grandis [rose gum]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         241   4e-72    Tarenaya hassleriana [spider flower]
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             240   6e-72    
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    240   7e-72    Arabis alpina [alpine rockcress]
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             240   8e-72    Eutrema salsugineum [saltwater cress]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    240   1e-71    Glycine max [soybeans]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         239   1e-71    Camelina sativa [gold-of-pleasure]
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         240   1e-71    Glycine soja [wild soybean]
ref|XP_004962519.1|  PREDICTED: serine carboxypeptidase 2-like          240   1e-71    Setaria italica
emb|CDY35977.1|  BnaA05g29730D                                          239   1e-71    Brassica napus [oilseed rape]
emb|CAI64396.1|  serine carboxypeptidase II                             233   2e-71    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    239   2e-71    
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         239   2e-71    Camelina sativa [gold-of-pleasure]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         238   2e-71    Camelina sativa [gold-of-pleasure]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          241   3e-71    
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    239   3e-71    Brassica rapa
emb|CDY28004.1|  BnaC05g44060D                                          238   3e-71    Brassica napus [oilseed rape]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             238   4e-71    Capsella rubella
emb|CDP11023.1|  unnamed protein product                                239   5e-71    Coffea canephora [robusta coffee]
gb|AES62200.2|  serine carboxypeptidase-like protein                    239   5e-71    Medicago truncatula
ref|NP_187456.1|  serine carboxypeptidase-like 27                       238   6e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             238   7e-71    
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             237   1e-70    Arabidopsis lyrata subsp. lyrata
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         236   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         236   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         235   4e-70    Camelina sativa [gold-of-pleasure]
sp|P08819.2|CBP2_WHEAT  RecName: Full=Serine carboxypeptidase 2; ...    234   7e-70    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010527107.1|  PREDICTED: serine carboxypeptidase-like 29         226   1e-69    Tarenaya hassleriana [spider flower]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    231   1e-68    Arabis alpina [alpine rockcress]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       231   1e-68    Arabidopsis thaliana [mouse-ear cress]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    230   8e-68    Gossypium raimondii
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    227   5e-67    
emb|CAA70815.1|  serine carboxypeptidase II, CP-MII                     228   5e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P08818.2|CBP2_HORVU  RecName: Full=Serine carboxypeptidase 2; ...    226   2e-66    Hordeum vulgare [barley]
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         218   1e-65    Jatropha curcas
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          224   2e-65    
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    223   3e-65    Fragaria vesca subsp. vesca
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         219   5e-65    
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    222   5e-65    Glycine max [soybeans]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    221   9e-65    Fragaria vesca subsp. vesca
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             219   1e-64    Phaseolus vulgaris [French bean]
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  218   3e-64    Citrus sinensis [apfelsine]
gb|KHN42831.1|  Serine carboxypeptidase 24                              220   4e-64    Glycine soja [wild soybean]
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         220   4e-64    Glycine max [soybeans]
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          219   6e-64    
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             219   8e-64    Citrus clementina [clementine]
ref|XP_010656616.1|  PREDICTED: serine carboxypeptidase 24 isofor...    217   8e-64    
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         219   1e-63    Citrus sinensis [apfelsine]
ref|XP_002451122.1|  hypothetical protein SORBIDRAFT_05g024440          219   1e-63    Sorghum bicolor [broomcorn]
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    219   1e-63    
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         221   2e-63    
ref|XP_012071521.1|  PREDICTED: serine carboxypeptidase 24 isofor...    218   2e-63    Jatropha curcas
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              218   3e-63    Pyrus x bretschneideri [bai li]
emb|CAN79972.1|  hypothetical protein VITISV_010072                     217   4e-63    Vitis vinifera
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    216   5e-63    Nelumbo nucifera [Indian lotus]
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    217   6e-63    Vitis vinifera
gb|EMT08964.1|  Serine carboxypeptidase 2                               214   1e-62    
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    216   1e-62    Nelumbo nucifera [Indian lotus]
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    216   2e-62    Arabis alpina [alpine rockcress]
emb|CDY39224.1|  BnaA03g50360D                                          216   2e-62    Brassica napus [oilseed rape]
ref|XP_010942076.1|  PREDICTED: serine carboxypeptidase 24 isofor...    213   2e-62    Elaeis guineensis
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         209   2e-62    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         215   2e-62    Nelumbo nucifera [Indian lotus]
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             216   2e-62    Capsella rubella
gb|KJB75608.1|  hypothetical protein B456_012G048700                    216   2e-62    Gossypium raimondii
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              215   3e-62    Brassica rapa
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           215   4e-62    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194790.1|  serine carboxypeptidase 24                            215   4e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         215   4e-62    Gossypium arboreum [tree cotton]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              215   5e-62    Fragaria vesca subsp. vesca
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    213   5e-62    Populus euphratica
ref|XP_002529402.1|  serine carboxypeptidase, putative                  214   6e-62    Ricinus communis
emb|CDP02317.1|  unnamed protein product                                214   6e-62    Coffea canephora [robusta coffee]
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          212   7e-62    
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             214   9e-62    Eutrema salsugineum [saltwater cress]
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         214   9e-62    Solanum lycopersicum
ref|XP_011653364.1|  PREDICTED: serine carboxypeptidase-like 25 i...    212   1e-61    Cucumis sativus [cucumbers]
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    214   1e-61    Arabis alpina [alpine rockcress]
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         214   1e-61    Fragaria vesca subsp. vesca
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             213   1e-61    
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    211   1e-61    Cucumis melo [Oriental melon]
pdb|1BCR|B  Chain B, Complex Of The Wheat Serine Carboxypeptidase...    204   2e-61    Triticum aestivum [Canadian hard winter wheat]
emb|CBI21207.3|  unnamed protein product                                213   2e-61    Vitis vinifera
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         213   2e-61    Vitis vinifera
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              213   2e-61    Tarenaya hassleriana [spider flower]
pdb|1WHT|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    203   2e-61    Triticum aestivum [Canadian hard winter wheat]
pdb|3SC2|B  Chain B, Refined Atomic Model Of Wheat Serine Carboxy...    203   2e-61    unidentified
pdb|1WHS|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    203   2e-61    
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     211   2e-61    
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    213   3e-61    
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             208   3e-61    
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             213   3e-61    
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    213   3e-61    
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              212   4e-61    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    212   4e-61    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25 i...    212   4e-61    
ref|XP_012084825.1|  PREDICTED: serine carboxypeptidase-like 25         212   5e-61    
ref|XP_006404896.1|  hypothetical protein EUTSA_v10000274mg             206   7e-61    
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         211   7e-61    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    211   7e-61    
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              210   8e-61    
emb|CDX76845.1|  BnaC08g34310D                                          211   8e-61    
ref|XP_010108549.1|  Serine carboxypeptidase 24                         212   9e-61    
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         211   9e-61    
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    210   9e-61    
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   211   9e-61    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          213   1e-60    
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         211   1e-60    
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    211   1e-60    
gb|KJB07561.1|  hypothetical protein B456_001G032600                    209   2e-60    
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             211   2e-60    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         210   2e-60    
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              210   2e-60    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    210   2e-60    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         210   2e-60    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         211   2e-60    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             210   2e-60    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             210   3e-60    
emb|CDY34805.1|  BnaA09g41720D                                          211   3e-60    
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         210   3e-60    
gb|ACF87497.1|  unknown                                                 205   3e-60    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             210   3e-60    
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         210   3e-60    
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             210   4e-60    
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    209   4e-60    
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    210   4e-60    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         209   4e-60    
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    210   4e-60    
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         209   5e-60    
ref|XP_011623958.1|  PREDICTED: serine carboxypeptidase-like 25 i...    209   5e-60    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         209   5e-60    
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    209   5e-60    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         209   5e-60    
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    209   6e-60    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         209   6e-60    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             209   6e-60    
ref|XP_011083950.1|  PREDICTED: serine carboxypeptidase 24-like i...    207   6e-60    
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    209   6e-60    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                209   7e-60    
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         209   7e-60    
gb|KJB07559.1|  hypothetical protein B456_001G032600                    209   7e-60    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    209   7e-60    
gb|KJB07564.1|  hypothetical protein B456_001G032600                    209   8e-60    
ref|NP_001077950.1|  serine carboxypeptidase-like 22                    207   9e-60    
gb|KJB07563.1|  hypothetical protein B456_001G032600                    209   9e-60    
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             209   1e-59    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    208   1e-59    
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             208   1e-59    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         208   1e-59    
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         208   1e-59    
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    208   2e-59    
emb|CDP10248.1|  unnamed protein product                                208   2e-59    
gb|AAM65698.1|  putative serine carboxypeptidase II                     208   2e-59    
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24              208   2e-59    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       208   2e-59    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          208   2e-59    
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         207   2e-59    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    207   3e-59    
gb|AAC63669.1|  putative serine carboxypeptidase II                     206   3e-59    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         207   3e-59    
ref|NP_179978.2|  serine carboxypeptidase-like 22                       207   3e-59    
gb|EPS67928.1|  hypothetical protein M569_06845                         207   3e-59    
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         207   4e-59    
ref|NP_179979.4|  serine carboxypeptidase-like 23                       206   4e-59    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         206   4e-59    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    207   5e-59    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         207   5e-59    
gb|AAC63668.1|  putative serine carboxypeptidase II                     207   5e-59    
ref|XP_002527614.1|  serine carboxypeptidase, putative                  206   5e-59    
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    206   5e-59    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         207   6e-59    
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             206   7e-59    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         206   9e-59    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    206   9e-59    
ref|XP_002325127.2|  BRI1 SUPPRESSOR 1 family protein                   205   1e-58    
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         206   1e-58    
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   1e-58    
dbj|BAD19262.1|  putative carboxypeptidase D                            203   2e-58    
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    205   2e-58    
ref|XP_004979757.1|  PREDICTED: p-(S)-hydroxymandelonitrile lyase...    206   2e-58    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   2e-58    
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             205   2e-58    
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             204   2e-58    
gb|AFK37459.1|  unknown                                                 205   2e-58    
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         205   2e-58    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         205   3e-58    
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         204   3e-58    
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    204   3e-58    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          205   4e-58    
gb|ERN07055.1|  hypothetical protein AMTR_s00019p00043630               204   4e-58    
emb|CDO99728.1|  unnamed protein product                                204   4e-58    
ref|XP_006845845.1|  PREDICTED: serine carboxypeptidase-like 25 i...    204   4e-58    
ref|XP_006845380.2|  PREDICTED: serine carboxypeptidase 24              204   4e-58    
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    204   5e-58    
gb|ERN03395.1|  hypothetical protein AMTR_s00003p00256450               202   5e-58    
prf||1408163B  CPase II B                                               195   5e-58 
ref|XP_011623955.1|  PREDICTED: serine carboxypeptidase-like 25 i...    204   6e-58    
gb|EAY87844.1|  hypothetical protein OsI_09265                          204   7e-58    
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    204   7e-58    
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    204   7e-58    
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                204   8e-58    
ref|XP_011623957.1|  PREDICTED: serine carboxypeptidase-like 25 i...    203   9e-58    
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    204   9e-58    
ref|NP_001048377.1|  Os02g0794500                                       203   1e-57    
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         201   1e-57    
dbj|BAJ85578.1|  predicted protein                                      203   2e-57    
ref|XP_011623956.1|  PREDICTED: serine carboxypeptidase-like 25 i...    202   2e-57    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    202   2e-57    
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         202   2e-57    
ref|NP_001150705.1|  LOC100284338 precursor                             202   3e-57    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              202   3e-57    
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         202   3e-57    
dbj|BAJ92218.1|  predicted protein                                      203   4e-57    
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    202   5e-57    
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    201   5e-57    
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         201   8e-57    
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                201   8e-57    
emb|CDY43258.1|  BnaC05g48510D                                          201   9e-57    
ref|XP_011622397.1|  PREDICTED: serine carboxypeptidase-like 31         200   1e-56    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         201   1e-56    
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               200   2e-56    
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                199   2e-56    
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             200   2e-56    
gb|EPS59460.1|  hypothetical protein M569_15347                         193   3e-56    
emb|CBI31484.3|  unnamed protein product                                199   4e-56    
ref|XP_012086520.1|  PREDICTED: serine carboxypeptidase-like 28         199   4e-56    
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         199   5e-56    
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         198   8e-56    
ref|XP_001772135.1|  predicted protein                                  197   2e-55    
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    197   2e-55    
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         197   3e-55    
ref|NP_001145702.1|  hypothetical protein                               194   3e-55    
gb|KJB78939.1|  hypothetical protein B456_013G026200                    195   6e-55    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    196   6e-55    
gb|AFK36150.1|  unknown                                                 190   6e-55    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    196   8e-55    
ref|NP_001152245.1|  lysosomal protective protein precursor             196   8e-55    
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         196   1e-54    
gb|EPS66906.1|  hypothetical protein M569_07869                         194   1e-54    
ref|XP_001785856.1|  predicted protein                                  195   1e-54    
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  190   1e-54    
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    194   2e-54    
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    195   2e-54    
dbj|BAD25095.1|  putative carboxypeptidase D                            191   2e-54    
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34         194   3e-54    
gb|ACU21427.1|  unknown                                                 188   3e-54    
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         194   3e-54    
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         185   3e-54    
ref|XP_011022271.1|  PREDICTED: serine carboxypeptidase-like 34         194   3e-54    
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             194   3e-54    
gb|KJB78942.1|  hypothetical protein B456_013G026200                    193   4e-54    
gb|EMS64875.1|  Serine carboxypeptidase 24                              193   4e-54    
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          194   4e-54    
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         194   5e-54    
ref|XP_001755195.1|  predicted protein                                  192   5e-54    
emb|CDY65614.1|  BnaCnng47980D                                          189   5e-54    
gb|KCW76300.1|  hypothetical protein EUGRSUZ_D00674                     187   6e-54    
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         194   6e-54    
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         193   9e-54    
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         192   1e-53    
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    192   1e-53    
ref|XP_001765233.1|  predicted protein                                  191   2e-53    
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    192   2e-53    
ref|NP_001047514.1|  Os02g0634700                                       192   3e-53    
gb|EEC73659.1|  hypothetical protein OsI_08191                          192   3e-53    
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         192   3e-53    
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         187   4e-53    
gb|EMT14017.1|  Serine carboxypeptidase-like 34                         189   5e-53    
ref|XP_009401001.1|  PREDICTED: serine carboxypeptidase-like 34         191   7e-53    
gb|KEH30582.1|  serine carboxypeptidase-like protein                    190   9e-53    
ref|XP_002962533.1|  serine carboxypeptidase-like enzyme                191   9e-53    
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             191   1e-52    
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    191   1e-52    
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    189   2e-52    
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               189   2e-52    
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         189   3e-52    
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         189   3e-52    
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    189   4e-52    
gb|ABR16596.1|  unknown                                                 190   4e-52    
emb|CDX72256.1|  BnaC07g42780D                                          192   4e-52    
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    189   4e-52    
ref|XP_008803196.1|  PREDICTED: serine carboxypeptidase-like 34         187   4e-52    
emb|CDY46950.1|  BnaA02g32960D                                          189   4e-52    
ref|XP_010052354.1|  PREDICTED: serine carboxypeptidase-like 31         189   5e-52    
gb|AFK45951.1|  unknown                                                 182   5e-52    
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         187   5e-52    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    188   5e-52    
ref|XP_007131611.1|  hypothetical protein PHAVU_011G027900g             185   5e-52    
gb|KJB76566.1|  hypothetical protein B456_012G094900                    188   6e-52    
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    186   6e-52    
emb|CAA58876.1|  p-(S)-hydroxymandelonitrile lyase                      186   6e-52    
gb|KHG11032.1|  Serine carboxypeptidase-like 28                         182   7e-52    
emb|CDY40802.1|  BnaC02g41710D                                          189   8e-52    
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    188   8e-52    
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    188   8e-52    
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    188   8e-52    
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             188   1e-51    
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    187   1e-51    
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          187   1e-51    
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    188   1e-51    
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    187   1e-51    
ref|XP_007043282.1|  Serine carboxypeptidase-like 34 isoform 2          184   1e-51    
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             187   1e-51    
emb|CAN70886.1|  hypothetical protein VITISV_009829                     185   2e-51    
ref|XP_006426220.1|  hypothetical protein CICLE_v10027439mg             181   2e-51    
ref|XP_011460258.1|  PREDICTED: serine carboxypeptidase-like 31         187   2e-51    
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         187   2e-51    
ref|XP_010067797.1|  PREDICTED: serine carboxypeptidase-like 40 i...    184   2e-51    



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 196/221 (89%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N LCDYQSFI PSE+C+K+LD A++E+G+ID+YSIFTPTCT  FS+++ +LKR +R VG 
Sbjct  251  NALCDYQSFIRPSEQCDKILDQANEEVGNIDSYSIFTPTCTAKFSMLNHLLKRSNR-VGH  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE+HS IYFNLPEVQ+ALHVH  NSSF+WV CS+EV   WKD P TVLDVY+
Sbjct  310  LRRSYDPCTEQHSVIYFNLPEVQEALHVHKRNSSFKWVACSEEVSSGWKDSPKTVLDVYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT+SPWR WYD+GQVGGWTQEY+GLT
Sbjct  370  ELIQSGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTISPWRAWYDDGQVGGWTQEYKGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEVALHRPK ALTLV+SFLAG SMP LQ+ISDS
Sbjct  430  FVTVRGAGHEVALHRPKQALTLVKSFLAGASMPSLQQISDS  470



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 194/221 (88%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N LCDYQSFI PSE+C+K+LD A++E+G+ID YSIFT TCT  FSI++ +LKR +R VG 
Sbjct  251  NALCDYQSFIRPSEQCDKILDQANEEVGNIDFYSIFTQTCTAKFSILNHLLKRSNR-VGH  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE+HS IYFNLPEVQ+ALHVH  NSSF+WV CSDEV   WKD P TVLDVY+
Sbjct  310  LRRSYDPCTEQHSVIYFNLPEVQEALHVHKRNSSFKWVACSDEVSSGWKDSPKTVLDVYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV+PWR WYD+GQVGGWTQEY+GLT
Sbjct  370  ELIRSGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEVALHRPK ALTLV+SFLAG+SMP L+ ISDS
Sbjct  430  FVTVRGAGHEVALHRPKQALTLVKSFLAGSSMPSLELISDS  470



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   353 bits (907),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 191/221 (86%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N LC  QS++ PSE+C+K+LD A++E+G+ID+YSIFTP CT  FSI++ +L R+   +G 
Sbjct  246  NALCHDQSYLRPSEQCDKILDQANEEIGNIDSYSIFTPACTAKFSILNHLL-RKSNSIGH  304

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE+HS IYFNLPEVQ ALHVH  NSSF+WVTCS+EV   WKD P +VLDVY+
Sbjct  305  LRRSYDPCTEQHSKIYFNLPEVQNALHVHKRNSSFKWVTCSEEVSSGWKDSPMSVLDVYR  364

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV+PWR WYD+GQVGGWTQEY+GLT
Sbjct  365  ELIKSGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLT  424

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEVALHRPK ALTLV+SFLAGTSMP L+ ISDS
Sbjct  425  FVTVRGAGHEVALHRPKQALTLVKSFLAGTSMPSLELISDS  465



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 190/221 (86%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N LC  QS+  PSE+C+K+L+ A++E+G+ID+YSIFTP CT  FSI++ +L R+   VG 
Sbjct  246  NALCHDQSYFRPSEQCDKILEQANEEIGNIDSYSIFTPACTAKFSILNHLL-RKSNSVGH  304

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE+HS IYFNLPEVQ ALHVH  NSSF+WVTCS+EV   WKD P TVLDVY+
Sbjct  305  LRRSYDPCTEQHSKIYFNLPEVQSALHVHMRNSSFKWVTCSEEVSSGWKDSPNTVLDVYR  364

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIWVFSGDTDAVIPVTSTRYSI+ALKLPTV+PWR WYD+GQVGGWTQEY+GLT
Sbjct  365  ELIKSGLRIWVFSGDTDAVIPVTSTRYSINALKLPTVAPWRAWYDDGQVGGWTQEYKGLT  424

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEVALHRPK ALTLV+SFLAGTSMP L+ ISDS
Sbjct  425  FVTVRGAGHEVALHRPKQALTLVKSFLAGTSMPSLELISDS  465



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD+QSFIH +E+C+  LD A +E+GDID YSIFTP CT + + +SR L R+  KVGL
Sbjct  257  NILCDFQSFIHANEQCDNALDLAYEEVGDIDMYSIFTPACTANSTSLSR-LSRKKSKVGL  315

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE HST+YFNLPEVQKALHVHT NSS +W TCS+ V + W+D P +VL+VY+
Sbjct  316  LRRAYDPCTEEHSTVYFNLPEVQKALHVHTRNSSLKWETCSNTVNENWQDSPKSVLNVYR  375

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLR+W+FSGDTDAVIPVTSTRY+IDALKLPTVSPWR WYD+GQVGGWTQEY+GLT
Sbjct  376  ELIHSGLRVWIFSGDTDAVIPVTSTRYNIDALKLPTVSPWRAWYDDGQVGGWTQEYKGLT  435

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK ALTLV+SFL+G SMP L+ +SDS
Sbjct  436  FVTVRGAGHEVPLHRPKQALTLVKSFLSGISMPKLELVSDS  476



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD  SFI P E C K+LD A  E+G+ID YS+FTP CT +FS+M++ LKRR+ KVG 
Sbjct  253  NIFCDLDSFILPKESCGKILDIADKEIGNIDQYSVFTPACTANFSVMNQFLKRRN-KVGH  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE+HST+YFNLP+VQ ALHV+  ++SF+W TCSD+VY+ WKD P +VL++Y 
Sbjct  312  LRRAYDPCTEQHSTVYFNLPKVQHALHVYNRSNSFKWATCSDDVYNNWKDSPRSVLNIYH  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            EL+ AG+RIWVFSGDTDAV+PVTSTRYS+DALKL TV PWRPWYD+GQVGGWTQ+YEGL 
Sbjct  372  ELLNAGIRIWVFSGDTDAVLPVTSTRYSLDALKLRTVGPWRPWYDDGQVGGWTQQYEGLN  431

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK ALTL +SF++G S+P L++ISDS
Sbjct  432  FVTVRGAGHEVPLHRPKQALTLFKSFISGNSLPQLEQISDS  472



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   339 bits (869),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD+QSFIH SE C K L  A +E+GDID YSIFTP CT +FS +S   KR +RKVGL
Sbjct  254  NVLCDFQSFIHASERCEKALGNADEEIGDIDMYSIFTPPCTANFSRLSHPWKR-NRKVGL  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTERHST+YFNLPEVQ A+HVH+ NS  +W TCSD V + WKD P +VL+VY+
Sbjct  313  LRRAYDPCTERHSTVYFNLPEVQNAIHVHSKNSPLKWETCSDAVNENWKDSPRSVLNVYR  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            EL+ +G+RIW+FSGDTDAVIPVTSTRYSIDALKLPTVSPWR WY D+GQVGGWTQEYEGL
Sbjct  373  ELLHSGIRIWIFSGDTDAVIPVTSTRYSIDALKLPTVSPWRAWYDDDGQVGGWTQEYEGL  432

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISD  225
            TFV VRGAGHEV LH+PK ALTL++S+L+G SMP L+ +SD
Sbjct  433  TFVTVRGAGHEVPLHKPKQALTLIKSYLSGNSMPKLELVSD  473



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   323 bits (828),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSFIH S  C+ +LD AS ELG+ID YSI+T  C  + S  +R+LKR   KVG 
Sbjct  254  NLLCDFQSFIHTSNSCDNILDIASAELGNIDPYSIYTLACPANVSQSNRLLKRM-HKVGR  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HS +YFNLPEVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+
Sbjct  313  ISEKYDPCTEAHSVVYFNLPEVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYK  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGDTD+VIPVTSTRYSIDALKLPTV PWRPWYD+GQVGGWTQEY GLT
Sbjct  373  ELIHSGLRIWMFSGDTDSVIPVTSTRYSIDALKLPTVKPWRPWYDDGQVGGWTQEYAGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LH+PK ALTL+++FL+G+SMP  + +SDS
Sbjct  433  FVSVRGAGHEVPLHKPKQALTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD+Q FIH S  C+K++D AS+E+G++D YSIFTP C+      ++++KR  R VG 
Sbjct  250  NVFCDFQPFIHSSASCDKIMDIASEEMGNVDPYSIFTPPCSVKVGFSNQLMKRLIR-VGR  308

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +Y+NLPEVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+
Sbjct  309  ISERYDPCTEQHSVVYYNLPEVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYR  368

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIW+FSGDTDA+IPVTSTRYS+DALKLPTV PWR WYD+GQVGGW+QEY GLT
Sbjct  369  ELIHAGLRIWIFSGDTDAIIPVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLT  428

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK ALTL+ +FL GTSMP L++++DS
Sbjct  429  FVTVRGAGHEVPLHKPKQALTLINAFLKGTSMPSLEQLADS  469



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSFIH S  C+ +LD AS ELG+ID YSI+TP C  + S  +R L+++  KVG 
Sbjct  254  NLLCDFQSFIHTSNSCDNILDIASAELGNIDPYSIYTPACPANVSQSNR-LQKQMHKVGR  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HS +YFNLPEVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+
Sbjct  313  ISEKYDPCTEAHSVVYFNLPEVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYK  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGDTD+VIPVTSTRYSIDALKLPTV PWRPWY++GQVGGWTQEY GLT
Sbjct  373  ELIHSGLRIWMFSGDTDSVIPVTSTRYSIDALKLPTVKPWRPWYEDGQVGGWTQEYAGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LH+PK ALTL+++FL+G+SMP  + +SDS
Sbjct  433  FVSVRGAGHEVPLHKPKQALTLIKAFLSGSSMPSSELVSDS  473



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD+Q FIH S  C+K++D AS+E+G++D YSIFTP C+      ++++KR  R VG 
Sbjct  305  NVFCDFQPFIHSSASCDKIMDIASEEMGNVDPYSIFTPPCSVKVGFSNQLMKRLIR-VGR  363

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +Y+NLPEVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+
Sbjct  364  ISERYDPCTEQHSVVYYNLPEVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYR  423

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIW+FSGDTDA+IPVTSTRYS+DALKLPTV PWR WYD+GQVGGW+QEY GLT
Sbjct  424  ELIHAGLRIWIFSGDTDAIIPVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLT  483

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK ALTL+ +FL GTSMP L++++DS
Sbjct  484  FVTVRGAGHEVPLHKPKQALTLINAFLKGTSMPSLEQLADS  524



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 181/221 (82%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD++SF+H S  C+K+++ AS+ELG+ID YSIFTP C+ + S    +LKRR R VG 
Sbjct  257  NVLCDFESFVHSSSSCDKIMEVASEELGNIDPYSIFTPPCSANVSQSKWLLKRRLR-VGQ  315

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNLPEVQKALHV    +  +W TCSD V   WKD P T+LDVY+
Sbjct  316  VSDKYDPCTEKHSEVYFNLPEVQKALHVLPEVAPSKWETCSDIVSTNWKDSPRTMLDVYR  375

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSGD DAVIPVTSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GL 
Sbjct  376  ELIHVGLRIWIFSGDADAVIPVTSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLN  435

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LHRPKLALTLV++FL+GTSMPGL+++SDS
Sbjct  436  FVSVRGAGHEVPLHRPKLALTLVKAFLSGTSMPGLEQVSDS  476



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 178/221 (81%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL CD+QSFIH S  C+ +LD AS ELG+ID YSI+TP+C  + S  +R+LKR     G 
Sbjct  251  NLFCDFQSFIHTSNSCDSILDIASAELGNIDPYSIYTPSCPANVSQSNRLLKRM-HVAGR  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+H+ +YFNLPEVQKALHV   ++  +W TCSD VY  WKD P TVLDVY+
Sbjct  310  INEKYDPCTEKHTVVYFNLPEVQKALHVDRHHAPSKWETCSDVVYTTWKDSPRTVLDVYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGDTDAVIPVTSTRYSID+LKLPTV PWR WYD GQVGGWTQEY GLT
Sbjct  370  ELIHSGLRIWMFSGDTDAVIPVTSTRYSIDSLKLPTVKPWRAWYDEGQVGGWTQEYAGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LH+PKLAL L+++FL+G+SMP LQ +SDS
Sbjct  430  FVSVRGAGHEVPLHKPKLALALIKNFLSGSSMPSLQLVSDS  470



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 178/221 (81%), Gaps = 2/221 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL CD+QSFIH S++C  +L+ A++E+G+ID YSIFTPTCT + S+  R++KR   + G 
Sbjct  267  NLFCDFQSFIHTSKQCENILEIANNEIGNIDLYSIFTPTCTSNSSLSHRLMKRL--RAGR  324

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNLPEVQKALHVH   +  +W TCSD V + WKD P TVLD+Y 
Sbjct  325  ISEKYDPCTEKHSTVYFNLPEVQKALHVHPEVAPTKWETCSDVVNENWKDSPKTVLDIYH  384

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIW+FSGDTDAVIPVTSTRYSIDALKLPT+ PWR WYD GQVGGWTQ+Y GL 
Sbjct  385  ELIGAGLRIWIFSGDTDAVIPVTSTRYSIDALKLPTIGPWRAWYDEGQVGGWTQQYVGLN  444

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LH+PKLAL+L+++FL+G  MP L   SDS
Sbjct  445  FVSVRGAGHEVPLHKPKLALSLIKAFLSGRQMPTLTEYSDS  485



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSF+H S  C+K+LD AS+ELG+ID YSI+TP C  + S  +++LKR    VG 
Sbjct  276  NLLCDFQSFVHTSNSCDKILDIASEELGNIDPYSIYTPPCHANDSQSNQLLKRM-HMVGR  334

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + + YDPCTE+HST+YFN PEVQ+ALHV   ++  +W TCSD VY  WKD PTTVLD+Y 
Sbjct  335  ISQKYDPCTEKHSTVYFNQPEVQRALHVDPDHAPSKWDTCSDLVYSTWKDSPTTVLDIYH  394

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI + LRIWVFSGDTDAVIP+TSTRYSIDALKLPTV PWR WYD+G+VGGWTQEYEGLT
Sbjct  395  ELIHSSLRIWVFSGDTDAVIPITSTRYSIDALKLPTVCPWRAWYDDGEVGGWTQEYEGLT  454

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LH+PK ALTL++SFL+G  MP L  +SDS
Sbjct  455  FVSVRGAGHEVPLHKPKQALTLIKSFLSGLPMPNLNLVSDS  495



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 175/221 (79%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCDY+SF+HPS  C+KVLD A +ELG+ID YSIFTP+CT S S  +R+LKR    VG 
Sbjct  253  NLLCDYESFVHPSSSCDKVLDVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGH  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
                YDPCTE+HS +YFN PEVQKALHV    +  +W TCS  V + W D P TVLD+Y+
Sbjct  312  PSEKYDPCTEKHSVVYFNQPEVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYR  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR WYD GQVGGWTQEY GLT
Sbjct  372  ELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDEGQVGGWTQEYSGLT  431

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  432  FVTVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLKRVSHS  472



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 176/221 (80%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCDY+SF+HPS  C+KVL+ A +ELG+ID YSIFTP+CT S S  +R+LKR    VG 
Sbjct  253  NLLCDYESFVHPSSSCDKVLEVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGH  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
                YDPCTE+HS +YFN PEVQKALHV    +  +W TCS  V + W D P TVLD+Y+
Sbjct  312  ASEKYDPCTEKHSVVYFNQPEVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYR  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY GLT
Sbjct  372  ELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLT  431

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  432  FVTVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  472



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   314 bits (805),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 177/216 (82%), Gaps = 2/216 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSF+HPS+ C + LD A DE+GDID YSIFTP C  +FS  +R+ +++  + G+
Sbjct  227  NLLCDFQSFVHPSDRCEEALDDAYDEIGDIDMYSIFTPPCRTNFSRPNRLDRKKVCRFGI  286

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LRR YDPCTE HST YFNLPEVQ ALH+ + NS  +W TCSD V + WKD P++VL+VY+
Sbjct  287  LRRQYDPCTEEHSTAYFNLPEVQDALHIRSKNS--QWETCSDLVNENWKDSPSSVLNVYR  344

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            +L  AGLRIW FSGDTD+VIPV STRYSI+AL+LPTVSPWR WY++GQVGGWT+EYEGLT
Sbjct  345  KLFPAGLRIWFFSGDTDSVIPVASTRYSINALRLPTVSPWRAWYNDGQVGGWTEEYEGLT  404

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
             V VRGAGHEVALH+PKL+LTLV+SFL G  MP L+
Sbjct  405  LVTVRGAGHEVALHKPKLSLTLVDSFLRGNPMPKLE  440



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 175/221 (79%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD++SFIH S  C+K+ D A+ ELG+ID YSIFTP+C+ + S  S +L +R  +VG 
Sbjct  152  NLLCDFESFIHSSVACDKMEDIAAKELGNIDPYSIFTPSCSANVS-QSNLLPKRKHRVGR  210

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HST+YFNLPEVQKALHV    +   W TCS+ V   WKD P TVLD+Y+
Sbjct  211  VSEKYDPCTETHSTVYFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYK  270

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLT
Sbjct  271  ELIRSGLHLWVFSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLT  330

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  331  FVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  371



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 175/221 (79%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL CD+QSFIH S+ C+K+LD AS+ELG+ID YSI+TP CT + S  +R+LK    KVG 
Sbjct  261  NLFCDFQSFIHSSDSCDKILDIASEELGNIDPYSIYTPPCTANVSGSNRLLKTM-HKVGR  319

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HST+YFNLPEVQKALHV    +  +W TCSD V + WKD P TVLD+Y 
Sbjct  320  VYEKYDPCTEAHSTVYFNLPEVQKALHVSKEFAPSKWETCSDLVNNNWKDSPRTVLDIYH  379

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +G+RIWVFSGDTDAVIPVTSTRYSIDALKL T  PW  WYD+ QVGGWTQEY GL 
Sbjct  380  ELIHSGIRIWVFSGDTDAVIPVTSTRYSIDALKLRTTKPWHAWYDDRQVGGWTQEYAGLA  439

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPKLALTL+++FL+GTSMP L+ +S S
Sbjct  440  FVVVRGAGHEVPLHRPKLALTLIKAFLSGTSMPTLEPVSSS  480



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 175/221 (79%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD++SFIH S  C+K+ D A+ ELG+ID YSIFTP+C+ + S  S +L +R  +VG 
Sbjct  259  NLLCDFESFIHSSVACDKMEDIAAKELGNIDPYSIFTPSCSANVS-QSNLLPKRKHRVGR  317

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HST+YFNLPEVQKALHV    +   W TCS+ V   WKD P TVLD+Y+
Sbjct  318  VSEKYDPCTETHSTVYFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYK  377

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLT
Sbjct  378  ELIRSGLHLWVFSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLT  437

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  438  FVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  478



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 175/218 (80%), Gaps = 1/218 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSFIH S  C+ +LD A+ ELG+ID YSI+TP+C  + S  S  L++R   VG 
Sbjct  254  NLLCDFQSFIHTSNSCDNILDIANAELGNIDPYSIYTPSCPANVS-QSNGLRKRRNTVGH  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + + YDPCTE HS +YFNLPEVQKALHV   ++  +W TCSD V   WKD P TVLDVY+
Sbjct  313  ISQKYDPCTEAHSVVYFNLPEVQKALHVDPDHAPSKWATCSDVVSMTWKDSPRTVLDVYK  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGD DAVIP+TSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GLT
Sbjct  373  ELIHSGLRIWMFSGDNDAVIPITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
            FV+VRGAGHEV LH+PK ALTL++SFL+G+SMP  +++
Sbjct  433  FVSVRGAGHEVPLHKPKQALTLIKSFLSGSSMPASEQL  470



>ref|XP_012071557.1| PREDICTED: serine carboxypeptidase II-2-like [Jatropha curcas]
 gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   310 bits (795),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSF+H S+ C  +L+ A  ELGDID YSIFTP CT + S  +R+LK+R R VG 
Sbjct  259  NLLCDFQSFVHSSDACGAILEVADKELGDIDHYSIFTPPCTTNSSGSNRLLKKRHR-VGH  317

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + + YDPCTE HST+YFNLPEVQKALHV       +W TCSD V + WKD P TVL++Y 
Sbjct  318  VSKKYDPCTEAHSTVYFNLPEVQKALHVSPEFLPSKWETCSDLVNENWKDSPRTVLNIYH  377

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGDTDAVIPVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GL 
Sbjct  378  ELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTTKPWHAWYDDGQVGGWTQEYAGLN  437

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPKLAL L+++FL+G SMP  + +S S
Sbjct  438  FVVVRGAGHEVPLHRPKLALALIKTFLSGVSMPTHELVSAS  478



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 176/221 (80%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD+QSFIH S  C+KVLD ASDELGDID YSI+TP C  + S  +R L++R + +G 
Sbjct  254  NVLCDFQSFIHTSSACDKVLDIASDELGDIDPYSIYTPLCPVNGSQSNR-LRKRMKVIGH  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HS  YFN  EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+
Sbjct  313  VNEKYDPCTEEHSVKYFNRAEVQTALHVNKAFAPAKWDTCSDLVNENWKDAPRTVLDIYR  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            EL+  GLRIW+FSGDTDAVIPVTSTRY+ID+LKLPTV P+R WYD+G VGGWTQEY GLT
Sbjct  373  ELMREGLRIWMFSGDTDAVIPVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LHRPKLAL L+++FLAGTSMP LQ +SDS
Sbjct  433  FVSVRGAGHEVPLHRPKLALALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 173/218 (79%), Gaps = 1/218 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSFIH S  C+  LD A+ ELG+ID YSI+TP+C  + S  S  L++R   VG 
Sbjct  254  NLLCDFQSFIHTSNSCDNXLDIANAELGNIDPYSIYTPSCPANVS-QSNGLRKRRNTVGH  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + + YDPCTE HS +YFNLPEVQKALH    ++  +W TCSD V   WKD P TVLDVY+
Sbjct  313  ISQKYDPCTEAHSVVYFNLPEVQKALHXDPGHAPSKWATCSDVVSMTWKDSPRTVLDVYK  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GLRIW+FSGD DAVIP+TSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GLT
Sbjct  373  ELIHSGLRIWMFSGDNDAVIPITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
            FV+VRGAGHEV LH+PK ALTL++SFL+G+SMP  +++
Sbjct  433  FVSVRGAGHEVPLHKPKQALTLIKSFLSGSSMPASEQL  470



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 176/221 (80%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD+QSFIH S  C+KVLD ASDELGDID YSI+TP C  + S  +R L++R + +G 
Sbjct  254  NVLCDFQSFIHTSSACDKVLDIASDELGDIDPYSIYTPLCPVNGSQSNR-LRKRMKVIGH  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HS  YFN  EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+
Sbjct  313  VNEKYDPCTEEHSVKYFNRAEVQTALHVNKAFAPAKWDTCSDLVSENWKDAPRTVLDIYR  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            EL+  GLRIW+FSGDTDAVIPVTSTRY+ID+LKLPTV P+R WYD+G VGGWTQEY GLT
Sbjct  373  ELMREGLRIWMFSGDTDAVIPVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV+VRGAGHEV LHRPKLAL L+++FLAGTSMP LQ +SDS
Sbjct  433  FVSVRGAGHEVPLHRPKLALALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   308 bits (788),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 168/221 (76%), Gaps = 0/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N +CD+QSF+H S EC K+LD AS+ELG+ID YSIFTP+C  S +     L +R    G 
Sbjct  253  NFICDFQSFVHASSECEKILDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGR  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
                YDPCTE+HST+YFNLPEVQKALHV+   +  +W TCSD V + WKDCP +VL +Y 
Sbjct  313  AGEKYDPCTEKHSTVYFNLPEVQKALHVNPAVAPSKWETCSDIVNENWKDCPRSVLHIYH  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSGDTDAVIPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLT
Sbjct  373  ELIQYGLRIWMFSGDTDAVIPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK AL L +SFL+G+ MP L    DS
Sbjct  433  FVTVRGAGHEVPLHRPKQALVLFKSFLSGSPMPTLSEFDDS  473



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 168/216 (78%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+Q   HPS+ C+K+ D A +E+GDID YSIFTP C     +    L +R    G 
Sbjct  20   NLLCDFQPVEHPSDSCDKIWDIAYEEMGDIDPYSIFTPPC----HVNDNQLDKRKHSFGR  75

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCTE+HS IYFN PEVQ+ALHV   +   +W TCSD V   WKD PT+VL++Y+
Sbjct  76   LRSVYDPCTEKHSIIYFNRPEVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYR  135

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDAVIPV STRYSI+ALKLPT+SPWR WYD+G+VGGWTQEY GLT
Sbjct  136  ELIPTGLRIWIFSGNTDAVIPVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLT  195

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
            FV VRGAGHEV LHRPKLALTL+++FL GTSMP L+
Sbjct  196  FVNVRGAGHEVPLHRPKLALTLIKAFLEGTSMPTLE  231



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD QSFI  SE C+K++D A +E+G+ID YSIFTP C+      ++++K+     G+
Sbjct  251  NVFCDSQSFILSSELCDKIMDIAREEIGNIDLYSIFTPPCSVKIGFSNQLMKKLIMASGI  310

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
             R+ YDPCTE+HS +Y+NLPEVQ+ALHV+  N++F+W TCSDEV   WKD P +VL++Y+
Sbjct  311  SRK-YDPCTEQHSAVYYNLPEVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI A LRIW+FSGDTDAVIPVTSTRYSIDALKLPTVSPWR WYD+GQVGGWTQ+Y GLT
Sbjct  370  ELIHARLRIWIFSGDTDAVIPVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK A TL ++FL+G  MP ++++S S
Sbjct  430  FVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPMPYMEQVSYS  470



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD QSFI  SE C+K++D A +E+G+ID YSIFTP C+      ++++K+     G+
Sbjct  291  NVFCDSQSFILSSELCDKIMDIAREEIGNIDLYSIFTPPCSVKIGFSNQLMKKLIMASGI  350

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
             R+ YDPCTE+HS +Y+NLPEVQ+ALHV+  N++F+W TCSDEV   WKD P +VL++Y+
Sbjct  351  SRK-YDPCTEQHSAVYYNLPEVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYR  409

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI A LRIW+FSGDTDAVIPVTSTRYSIDALKLPTVSPWR WYD+GQVGGWTQ+Y GLT
Sbjct  410  ELIHARLRIWIFSGDTDAVIPVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLT  469

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK A TL ++FL+G  MP ++++S S
Sbjct  470  FVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPMPYMEQVSYS  510



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 176/238 (74%), Gaps = 18/238 (8%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCDY+SF+HPS  C+KVL+ A +ELG+ID YSIFTP+CT S S  +R+LKR    VG 
Sbjct  253  NLLCDYESFVHPSSSCDKVLEVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGH  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTC-----------------SDE  576
                YDPCTE+HS +YFN PEVQKALHV    +  +W TC                 S  
Sbjct  312  ASEKYDPCTEKHSVVYFNQPEVQKALHVIPAVAPAKWETCRWHQQYTLVISLFLLLCSGV  371

Query  575  VYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPW  396
            V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR W
Sbjct  372  VNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAW  431

Query  395  YDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            YD+GQVGGWTQEY GLTFV VRGAGHEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  432  YDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  489



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N  CD +SF+H SE+C  +LD AS+ELG+ID YSI+TP+CT + S+ +++LKR    +G 
Sbjct  258  NRFCDLESFVHSSEKCETILDIASNELGNIDPYSIYTPSCTTNSSLPNKLLKRL---IGH  314

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L   YDPC+E+HS +YFN PEVQ+ALHV+   +  +W TCS  V   W+D   +VLD+Y 
Sbjct  315  LNEAYDPCSEKHSVVYFNQPEVQQALHVNPQFAPVKWETCSGLVNSNWQDSSRSVLDIYH  374

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            EL+ AGLRIW+FSGDTDAVIPVTSTRY+IDALKLPT+ PW  WYD+GQVGGWTQEY+GLT
Sbjct  375  ELMDAGLRIWMFSGDTDAVIPVTSTRYNIDALKLPTIKPWHAWYDDGQVGGWTQEYKGLT  434

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHR KL+LTLV+SFLAG SMP L+++SDS
Sbjct  435  FVVVRGAGHEVPLHRAKLSLTLVKSFLAGESMPTLEQVSDS  475



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 170/221 (77%), Gaps = 0/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD+QSF+H S EC ++LD A  ELG+ID YSIFTP+C  S +     L +R   VG 
Sbjct  253  NVFCDFQSFVHTSSECERILDIADKELGNIDPYSIFTPSCPGSVTFSKNKLLKRRHSVGS  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNLPEVQKALH++   +  +W TCSD V + WKD   +VL +Y 
Sbjct  313  IGEKYDPCTEQHSTVYFNLPEVQKALHINPAFAPSKWETCSDVVNENWKDSARSVLHIYH  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSGDTDAVIPVTSTRY+ID+LKLPTV+PW PWYD+GQVGGWTQ Y+GLT
Sbjct  373  ELIGYGLRIWMFSGDTDAVIPVTSTRYNIDSLKLPTVTPWHPWYDDGQVGGWTQVYKGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PKLAL L +SFL+G+SMP    + DS
Sbjct  433  FVTVRGAGHEVPLHQPKLALVLFKSFLSGSSMPTFTGLDDS  473



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 171/214 (80%), Gaps = 1/214 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD++SF+H S  CN+++D AS+E+G+ID YSIFTP+C+ + S    +LKRR   V  
Sbjct  257  NVLCDFESFVHSSSACNEMMDLASEEMGNIDPYSIFTPSCSANASQTKWLLKRR-LMVSQ  315

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L   YDPCTE+HS +YFNLPEVQK+LHV    +  +W TCSD V   WKD P T+LDVY+
Sbjct  316  LSEKYDPCTEKHSEVYFNLPEVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYR  375

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSGDTDAVIP+TSTRYSIDALKL T+ PWR WYD+GQVGGWTQEYEGL 
Sbjct  376  ELIHEGLRIWIFSGDTDAVIPITSTRYSIDALKLATMKPWRAWYDDGQVGGWTQEYEGLK  435

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            FV+VRGAGHEV LHRPK ALTL ++FL+GTSMP 
Sbjct  436  FVSVRGAGHEVPLHRPKQALTLFKAFLSGTSMPA  469



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD++SF+H S++C+K+LD AS E G+ID+YSIFTPTC  +F+     + +R R VG 
Sbjct  252  NIFCDFESFVHTSKQCDKILDIASKEAGNIDSYSIFTPTCHATFASSKNKVMKRLRSVGK  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNL EVQKALHV+      +W TCS  V + W DC  +VL +Y 
Sbjct  312  MGEQYDPCTEKHSTVYFNLAEVQKALHVNPVIGKSKWETCSGVVNNHWGDCERSVLHIYH  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPTV+PW  WY DNG+VGGW+Q YEGL
Sbjct  372  ELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDNGEVGGWSQGYEGL  431

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            TFV VRGAGHEV LHRPK ALTL++SFLAGT MP
Sbjct  432  TFVTVRGAGHEVPLHRPKQALTLIKSFLAGTPMP  465



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 169/216 (78%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QSF HPS+ C ++L+ A  E+G+ID +SIFTP C E+         RR    G 
Sbjct  254  NLLCDFQSFEHPSKSCERILEIADKEMGNIDPFSIFTPPCHEN----DNQPDRRKHSFGR  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCTE HS IYFN PEVQ+ALHV+  +   +W TCSD V   WKD P +VL++Y+
Sbjct  310  LRGVYDPCTENHSNIYFNRPEVQRALHVNPDHKPDKWQTCSDVVGTNWKDSPRSVLNIYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDA+IPVTSTRYSI+ALKLPTVSPWR WYD+G+VGGWTQEY GLT
Sbjct  370  ELIPTGLRIWIFSGNTDAIIPVTSTRYSINALKLPTVSPWRAWYDDGEVGGWTQEYAGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
            FV VRGAGHEV LHRPKLALTL+++FL GTSMP L+
Sbjct  430  FVNVRGAGHEVPLHRPKLALTLIKAFLEGTSMPTLE  465



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 174/219 (79%), Gaps = 4/219 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QS  HPS+ C ++L+ A  E+G+ID YSIFTP C  +    ++ +KR++  VG 
Sbjct  224  NLLCDFQSVEHPSQSCERILEIADKEMGNIDPYSIFTPPCHAN---DNQQIKRKN-SVGR  279

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCTE+HSTIYFN PEVQ+ LHV       +W TCS  V   WKD P TVLD+Y+
Sbjct  280  LRGVYDPCTEKHSTIYFNRPEVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYR  339

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDAVIPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGWTQEY GLT
Sbjct  340  ELIPTGLRIWIFSGNTDAVIPVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLT  399

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRIS  228
            FV VRGAGHEV LHRPKLALTL+++FLAGTSMP L+ ++
Sbjct  400  FVNVRGAGHEVPLHRPKLALTLIKAFLAGTSMPTLEPLT  438



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 168/216 (78%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+Q   HPS+ C+K+ D A +E+GDID YSIFTP C     +    L +R    G 
Sbjct  254  NLLCDFQPVEHPSDSCDKIWDIAYEEMGDIDPYSIFTPPC----HVNDNQLDKRKHSFGR  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCTE+HS IYFN PEVQ+ALHV   +   +W TCSD V   WKD PT+VL++Y+
Sbjct  310  LRSVYDPCTEKHSIIYFNRPEVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDAVIPV STRYSI+ALKLPT+SPWR WYD+G+VGGWTQEY GLT
Sbjct  370  ELIPTGLRIWIFSGNTDAVIPVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
            FV VRGAGHEV LHRPKLALTL+++FL GTSMP L+
Sbjct  430  FVNVRGAGHEVPLHRPKLALTLIKAFLEGTSMPTLE  465



>gb|ACF84647.1| unknown [Zea mays]
Length=257

 Score =   294 bits (752),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CDY+SF+H S +C+K++D AS E G+ID+YSIFTPTC  SF+     + +R    G 
Sbjct  35   NVFCDYESFVHSSPQCDKIMDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGK  94

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNL EVQKALHV+T     +W TCS+ V   W DC  +VL +Y 
Sbjct  95   MGEQYDPCTEKHSTVYFNLAEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYH  154

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT++PW  WY D+G+VGGWTQ Y GL
Sbjct  155  ELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGL  214

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             FV VRGAGHEV LHRPK ALTL++SFL G+ MP
Sbjct  215  NFVTVRGAGHEVPLHRPKQALTLIKSFLTGSPMP  248



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 166/221 (75%), Gaps = 0/221 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N  CD+QSF+H S EC K+LD AS+ELG ID YSI TP+C  + +     L +R    G 
Sbjct  251  NFFCDFQSFVHVSSECEKILDVASNELGTIDPYSILTPSCPGTVTFSKNKLLKRLHSFGR  310

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HSTIYFNLPEVQKALHV+   +  EW TCSD V + WKD P +VL +Y 
Sbjct  311  VGEKYDPCTEKHSTIYFNLPEVQKALHVNPVVAPSEWETCSDVVNENWKDSPRSVLHIYH  370

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSGDTDAVIPVTSTRY++D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLT
Sbjct  371  ELIHYGLRIWMFSGDTDAVIPVTSTRYNVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLT  430

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK AL L +SFL+G+ MP L    DS
Sbjct  431  FVTVRGAGHEVPLHRPKQALVLFKSFLSGSPMPTLSEFVDS  471



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 172/223 (77%), Gaps = 3/223 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR--KV  711
            NLLCD++S  HPS  C  + + A  ELG+ID YS+FTP C  + S +SR+++R++R  ++
Sbjct  251  NLLCDFESVEHPSHSCENIWEIADKELGNIDPYSLFTPPCHANVSQLSRLVRRKNRIGRL  310

Query  710  GLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDV  531
            GL    YDPCTERHS +YFN PEVQ ALHV   +    W TCSD VY  WKD P +VLD+
Sbjct  311  GLSTE-YDPCTERHSIVYFNRPEVQTALHVDLDHKPATWETCSDVVYTNWKDSPRSVLDI  369

Query  530  YQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEG  351
            Y ELI  GL+IWVFSG+TD VIPVTSTRYSI ALKLPT+SPWR WYD+G+VGGWTQEY G
Sbjct  370  YHELIGMGLKIWVFSGNTDVVIPVTSTRYSISALKLPTLSPWRAWYDDGEVGGWTQEYAG  429

Query  350  LTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            LTFV VRGAGHEV LH+PKLALTLV++FLAGTSMP L  +S S
Sbjct  430  LTFVIVRGAGHEVPLHKPKLALTLVQTFLAGTSMPNLDLLSTS  472



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 174/219 (79%), Gaps = 4/219 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QS  HPS+ C ++L+ A  E+G+ID YSIFTP C  +    ++ +KR++  VG 
Sbjct  255  NLLCDFQSVEHPSQSCERILEIADKEMGNIDPYSIFTPPCHAN---DNQQIKRKN-SVGR  310

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCTE+HSTIYFN PEVQ+ LHV       +W TCS  V   WKD P TVLD+Y+
Sbjct  311  LRGVYDPCTEKHSTIYFNRPEVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYR  370

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDAVIPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGWTQEY GLT
Sbjct  371  ELIPTGLRIWIFSGNTDAVIPVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLT  430

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRIS  228
            FV VRGAGHEV LHRPKLALTL+++FLAGTSMP L+ ++
Sbjct  431  FVNVRGAGHEVPLHRPKLALTLIKAFLAGTSMPTLEPLT  469



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   301 bits (770),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CDY+SF+H S +CNK+LD ASDE G+ID+YSIFTPTC  SF+     + +R   VG 
Sbjct  262  NVFCDYESFVHTSSQCNKILDIASDEAGNIDSYSIFTPTCHASFASSRNKVMKRLHSVGK  321

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNL EVQKALHV    +  +W TCSD V   WKDC  +VL +Y 
Sbjct  322  MGERYDPCTEKHSTVYFNLAEVQKALHVSPIINKSKWETCSDVVNTNWKDCERSVLHIYH  381

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIWVFSGDTDAV+PVTSTRYSI+ALKLPTV+PW  WY D+G+VGGWTQ Y+GL
Sbjct  382  ELIQYGLRIWVFSGDTDAVLPVTSTRYSINALKLPTVTPWNAWYDDDGEVGGWTQGYKGL  441

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
             FV VRGAGHEV LHRPK AL L++SFLAG+ MP +Q
Sbjct  442  NFVTVRGAGHEVPLHRPKQALILIKSFLAGSPMPSVQ  478



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTES-FSIMSRVLKRRDRKVG  708
            NLLCD+QS  HPS  C K+ + A++ELG+ID YS+FTP C  +  S +SR+++R+ R +G
Sbjct  249  NLLCDFQSVEHPSHSCEKIWEIANEELGNIDPYSLFTPPCQHANVSQLSRLVRRKHR-IG  307

Query  707  LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVY  528
             L   YDPCTE+HS +YFN P+VQ  LHV   +    W TCSDEV+  WKD P TVL++Y
Sbjct  308  RLSAEYDPCTEKHSIVYFNRPDVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIY  367

Query  527  QELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGL  348
             ELI  GLRIWVFSG+TD VIPVTSTRYSI AL LPTVSPWR WYD+G+VGGWTQEY GL
Sbjct  368  HELIQMGLRIWVFSGNTDVVIPVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGL  427

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            TFV VRGAGHEV LH PKLALTL ++FLAGTSMP L+ +  S
Sbjct  428  TFVVVRGAGHEVPLHSPKLALTLFKAFLAGTSMPNLELVGAS  469



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 169/221 (76%), Gaps = 13/221 (6%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD++SFIH S  C+K+ D A+ ELG+ID YSIFTP+C+ +             +VG 
Sbjct  259  NLLCDFESFIHSSVACDKMEDIATKELGNIDPYSIFTPSCSAN-------------RVGR  305

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE H+T+YFNLPEVQKALHV    +   W TCS+ V   WKD P TVLD+Y+
Sbjct  306  VSEKYDPCTETHTTVYFNLPEVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYK  365

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLT
Sbjct  366  ELIHSGLHVWVFSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLT  425

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  426  FVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  466



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   298 bits (763),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTES-FSIMSRVLKRRDRKVG  708
            NLLCD+QS  HPS  C K+ + A++ELG+ID YS+FTP C  +  S +SR+++R+ R +G
Sbjct  263  NLLCDFQSVEHPSHSCEKIWEIANEELGNIDPYSLFTPPCQHANVSQLSRLVRRKHR-IG  321

Query  707  LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVY  528
             L   YDPCTE+HS +YFN P+VQ  LHV   +    W TCSDEV+  WKD P TVL++Y
Sbjct  322  RLSAEYDPCTEKHSIVYFNRPDVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIY  381

Query  527  QELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGL  348
             ELI  GLRIWVFSG+TD VIPVTSTRYSI AL LPTVSPWR WYD+G+VGGWTQEY GL
Sbjct  382  HELIQMGLRIWVFSGNTDVVIPVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGL  441

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            TFV VRGAGHEV LH PKLALTL ++FLAGTSMP L+ +  S
Sbjct  442  TFVVVRGAGHEVPLHSPKLALTLFKAFLAGTSMPNLELVGAS  483



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD QSF HPS EC K+LD AS+ELG+ID YSIFTP+CT SF++    L +R    G 
Sbjct  255  NIFCDSQSFEHPSSECQKILDIASNELGNIDPYSIFTPSCTGSFTLSKNKLLKRLHSAGR  314

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + + YDPCTE+HS +YFNLPEVQK LHV+   +  +WVTCSD V   +KD   +VL +Y+
Sbjct  315  IGKKYDPCTEKHSMVYFNLPEVQKVLHVNPAFAPSKWVTCSDFVDKNYKDSSRSVLPIYR  374

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI+ GLRIW+FSGDTDAVIPV STRY+IDALKLPTV+PW  WYD+GQVGGWTQ Y+GLT
Sbjct  375  ELISHGLRIWMFSGDTDAVIPVASTRYNIDALKLPTVTPWHAWYDDGQVGGWTQVYKGLT  434

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV VRGAGHE++L RPK AL L+++FL+G  MP
Sbjct  435  FVTVRGAGHEISLLRPKSALVLIKAFLSGNPMP  467



>gb|EMT26558.1| putative Serine carboxypeptidase II-2 [Aegilops tauschii]
Length=389

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD++SF+H S +C+K+LD AS E G+ID+YSIFTPTC  SF+     + +R R  G 
Sbjct  167  NIFCDFESFVHTSPQCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSAGK  226

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y 
Sbjct  227  MGEQYDPCTEQHSIVYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCDRSVLHIYH  286

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIW+FSGDTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL
Sbjct  287  ELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGL  346

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
             FV VRGAGHEV LHRPK ALTL++SFLAG+ MP L  +
Sbjct  347  NFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLSDL  385



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 163/214 (76%), Gaps = 1/214 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CDY+SF+H S +C+K++D AS E G+ID+YSIFTPTC  SF+     + +R    G 
Sbjct  252  NVFCDYESFVHSSPQCDKIMDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGK  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNL EVQKALHV+T     +W TCS+ V   W DC  +VL +Y 
Sbjct  312  MGEQYDPCTEKHSTVYFNLAEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYH  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT++PW  WY D+G+VGGWTQ Y GL
Sbjct  372  ELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGL  431

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             FV VRGAGHEV LHRPK ALTL++SFL G+ MP
Sbjct  432  NFVTVRGAGHEVPLHRPKQALTLIKSFLTGSPMP  465



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD++SF+H S +C+K+LD AS E G+ID+YSIFTPTC  SF+     + +R R VG 
Sbjct  214  NIFCDFESFVHTSPQCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGK  273

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y 
Sbjct  274  MGEQYDPCTEKHSIVYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYH  333

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIW+FSGDTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL
Sbjct  334  ELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGL  393

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
             FV VRGAGHEV LHRPK ALTL++SFLAG  MP L  +
Sbjct  394  NFVTVRGAGHEVPLHRPKQALTLIKSFLAGRPMPVLSDL  432



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 168/219 (77%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD++SF+H S +C+K+LD AS E G+ID+YSIFTPTC  SF+     + +R R VG 
Sbjct  247  NIFCDFESFVHTSPQCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGK  306

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y 
Sbjct  307  MGEQYDPCTEQHSIVYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYH  366

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIW+FSGDTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL
Sbjct  367  ELIQYGLRIWMFSGDTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGL  426

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
             FV VRGAGHEV LHRPK ALTL++SFLAG+ MP L  +
Sbjct  427  NFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLSDL  465



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 164/214 (77%), Gaps = 1/214 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CDY+SF+H S +CNK+LD AS E G+ID+YSIFTPTC  SF+     + +R   VG 
Sbjct  262  NVFCDYESFVHTSSQCNKILDIASTEAGNIDSYSIFTPTCHSSFAASRNKVMKRLHSVGK  321

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNL EVQKALH     +  +W TCSD V   WKDC  +VL +Y 
Sbjct  322  MGERYDPCTEKHSTVYFNLAEVQKALHASPIINKSKWETCSDIVNTNWKDCERSVLHIYH  381

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGGWTQEYEGL  348
            ELI  GLRIWVFSGDTDAV+PVTSTRYSIDALKL TV+PW  WYD +G+VGGWTQ Y+GL
Sbjct  382  ELIQYGLRIWVFSGDTDAVLPVTSTRYSIDALKLLTVTPWSAWYDEDGEVGGWTQGYKGL  441

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             FV+VRGAGHEV LHRPK AL L++SFLAG +MP
Sbjct  442  NFVSVRGAGHEVPLHRPKQALILIKSFLAGRAMP  475



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD++SFIH S +C+K+LD AS E G+ID+YSIFTPTC  SF+     + +R R VG 
Sbjct  252  NIFCDFESFIHSSPQCDKILDIASTEAGNIDSYSIFTPTCHSSFASSRNKVMKRLRSVGK  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNL EVQKALHV+      +W TCS  + + W D   +VL +Y 
Sbjct  312  MGEQYDPCTEKHSIVYFNLAEVQKALHVNPVIGKSKWETCSGVINNNWGDSERSVLHIYH  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIW+FSGDTDAVIPVTSTRYSI+ALKLPTV+PW  WY D+G+VGGWTQ Y+GL
Sbjct  372  ELIQYGLRIWMFSGDTDAVIPVTSTRYSINALKLPTVAPWHAWYDDDGEVGGWTQGYQGL  431

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
            TFV VRGAGHEV LHRPK ALTL++SFLAG+ MP L  +
Sbjct  432  TFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLSDL  470



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD++SFIH S  CN+++D AS+E+G+ID YSIFTP+C+ + S    +LKRR   V  
Sbjct  257  NVLCDFESFIHFSSACNEMMDVASEEMGNIDPYSIFTPSCSANASQTKWLLKRR-HMVSQ  315

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L   YDPCTE+HS +YFNLPEVQK+LHV    +  +W TCSD V   WKD P T+LDVY+
Sbjct  316  LSEKYDPCTEKHSEVYFNLPEVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYR  375

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            EL   GLRI +FSGDTDAVIP+TSTRYSIDALKL TV PW  WYD+GQVGGWTQEYEGL 
Sbjct  376  ELTREGLRICIFSGDTDAVIPITSTRYSIDALKLATVKPWHAWYDDGQVGGWTQEYEGLK  435

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            FV+VRGAGHEV LHRPK AL L ++FL+GTSM
Sbjct  436  FVSVRGAGHEVPLHRPKQALALFKAFLSGTSM  467



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD++SF+H S +C+K+LD AS E G+ID+YSIFTPTC  SF+     + +R R VG 
Sbjct  247  NIFCDFESFVHTSPQCDKILDVASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGK  306

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNL EVQKALHV+      +W TCS+ +   WKDC  +VL +Y 
Sbjct  307  MGEQYDPCTEQHSIVYFNLHEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYH  366

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GL IW+FSGDTDAVIPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL
Sbjct  367  ELIQYGLHIWMFSGDTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGL  426

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
             FV VRGAGHEV LHRPK ALTL++SFLAG+ MP L  +
Sbjct  427  NFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMPVLSDL  465



>ref|XP_006845388.1| PREDICTED: serine carboxypeptidase II-2 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 168/218 (77%), Gaps = 1/218 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD+QSF+HPS +C+KV+D A +ELG ID YS+FT TC +  S +S  L+ +    G 
Sbjct  252  NVFCDFQSFVHPSSQCDKVIDQAYEELGGIDPYSVFTITC-QGNSTLSNKLRSKSNSFGR  310

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFN PEVQKALHV+   +  +W TCSD V   W+D   ++L +Y 
Sbjct  311  IGEQYDPCTEKHSTVYFNQPEVQKALHVNPAFAPSKWKTCSDVVGVNWRDSVKSILPIYH  370

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSGDTDA+IPVTSTRY+IDAL+LPTV+PW  WYDNGQVGGWTQ Y+GLT
Sbjct  371  ELIHEGLRIWMFSGDTDAIIPVTSTRYNIDALRLPTVTPWHAWYDNGQVGGWTQVYKGLT  430

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
            FV VRGAGHEVALH+P+LAL L+++FL G+ MP L  +
Sbjct  431  FVTVRGAGHEVALHKPRLALRLIKAFLVGSPMPTLASL  468



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 163/224 (73%), Gaps = 7/224 (3%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+LCD+ S +HPS  CN  LD A  E+G+ID YSI+TP C  S    +   +++ RK   
Sbjct  230  NVLCDFSSLLHPSALCNMALDKADVEMGEIDPYSIYTPPCLNS----TGTYRKQHRKRYP  285

Query  704  LRRI---YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLD  534
             R +   YDPCTE+HS IYFNLPEVQKALH + T   + W TCSD V D W D P ++L 
Sbjct  286  WRHLFGEYDPCTEKHSEIYFNLPEVQKALHANVTGIPYRWTTCSDAVADHWGDSPRSMLP  345

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +YQELI AGLRIW+FSGDTDAVIPVTSTRYSI+ALKLPTV+ W PWYDNGQVGGWTQ YE
Sbjct  346  IYQELIKAGLRIWMFSGDTDAVIPVTSTRYSINALKLPTVTQWHPWYDNGQVGGWTQVYE  405

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            GLTFV VRGAGHEV LH P+ A T+ ESFL G  MP   ++ D+
Sbjct  406  GLTFVTVRGAGHEVPLHEPRKAFTVFESFLEGKPMPVSPKLVDT  449



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis sativus]
Length=468

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 167/221 (76%), Gaps = 3/221 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLC  QSF+H S  C+++L+ A  E+G+ID YSIFTP C+E+    S  L++R   +G 
Sbjct  251  NLLCANQSFVHSSASCDEILEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGR  307

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS  YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+
Sbjct  308  VGERYDPCTEKHSVAYFNLPEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYR  367

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T
Sbjct  368  ELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVT  427

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
             V+VRGAGHEV LH+PKLAL L++SFLAG S+  LQ  SD+
Sbjct  428  LVSVRGAGHEVPLHQPKLALQLIKSFLAGNSLSPLQLHSDT  468



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 164/218 (75%), Gaps = 4/218 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD QS  HPS  C K+L+ A DELG++D YSI+TP C  +         +R   +G 
Sbjct  267  NLLCDSQSVEHPSTSCEKILEIADDELGNLDPYSIYTPPCHGN----DNHKVKRKHSIGR  322

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR  YDPCTE+HS  YFN PEVQ+ LHV   +   +W TCSD V   WKD P TVLD+Y+
Sbjct  323  LRATYDPCTEKHSIKYFNQPEVQRILHVDPHHKPEKWETCSDLVNINWKDSPRTVLDIYR  382

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TD+VIPVTSTRY+IDALKLPTVSPWR WYD+G+VGGW QEY GLT
Sbjct  383  ELIPTGLRIWMFSGNTDSVIPVTSTRYTIDALKLPTVSPWRAWYDDGEVGGWIQEYAGLT  442

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
            FV +RGAGHEV LH+PKLALTL ++FLAGTSMP L+ +
Sbjct  443  FVTIRGAGHEVPLHKPKLALTLFKAFLAGTSMPTLEPL  480



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   290 bits (742),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 164/216 (76%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD+QS  HPS+ C K+ + +  ELG+ID Y+IFT  C  +       L +R  +VG 
Sbjct  343  NLLCDFQSVKHPSKSCEKIWEISEKELGNIDPYNIFTTPCHAN----DNQLVKRKHRVGN  398

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCT +HST YFNLPEVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+
Sbjct  399  LRTVYDPCTSKHSTTYFNLPEVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYR  458

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDAV+PVTSTRYSIDALKLPTVSPWR WYD+G+V GWTQEY GLT
Sbjct  459  ELIPTGLRIWMFSGNTDAVLPVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLT  518

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
            FV VRGAGHEV LHRPKLAL L +SFLAGTSM  L+
Sbjct  519  FVNVRGAGHEVPLHRPKLALALFKSFLAGTSMQTLE  554


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL CD+QS  HPSE C K+ + A  ELG+ID YSIF   C  + + M +   +  R  G 
Sbjct  255  NLRCDFQSVKHPSESCEKIWEIAEKELGNIDPYSIFATPCHANDNQMVKGKHKVFRFCGQ  314

Query  704  LRRIYD  687
            +   +D
Sbjct  315  MGMFHD  320



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 168/249 (67%), Gaps = 29/249 (12%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCDY+SF+HPS  C+KVLD A +ELG+ID YSIFTP+CT S S  +R+LKR    VG 
Sbjct  66   NLLCDYESFVHPSSSCDKVLDVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGH  124

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCS------------------D  579
                YDPCTE+HS +YFN PEVQKALHV    +  +W TC                    
Sbjct  125  ASEKYDPCTEKHSVVYFNQPEVQKALHVIPAVALAKWETCRWHQQHALMIFFIFTALQWG  184

Query  578  EVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRP  399
             V + W D P  VLD+Y ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR 
Sbjct  185  VVNNNWLDSPRIVLDIYHELIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRA  244

Query  398  WYDNGQVGG----------WTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            WYD GQV            WTQEY GLT V VRGA HEV LHRPK ALTL++SFL+G SM
Sbjct  245  WYDEGQVNYTTKPFITYILWTQEYAGLTLVTVRGADHEVPLHRPKPALTLIKSFLSGRSM  304

Query  248  PGLQRISDS  222
            P L+R+S S
Sbjct  305  PCLERVSLS  313



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 167/221 (76%), Gaps = 3/221 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLC  QSF+H S  C+++L+ A  E+G+ID YSIFTP C+E+    S  L++R   +G 
Sbjct  325  NLLCANQSFVHSSASCDEILEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGR  381

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS  YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+
Sbjct  382  VGERYDPCTEKHSVAYFNLPEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYR  441

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T
Sbjct  442  ELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVT  501

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
             V+VRGAGHEV LH+PKLAL L++SFLAG S+  LQ  SD+
Sbjct  502  LVSVRGAGHEVPLHQPKLALQLIKSFLAGNSLSPLQLHSDT  542



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 162/216 (75%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL CD+QS  HPSE C K+ + A  ELG+ID YSIF   C  + + M +   R    VG 
Sbjct  255  NLRCDFQSVKHPSESCEKIWEIAEKELGNIDPYSIFATPCHANDNQMVKGKHR----VGN  310

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            LR +YDPCT +HST YFNLPEVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+
Sbjct  311  LRTVYDPCTSKHSTTYFNLPEVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYR  370

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIW+FSG+TDAV+PVTSTRYSIDALKLPTVSPWR WYD+G+V GWTQEY GLT
Sbjct  371  ELIPTGLRIWMFSGNTDAVLPVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLT  430

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
            FV VRGAGHEV LHRPKLAL L +SFLAGTSM  L+
Sbjct  431  FVNVRGAGHEVPLHRPKLALALFKSFLAGTSMQTLE  466



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 166/221 (75%), Gaps = 3/221 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL C  +SF+HPS  C+++L+ A  E+G+ID YSIFTP C+E   + S  L++R   VG 
Sbjct  251  NLRCANESFVHPSASCDEILEVADKEIGNIDHYSIFTPPCSE---VSSNRLRKRMHMVGR  307

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS  YFNLPEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+
Sbjct  308  IGERYDPCTEQHSVAYFNLPEVQQALHVDPKFAPSKWETCSYVINGNWKDSAGSVLDIYR  367

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTDAV+P+TSTRYS+DALKLP + PWR WYD GQVGGW QEYEG+T
Sbjct  368  ELIQAGLRIWVFSGDTDAVLPITSTRYSVDALKLPVIGPWRAWYDEGQVGGWIQEYEGVT  427

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
             V+VRGAGHEV LH+PKLAL L ++FLAG S+  LQ  SD+
Sbjct  428  LVSVRGAGHEVPLHQPKLALQLFKAFLAGNSLSPLQLHSDT  468



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   282 bits (722),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 164/225 (73%), Gaps = 17/225 (8%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NLLCD++SFIH S  C+K+ D A+ ELG+ID YSIFTP+C+ +             +VG 
Sbjct  259  NLLCDFESFIHSSVACDKMEDIATKELGNIDPYSIFTPSCSAN-------------RVGR  305

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEV----YDFWKDCPTTVL  537
            +   YDPCTE H+T+YFNLPEVQKALHV    +   W TC             D P TVL
Sbjct  306  VSEKYDPCTETHTTVYFNLPEVQKALHVSPEFAPARWETCRGATCPHHLTLIFDSPRTVL  365

Query  536  DVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEY  357
            D+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY
Sbjct  366  DIYKELIHSGLHVWVFSGDTDAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEY  425

Query  356  EGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
             GLTFV VRGAGHEV LH+PK ALTLV++FL+GT MP LQ +SDS
Sbjct  426  AGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPMPTLQLVSDS  470



>ref|XP_010525795.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=277

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL C  +SF+HPSE C KVLDTA  E+G+ID YS+FTPTC  + S    +LK+R    G 
Sbjct  43   NLSCGLESFVHPSEACQKVLDTADKEMGNIDQYSVFTPTCPANVSQSKLLLKKRP-IFGR  101

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNLPEVQKALHV    +  +W  CSD V + W D P +VL++Y 
Sbjct  102  VSEEYDPCTEKHSRVYFNLPEVQKALHVPPEFAPSKWDICSDTVSEHWIDSPPSVLNIYH  161

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD DAV+PVT+TRYSI+AL L  +SPW  WY +GQV GWTQ+Y GL 
Sbjct  162  ELIAAGLRIWVFSGDADAVVPVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLN  221

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRIS  228
            FV VRGAGHEV LHRPK +L L ++F++G  +P  ++ S
Sbjct  222  FVTVRGAGHEVPLHRPKQSLELFKAFVSGNPLPTSEKNS  260



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL C ++SF HPS+ C +VLDTA  E+G+ID YS+FTPTC  + +    +LK+R   +G 
Sbjct  255  NLRCGFESFTHPSKACIEVLDTADKEIGNIDQYSVFTPTCPGNVTQTKFLLKKRP-ILGR  313

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFNLPEVQ ALHV    +  +W TCSD V + WKD P +VL++Y 
Sbjct  314  VSENYDPCTEKHSIMYFNLPEVQTALHVPPELAPSKWETCSDTVGNHWKDSPRSVLNIYH  373

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGL IWVFSGD DAV+PVTSTRYSIDAL L  ++PWRPWY +GQVGGWTQ+Y GL 
Sbjct  374  ELIAAGLHIWVFSGDADAVVPVTSTRYSIDALNLRPLNPWRPWYIDGQVGGWTQQYVGLN  433

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV VRGAGHEV LHRPK AL L ++F++G S+P
Sbjct  434  FVTVRGAGHEVPLHRPKQALALFKAFVSGNSLP  466



>dbj|BAH20278.1| AT4G30810 [Arabidopsis thaliana]
Length=373

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SFIH S++CNK+L+ A  E+G+ID YS+FTP C  + S  + +LK+R      +
Sbjct  146  LQCGFESFIHSSKQCNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRV  204

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+H+T+YFNLPEVQKALHV    +  +W TCSD V + W D P++VL++Y E
Sbjct  205  SEQYDPCTEKHTTVYFNLPEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHE  264

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL F
Sbjct  265  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNF  324

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  325  VTVRGAGHEVPLHRPKQALALFKAFISGTPL  355



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 158/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C YQSFIHPS+ECNK+ + A  E+G+ID YS+FTP C  + S  + +LK+R    G +
Sbjct  252  LQCGYQSFIHPSKECNKIAEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TGRV  310

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+H+ +YFNLPEVQKALHV    +  +W TCS+ V   WKD  ++VL++Y E
Sbjct  311  SEQYDPCTEKHTKVYFNLPEVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHE  370

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL F
Sbjct  371  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLKF  430

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  431  VTVRGAGHEVPLHRPKQALALFKAFISGTPL  461



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SFIH S+ C+K+L+TA  E+G+ID YS+FTP C  + S  + +LK+R R    +
Sbjct  251  LQCGFESFIHSSKACDKILETADKEIGNIDQYSVFTPACIANASQSNMLLKKRPR-TSRV  309

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+HS +YFNLPEVQ+ALHV    +  +W TCSD V + WKD  ++VL++Y E
Sbjct  310  SEQYDPCTEKHSKVYFNLPEVQEALHVPPGLAPSKWDTCSDVVNEHWKDSSSSVLNIYHE  369

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL F
Sbjct  370  LIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNF  429

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  430  VTVRGAGHEVPLHRPKEALALFKAFISGTQL  460



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SFIH SE CNKVL+TA  E+G+ID YS+FTP C  + S  S++L  + R    +
Sbjct  253  LQCGFESFIHSSEACNKVLETADKEIGNIDQYSVFTPACVANAS-QSKMLLNKRRMTSRV  311

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+HS +YFNLPEV++ALHV    +S +W TCS+ V + W D P++VL++Y E
Sbjct  312  SEQYDPCTEKHSKVYFNLPEVKEALHVPPGLASSKWDTCSNVVNEHWNDSPSSVLNIYHE  371

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +S + PWY +GQVGGWTQ+Y GL F
Sbjct  372  LIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPLSTYGPWYIDGQVGGWTQQYAGLNF  431

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  432  VTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SFIH S++CNK+L+ A  E+G+ID YS+FTP C  + S  + +LK+R      +
Sbjct  252  LQCGFESFIHSSKQCNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRV  310

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+H+T+YFNLPEVQKALHV    +  +W TCSD V + W D P++VL++Y E
Sbjct  311  SEQYDPCTEKHTTVYFNLPEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHE  370

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL F
Sbjct  371  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNF  430

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  431  VTVRGAGHEVPLHRPKQALALFKAFISGTPL  461



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 156/212 (74%), Gaps = 1/212 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C  + F+H SE C K LD    E+GDID YS+FTP C  + S    +LK+R R  G 
Sbjct  248  KLKCGLEPFVHTSEVCLKALDIMDMEIGDIDQYSVFTPACVANASQAKMLLKKR-RVGGR  306

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCT +HS +YFNLPEVQ+ALHV    +  +W  CSD+V   WKD P++VL++Y 
Sbjct  307  VSEQYDPCTMKHSKVYFNLPEVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYH  366

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD DAV+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL 
Sbjct  367  ELIAAGLRIWVFSGDADAVVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLN  426

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            FV VRGAGHEV LHRPK AL L ++F++GTS+
Sbjct  427  FVTVRGAGHEVPLHRPKEALALFQAFISGTSL  458



>ref|XP_010541227.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=346

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 156/219 (71%), Gaps = 1/219 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            NL C  +SF+HPSE C KVLDTA  E+G+ID Y +FTPTC  + S    +LK+R    G 
Sbjct  112  NLSCGLESFVHPSEACQKVLDTADKEMGNIDQYIVFTPTCPANVSQSKLLLKKRP-IFGR  170

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HS +YFN PEVQKALHV    +  +W  CSD V + W D P +VL++Y 
Sbjct  171  VSEEYDPCTEKHSRVYFNPPEVQKALHVPPEFAPSKWDICSDTVSEHWNDSPPSVLNIYH  230

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI  GLRIWVFSGD DAV+PVT+TRYSI+AL L  +SPW  WY +GQV GWTQ+Y GL 
Sbjct  231  ELIAVGLRIWVFSGDADAVVPVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLN  290

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRIS  228
            FV VRGAGHEV LHRPK +L L ++F++G  +P  ++ S
Sbjct  291  FVTVRGAGHEVPLHRPKQSLELFKAFVSGNPLPTSEKNS  329



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C  + F+H SE C K LD    E+GDID YS+FTP C  + S    +LK+R R  G 
Sbjct  248  KLKCGLEPFVHTSEVCLKALDIMDMEIGDIDQYSVFTPACVANASQAKMLLKKR-RVGGR  306

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCT +HS +YFNLPEVQ+ALHV    +  +W  CSD+V   WKD P++VL++Y 
Sbjct  307  VSEQYDPCTMKHSKVYFNLPEVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYH  366

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD DAV+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL 
Sbjct  367  ELIAAGLRIWVFSGDADAVVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLN  426

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            FV VRGAGHEV LHRPK AL L ++F+ GTS+
Sbjct  427  FVTVRGAGHEVPLHRPKEALALFQAFITGTSL  458



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 158/211 (75%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SFIH S+ C+K+ + A  E+G+ID YS+FTP C  + S    +LK+R R    +
Sbjct  250  LQCGFESFIHSSKACDKIQEIADKEIGNIDQYSVFTPACIANASQSKMLLKKRPR-TSRV  308

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+HS +YFNLPEVQ+ALHV    +  +W TCSD V + WKDC ++VL++Y E
Sbjct  309  SEQYDPCTEKHSKVYFNLPEVQEALHVPPGLAPSKWDTCSDVVNEHWKDCSSSVLNIYHE  368

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL F
Sbjct  369  LIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNF  428

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  429  VTVRGAGHEVPLHRPKEALALFKAFISGTPL  459



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SF+H S+ CNK+ + A  E+G+ID YS+FTP C  + S    +LK+R      +
Sbjct  249  LQCGFESFVHSSKACNKIQEIADKEIGNIDQYSVFTPACLANASQTKMLLKKRPM-TSRV  307

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+HS +YFNLPEV+ ALHV +  +S +W TCSD V + WKDC ++VL++Y E
Sbjct  308  SEQYDPCTEKHSKVYFNLPEVKTALHVPSRLASAKWDTCSDVVNEHWKDCSSSVLNIYHE  367

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGWTQ+Y GL F
Sbjct  368  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSTYGPWYMDGQVGGWTQQYAGLNF  427

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  428  VTVRGAGHEVPLHRPKEALALFKAFISGTQL  458



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 155/204 (76%), Gaps = 0/204 (0%)
 Frame = -2

Query  860  FIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPC  681
            FI+ SE C KVL  A  E+G+ID YS+FTP C  + S  S +L ++   V  L R+YDPC
Sbjct  272  FIYASEACKKVLKIADKEMGNIDRYSVFTPACVTNSSQSSMLLNKKRPFVSDLSRVYDPC  331

Query  680  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  501
            T++HS +YFNLP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLR
Sbjct  332  TKKHSKVYFNLPKVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLR  391

Query  500  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAG  321
            IWVFSGD DA++PVTSTRYSI+AL L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+G
Sbjct  392  IWVFSGDADAIVPVTSTRYSINALNLSTISPYGPWYIDGQVGGWSQQYAGLNFVIVRGSG  451

Query  320  HEVALHRPKLALTLVESFLAGTSM  249
            HEVALHRPK AL L ++F++GT +
Sbjct  452  HEVALHRPKEALALFKAFISGTPL  475



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++SFIH S+ CNK+L+ A  E+G+ID YS+FTP C  + S  + +LK+R      +
Sbjct  252  LQCGFESFIHSSKPCNKILEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRV  310

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+H+T+YFNLPEVQKALHV    +  +W TCSD V + W D P++VL++Y E
Sbjct  311  SEQYDPCTEKHTTVYFNLPEVQKALHVPAGLAPSKWDTCSDVVNEHWNDSPSSVLNIYHE  370

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL F
Sbjct  371  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSVYGPWYLDGQVGGWSQQYAGLNF  430

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK A  L ++F++GT +
Sbjct  431  VTVRGAGHEVPLHRPKQAFALFKAFISGTPL  461



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   271 bits (693),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 157/213 (74%), Gaps = 1/213 (0%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C  + F+H SE C K LD    E+G+ID YS+FTPTC  + S    +LK+R    G 
Sbjct  248  KLKCGLEPFVHTSEVCLKALDIMDMEIGEIDQYSVFTPTCVANASQAKMLLKKRAVG-GR  306

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCT +HS +YFNLPEVQ+ALHV    +  +W  CSD V + WKD P++VL++Y 
Sbjct  307  VSEQYDPCTMKHSKVYFNLPEVQEALHVPPGLAPSKWDVCSDVVSENWKDSPSSVLNIYH  366

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD DAV+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL 
Sbjct  367  ELIAAGLRIWVFSGDADAVVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLN  426

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV VRGAGHEV LHRPK AL L ++F++GTS+P
Sbjct  427  FVTVRGAGHEVPLHRPKEALALFQAFISGTSLP  459



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C Y SFIHPS+ CNK+ + A  E+G+ID YS+FTP C  + S  + +LK+R      +
Sbjct  252  LQCGYASFIHPSKACNKIEEIAEKEIGNIDQYSVFTPACLSNASQSNMLLKKRTM-TSRV  310

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
            R  YDPCTE+H+ +YFNLPEVQ+ALHV    +  +W TCSD V + W D  ++VL++Y E
Sbjct  311  REQYDPCTEKHTKVYFNLPEVQRALHVPPGLAPSKWDTCSDVVNEHWNDSSSSVLNIYHE  370

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL F
Sbjct  371  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYSDGQVGGWSQQYAGLNF  430

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRI  231
            V VRGAGHEV LHRPK AL L ++F++G  +   + I
Sbjct  431  VTVRGAGHEVPLHRPKQALELFKAFISGAPLSTHENI  467



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 155/204 (76%), Gaps = 0/204 (0%)
 Frame = -2

Query  860  FIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPC  681
            FI+ SE C KVL  A  E+G+ID YS+FTP C  + S  S +L ++   V  L R+YDPC
Sbjct  296  FIYASEACKKVLKIADKEIGNIDRYSVFTPACVTNSSQSSMLLNKKGPFVSDLSRVYDPC  355

Query  680  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  501
            T++HS +YFNLP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLR
Sbjct  356  TKKHSKVYFNLPKVQKALHVPPQVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLR  415

Query  500  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAG  321
            IWVFSGD DA++PVTSTRYSI+AL L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+G
Sbjct  416  IWVFSGDADAIVPVTSTRYSINALNLSTLSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSG  475

Query  320  HEVALHRPKLALTLVESFLAGTSM  249
            HEVALHRPK AL L ++F++GT +
Sbjct  476  HEVALHRPKEALALFKAFISGTPL  499



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C +    H S+ECNKV D A  E G+ID YSI+TPTC ++     R+++ R      L
Sbjct  246  LACQFDVSEHASKECNKVFDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTE++ST Y+NLPEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+E
Sbjct  303  PRGYDPCTEKYSTKYYNLPEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT 
Sbjct  363  LIAAGIRIWVFSGDADSVVPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+  L L E FL G  MP
Sbjct  423  VTVRGAGHEVPLHRPRQGLKLFEHFLRGEPMP  454



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C +    H S+ECNKV D A  E G+ID YSI+TPTC ++     R+++ R      L
Sbjct  246  LACQFDVSEHASKECNKVFDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTE++ST Y+NLPEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+E
Sbjct  303  PRGYDPCTEKYSTKYYNLPEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT 
Sbjct  363  LIAAGIRIWVFSGDADSVVPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+  L L E FL G  MP
Sbjct  423  VTVRGAGHEVPLHRPRQGLKLFEHFLRGEPMP  454



>gb|ACF79757.1| unknown [Zea mays]
Length=463

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C +    H S+ECNKV D A  E G+ID YSI+TPTC ++     R+++ R      L
Sbjct  246  LACQFDVSEHASKECNKVFDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTE++ST Y+NLPEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+E
Sbjct  303  PRGYDPCTEKYSTKYYNLPEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT 
Sbjct  363  LIAAGIRIWVFSGDADSVVPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+  L L E FL G  MP
Sbjct  423  VTVRGAGHEVPLHRPRQGLKLFEHFLRGEPMP  454



>ref|XP_004968265.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=523

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 153/211 (73%), Gaps = 3/211 (1%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C++ S  HPS+ECNK+ D A  E G ID YSI+TPTC ++     R ++ R      L
Sbjct  306  LACEFDSAEHPSKECNKINDIAEAEHGSIDAYSIYTPTCKKTSLHKRRQIRGR---TPWL  362

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTE++S  Y+NLPEVQKALH + T   + WV CSD +YD+WKD P ++L +Y+E
Sbjct  363  PRGYDPCTEKYSEKYYNLPEVQKALHANVTGIPYAWVACSDPIYDYWKDSPKSMLPIYRE  422

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYDNG+VGGW Q Y+GLT 
Sbjct  423  LIAAGIRIWVFSGDADSVVPLTATRYSIDALSLPTVTNWYPWYDNGEVGGWCQVYKGLTL  482

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEVALHRP+  L L E FL    M
Sbjct  483  VTVRGAGHEVALHRPRQGLKLFEHFLRDEPM  513



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++S IH S+ C+K+ +TA  E+G+ID YS+FTP C  + S  + +LK+R R    +
Sbjct  250  LQCGFESLIHSSKACDKIQETADKEIGNIDQYSVFTPACIANASQSNMLLKKRPR-TSRV  308

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+HS +YFNLPEVQ+ALHV    +  +W TCSD V + WKD  ++VL++Y E
Sbjct  309  SEQYDPCTEKHSKVYFNLPEVQEALHVPPGLAPSKWDTCSDVVNENWKDSSSSVLNIYHE  368

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL F
Sbjct  369  LIAAGLRIWVFSGDADAVVPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNF  428

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK  L L ++F++GT +
Sbjct  429  VTVRGAGHEVPLHRPKEGLALFKAFISGTPL  459



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C  + FIH SE CN  L+ +  E+G+ID YS+FTP C  S S    +LKRR     + 
Sbjct  253  LQCGLEPFIHSSEACNNALEISYKEMGNIDHYSVFTPACVASASQSRMLLKRRPVNSRVS  312

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             + YDPCTE+HS +YFNLPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y E
Sbjct  313  EQ-YDPCTEKHSKVYFNLPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHE  371

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD DAV+PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL F
Sbjct  372  LIAAGIRIWVFSGDADAVVPVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNF  431

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  432  VTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 156/211 (74%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C YQSFIH S+EC K+ + A  E+G+ID YS+FTP C  + S  + +LK+R    G +
Sbjct  271  LQCGYQSFIHSSKECTKIEEIADKEIGNIDHYSVFTPACVANASQSNMLLKKRPI-TGRV  329

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+H+ +YFNLPEVQKALHV    +  +W TCS+ V   WKD  ++VL++Y E
Sbjct  330  SEQYDPCTEKHTKVYFNLPEVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHE  389

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL F
Sbjct  390  LIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNF  449

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  450  VTVRGAGHEVPLHRPKQALALFKAFISGTPL  480



>ref|XP_006850617.1| PREDICTED: serine carboxypeptidase-like 27 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 154/213 (72%), Gaps = 8/213 (4%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            L CD+ S +HPS EC K LD A+ E G+ID YSI++P C  S       LK + R     
Sbjct  252  LACDFGSAMHPSVECIKALDLANLEQGNIDPYSIYSPPCNAS-----ATLKNKPRGHYPW  306

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTERHS +YFNLPEVQKALH + T   + W TCSD V + W+D P ++L +YQ
Sbjct  307  MSRAYDPCTERHSKVYFNLPEVQKALHANVTGIPYPWATCSDVVGNNWQDSPKSMLPIYQ  366

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG RIWVFSGDTD+V+PVT+TRYS+DALKLPT++ W PWYDNG+VGGW+Q Y GLT
Sbjct  367  ELIAAGFRIWVFSGDTDSVVPVTATRYSLDALKLPTLTNWYPWYDNGKVGGWSQVYRGLT  426

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV + GAGHEV LHRP+ A  L +SFL   +MP
Sbjct  427  FVTITGAGHEVPLHRPRQAFILFKSFL--QNMP  457



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C  + FIH SE CN  L+ +  E+G+ID YS+FTP C  S S    +LKRR     + 
Sbjct  253  LQCGLEPFIHSSEACNNALEISYKEMGNIDHYSVFTPACVASASQSRMLLKRRPVNSRVS  312

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             + YDPCTE+HS +YFNLPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y E
Sbjct  313  EQ-YDPCTEKHSKVYFNLPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHE  371

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD DAV+PVTSTRYSIDAL L + SP+ PWY +GQVGGWTQ+Y GL F
Sbjct  372  LIAAGIRIWVFSGDADAVVPVTSTRYSIDALNLSSTSPYGPWYTDGQVGGWTQQYAGLNF  431

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  432  VTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = -2

Query  860  FIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRK-VGLLRRIYDP  684
            FI+ +E C KVL  A  E+G+ID YS+FTP C  + S  S +L  + R  V  L R+YDP
Sbjct  259  FIYATEACKKVLKIADKEMGNIDRYSVFTPACVVTNSSQSSMLLNKKRPFVSDLSRVYDP  318

Query  683  CTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGL  504
            CT++HS +YFNLP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGL
Sbjct  319  CTKKHSKVYFNLPKVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGL  378

Query  503  RIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGA  324
            RIWVFSGD DA++PVTSTRYSI+AL L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+
Sbjct  379  RIWVFSGDADAIVPVTSTRYSINALNLSTTSPYGPWYIDGQVGGWSQQYAGLNFVIVRGS  438

Query  323  GHEVALHRPKLALTLVESFLAGTSM  249
            GHEVALHRPK AL L ++F++GT +
Sbjct  439  GHEVALHRPKEALALFKAFISGTPL  463



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C++ S  HPS  C K LD A  E GDID YSIFT  C  + S+   +          + R
Sbjct  252  CEFGSSQHPSVACIKALDAADKEDGDIDPYSIFTRPCNNTASLRHNLRGHYP----WMTR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+ST+YFN PEVQK+LH + T  S+ W TCSD V D+W D P ++L +YQELI
Sbjct  308  AYDPCTERYSTMYFNQPEVQKSLHANVTGISYPWKTCSDIVGDYWADSPLSMLPIYQELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLTFV 
Sbjct  368  AAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQVYKGLTFVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L +SFL    MP
Sbjct  428  VTGAGHEVPLHRPREAFILFKSFLENKPMP  457



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 155/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C YQSFIH S+ECNK+ + A  E+G+ID YS+FTP C    S  + +LK+R    G +
Sbjct  253  LQCGYQSFIHSSKECNKIEEIADKEIGNIDQYSVFTPACVAKASQSNMLLKKRPI-TGRV  311

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+H+ +YFNLPEVQKALHV    +  +W TCS+ V   WKD  ++VL++Y E
Sbjct  312  SEQYDPCTEKHTKVYFNLPEVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHE  371

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD DAV+PVTSTR+SIDAL L  +S + PWY + QVGGW+Q+Y GL F
Sbjct  372  LIAAGLRIWVFSGDADAVVPVTSTRHSIDALNLHPLSVYGPWYLDEQVGGWSQQYAGLNF  431

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  432  VTVRGAGHEVPLHRPKQALALFKAFISGTPL  462



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS +C K LD A  E+G+ID YSI+T  C  + S     L+RR R     + 
Sbjct  255  CDLGSSTHPSSDCVKSLDLADKEMGNIDPYSIYTRPCNSASS-----LRRRLRGHYPWMS  309

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S IYFNLPEVQ ALH + T  S+ W +CSD V ++W D P +VL +YQEL
Sbjct  310  RAYDPCTERYSEIYFNLPEVQNALHANVTRISYPWQSCSDIVGNYWADTPLSVLPIYQEL  369

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AG RIWVFSGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLT V
Sbjct  370  IAAGHRIWVFSGDTDAVVPVTATRYSIDALKLPTITKWYPWYDNGKVGGWSQVYKGLTLV  429

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  430  TVTGAGHEVPLHRPRQAFILFRSFLENKPMP  460



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 4/213 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N  CD++   HPSE C+K +D A  E G+ID YSIFTPTC+ + S    + K R R    
Sbjct  247  NANCDFEVSEHPSEACDKTMDIAYVEQGNIDAYSIFTPTCSATISQRRNLRKIRPR----  302

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNLPEVQKALH + T   + W TC+D + D WKD P ++L +Y+
Sbjct  303  ISVPYDPCTEKHSTVYFNLPEVQKALHANVTGIPYPWATCNDIIGDNWKDSPRSMLPIYR  362

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGDTD+V+PVT+TRYS+D L+LPT+  W PWYDNGQ+GGW++ Y+GL+
Sbjct  363  ELIAAGIRIWVFSGDTDSVVPVTATRYSLDTLELPTLVKWHPWYDNGQMGGWSEVYDGLS  422

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             + VRGAGHEV LH P+ A  + +SFL    MP
Sbjct  423  LIVVRGAGHEVPLHAPRKAYIMFKSFLENKPMP  455



>ref|XP_002457307.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
 gb|EES02427.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
Length=463

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 153/212 (72%), Gaps = 3/212 (1%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C ++   H S+ECNK+   A  E G+ID YSI+TPTC ++     R+++ R      L
Sbjct  246  LACQFEVSEHASKECNKMFGIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTE++ST Y+NLPEVQKALH + T   + WVTCSD VYDFWKD P ++L +Y+E
Sbjct  303  PRGYDPCTEKYSTKYYNLPEVQKALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +VGGW Q Y+GLT 
Sbjct  363  LIAAGLRIWVFSGDADSVVPLTATRYSIDALFLPTVTNWYPWYDDEEVGGWCQVYKGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V +RGAGHEV LHRP+  L L E FL    MP
Sbjct  423  VTIRGAGHEVPLHRPRQGLKLFEHFLRDEPMP  454



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C  + FIH S+ CN  L+ +  E+G+ID YS+FTP C  S S  SR+L  R      +
Sbjct  253  LQCGLEPFIHSSDACNNALEISYKEMGNIDHYSVFTPACVASAS-QSRMLLNRRPVNSRV  311

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
               YDPCTE+HS +YFNLPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y E
Sbjct  312  SEQYDPCTEQHSKVYFNLPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHE  371

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG+RIWVFSGD DAV+PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL F
Sbjct  372  LIAAGIRIWVFSGDADAVVPVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNF  431

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  432  VTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_002457308.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
 gb|EES02428.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
Length=467

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 154/210 (73%), Gaps = 3/210 (1%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C Y +  HPSEEC K+ + A DE GDID YS++TPTC ++  +  R ++ R   +  L R
Sbjct  252  CKYDAAQHPSEECQKIYEVAYDEQGDIDFYSLYTPTCKKTSLLKRRQIRGR---MPWLPR  308

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTE + T Y+NLPEVQ+A H + T   + W+ CSD VY++W+D P ++L +Y+ELI
Sbjct  309  GYDPCTELYFTKYYNLPEVQEAFHANVTGIPYAWIGCSDPVYEYWQDSPRSMLPIYRELI  368

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            +AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V 
Sbjct  369  SAGLRIWVFSGDTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVT  428

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            VRGAGHEV LHRP+  L L+E FL G  MP
Sbjct  429  VRGAGHEVPLHRPRQGLKLLEHFLQGEPMP  458



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 149/211 (71%), Gaps = 4/211 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD++S  HPS EC K L  A  E G+ID YSIFT  C  + ++   +          + R
Sbjct  251  CDFESSTHPSVECIKALMLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSR  306

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN PEVQKALH + T   + W TCSD V D+W D P ++L +Y+ELI
Sbjct  307  AYDPCTERYSKVYFNHPEVQKALHANVTGIPYPWKTCSDIVGDYWADSPLSMLPIYKELI  366

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+FV 
Sbjct  367  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVT  426

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            V GAGHEV LHRP+ A  L  SFL   SMPG
Sbjct  427  VTGAGHEVPLHRPRQAFILFRSFLKNKSMPG  457



>ref|XP_006645520.1| PREDICTED: serine carboxypeptidase II-1-like [Oryza brachyantha]
Length=412

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD+ S  HPS+ C+K+ + A  E G+ID YSI+TPTC ++  +  R++K     +  L R
Sbjct  197  CDFGSSAHPSKACDKIYEVAEAEQGNIDAYSIYTPTCKKTSFLKRRLIKG---NMPWLPR  253

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTE++ST Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI
Sbjct  254  GYDPCTEKYSTKYYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELI  313

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V 
Sbjct  314  AAGLRIWVFSGDADSVVPLTATRYSIDALHLPTVTNWYPWYDDDEVAGWCQVYQGLTLVT  373

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  374  IRGAGHEVPLHRPRQALKLFEHFLQDNPMP  403



>ref|XP_004968264.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=463

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 151/212 (71%), Gaps = 3/212 (1%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L C+++   HPS+EC K+L+ AS E G IDTYSI+TPTC ++     R+++ R      L
Sbjct  246  LTCEFEVSEHPSKECEKILEVASAEQGKIDTYSIYTPTCKKTSLHRHRLIRGR---TPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCT ++ST Y+NLPEVQKALH + T   + WV CSD +Y +WKD P ++L +Y+E
Sbjct  303  PRGYDPCTTQYSTKYYNLPEVQKALHANVTGIPYAWVACSDPIYKYWKDSPRSMLPIYRE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG RIWVFSGD DAV+P+  TRYSIDAL LPT+S W  WYD G+VGGW Q Y+GLT 
Sbjct  363  LIAAGKRIWVFSGDADAVVPLPGTRYSIDALFLPTISNWYAWYDQGEVGGWCQVYKGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V +RGAGHEV LHRP+L L L E FL    MP
Sbjct  423  VTIRGAGHEVPLHRPRLGLKLFEHFLRDEPMP  454



>ref|NP_001042076.1| Os01g0158200 [Oryza sativa Japonica Group]
 dbj|BAD61439.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF03990.1| Os01g0158200 [Oryza sativa Japonica Group]
 gb|EAZ10621.1| hypothetical protein OsJ_00453 [Oryza sativa Japonica Group]
 dbj|BAG92359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=471

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             + CD++S  H SE CNK+ + A  E G+ID YSI+TPTC ++ S + R L R +     
Sbjct  253  QVACDFESSAHASEACNKIYEVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGNSP--W  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+
Sbjct  310  LPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT
Sbjct  370  ELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  430  LVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  462



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 149/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD+ S  HPS  C K  D A  E G ID YSIFT  C+ + S     L+R  R     + 
Sbjct  252  CDFGSSQHPSVACIKAFDVADKEQGSIDPYSIFTRPCSSAIS-----LRRNLRGHYPWMP  306

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S IYFN PEVQKALH + T  S+ W TCSD V D+W D P ++L +Y+EL
Sbjct  307  RAYDPCTERYSIIYFNRPEVQKALHANLTAISYPWKTCSDIVGDYWADSPLSMLPIYEEL  366

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTDAV+P+T+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLTFV
Sbjct  367  IAAGLRIWVFSGDTDAVVPLTATRYSIDALKLPTVMNWYPWYDHGKVGGWSQVYKGLTFV  426

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             VRGAGHEV LHRP+  L L + FL    MP
Sbjct  427  TVRGAGHEVPLHRPRQVLILFKYFLENKPMP  457



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS++C K L  A  E G+ID YSI+TP C  S S     L+RR R     + 
Sbjct  254  CDTGSSTHPSDDCVKSLLQAEKEQGNIDPYSIYTPPCNASSS-----LRRRFRVHFPWMP  308

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTERHST+YFNLPEVQ+A H +TT   + W TCSD V  +W D P +VL +YQ L
Sbjct  309  RAYDPCTERHSTVYFNLPEVQEAFHANTTGIPYPWKTCSDTVGIYWTDAPLSVLPIYQGL  368

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            + AGL+IWVFSGDTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GL FV
Sbjct  369  MAAGLKIWVFSGDTDSVVPITATRYSIDALKLPTITNWYPWYDNKRVGGWSQVYKGLIFV  428

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+LA  L  SFL    MP
Sbjct  429  TVTGAGHEVPLHRPRLAYILFRSFLENEPMP  459



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 150/211 (71%), Gaps = 4/211 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD++S  HPS EC K L  A  E G+ID YSIFT  C  + ++   +          + R
Sbjct  251  CDFESSTHPSVECIKALMLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSR  306

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCT+R+S +YFN PEVQKALH + T   ++W TCSD V D+W D P ++L +Y+EL+
Sbjct  307  AYDPCTDRYSKVYFNHPEVQKALHANVTGIPYQWKTCSDIVGDYWADSPLSMLPIYKELM  366

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+FV 
Sbjct  367  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVT  426

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            V GAGHEV LHRP+ A  L  SFL   SMPG
Sbjct  427  VTGAGHEVPLHRPRQAFILFRSFLENKSMPG  457



>dbj|BAB08188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             + CD++S  H SE CNK+ + A  E G+ID YSI+TPTC ++ S + R L R +     
Sbjct  253  QVACDFESSAHASEACNKIYEVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGNSP--W  309

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+
Sbjct  310  LPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYR  369

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT
Sbjct  370  ELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLT  429

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  430  LVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  462



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 150/213 (70%), Gaps = 6/213 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            + CD  S  HPS EC   L+ A  E G+ID YSIFT  C ++ S     L+R  R     
Sbjct  248  VACDLGSATHPSSECTTALEVAEAEQGNIDPYSIFTQPCADTTS-----LRRNLRGHYPW  302

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R +DPCTER+S  YFN PEVQKALH + T   ++W TCSD V   W D P ++L +YQ
Sbjct  303  MSRAFDPCTERYSKEYFNRPEVQKALHANVTGIPYQWETCSDVVGYNWTDSPLSMLPIYQ  362

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+QEY+GLT
Sbjct  363  ELIAAGIRIWVYSGDTDAVVPVTATRYSIDALKLPTINKWHPWYDNGKVGGWSQEYKGLT  422

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV V GAGHEV LHRP+ A  L  SFL   SMP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKSMP  455



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 152/212 (72%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + C++ S  HPS +C + L  A+ E G+ID YS++T  C  + S + R LK R      +
Sbjct  250  IACNFGSSQHPSVQCMQALRVATVEQGNIDPYSVYTQPCNNTAS-LRRGLKGR---YPWM  305

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKALH + T   + W  CSD V ++W D P ++L +YQE
Sbjct  306  SRAYDPCTERYSDLYFNRPEVQKALHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYQE  365

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI+AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT 
Sbjct  366  LISAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTL  425

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+ A  L  SFL   SMP
Sbjct  426  VTVRGAGHEVPLHRPRQAFILFRSFLENKSMP  457



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             + CD++S  H SE CNK+ + A  E G+ID YSI+TPTC ++ S + R L R +  +  
Sbjct  256  QVACDFESSAHASEACNKIYEVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGN--LPW  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++S  Y+NLPEVQKA H + T   + W TCSD+++ +WKD P ++L +Y+
Sbjct  313  LPRGYDPCTEKYSMKYYNLPEVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYR  372

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT
Sbjct  373  ELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLT  432

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  433  LVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  465



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 152/211 (72%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS EC + L  A  E G+ID YSI+T  C  + S     LKR  R     + 
Sbjct  249  CDLGSSQHPSVECMRALKIAETEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMS  303

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+EL
Sbjct  304  RAYDPCTERYSEVYFNRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSILPIYREL  363

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW +NG+VGGW+Q Y+GLTFV
Sbjct  364  IAAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWNNNGKVGGWSQVYKGLTFV  423

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+LA+ L  SFLA  +MP
Sbjct  424  TVTGAGHEVPLHRPRLAVILFRSFLASKAMP  454



>gb|ABK21145.1| unknown [Picea sitchensis]
Length=343

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRD-RKVGLLR  699
            CD+ S  HPS++C + +D A  ELG+ID YSI+TP+C  S S   ++      R  G   
Sbjct  129  CDFTSSQHPSDQCQRAMDLADLELGNIDQYSIYTPSCNISGSQRHKLRSHHPWRSYG---  185

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
              YDPCTE +S +YFN PEVQKA H + T+ S+ W TCSD +  +W+D P ++L +YQEL
Sbjct  186  --YDPCTESYSALYFNRPEVQKAFHANVTSISYSWTTCSDILEKYWQDSPRSMLPIYQEL  243

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            + AG+RIWVFSGDTDAV+PVT+TRYSIDAL+L T+  W PWYDN +VGGWTQ Y+GLT V
Sbjct  244  LRAGIRIWVFSGDTDAVVPVTATRYSIDALRLRTIVNWYPWYDNQEVGGWTQIYKGLTLV  303

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             +RGAGHEV LH+P+ A  L ++FL G  MP
Sbjct  304  TIRGAGHEVPLHQPRKAFILFKAFLKGKPMP  334



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S +HPS EC K L+ A  E G+ID YSIFT  C ++ S     L+R+ R     + 
Sbjct  246  CDLGSSMHPSNECTKALNLAEAEQGNIDPYSIFTRPCNDTSS-----LRRKLRGHYPWMS  300

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFNLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQEL
Sbjct  301  RAYDPCTERYSEVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQEL  360

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTDAV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLTFV
Sbjct  361  IAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTITNWYXWYDNHKVGGWSQVYKGLTFV  420

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  421  TVTGAGHEVPLHRPRQAYILFRSFLENKPMP  451



>ref|XP_012086498.1| PREDICTED: serine carboxypeptidase-like 27 [Jatropha curcas]
 gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + C++ S +HPS +C K L  A  E G+ID YSIFT  C  + S+   +          +
Sbjct  248  IACNFSSSMHPSVDCIKALYLAQLEQGNIDPYSIFTRPCNNTASLRHNLRGHYP----WM  303

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+E
Sbjct  304  SRAYDPCTERYSKLYFNRPEVQKALHANATGISYPWKTCSDIVGNYWADAPLSMLPIYKE  363

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLTF
Sbjct  364  LIAAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWSQVYKGLTF  423

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V V GAGHEV LHRP+ A  L +SFL    MP
Sbjct  424  VTVTGAGHEVPLHRPRQAFILFKSFLENKPMP  455



>dbj|BAK06862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   248 bits (634),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + S  HPS EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R
Sbjct  21   CLFDSSEHPSPECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSR  76

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI
Sbjct  77   AYDPCTERYSNIYYNLPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELI  136

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  137  AAGIRIWVFSGDTDAVVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVT  196

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ AL L   FL  T MP
Sbjct  197  VAGAGHEVPLHRPRQALILFRHFLKDTPMP  226



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 148/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L CD+ S  HPS EC K L  A  E G+ID YSIFT  C  + ++   +          +
Sbjct  249  LTCDFVSSTHPSVECMKALKLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+E
Sbjct  305  SRAYDPCTERYSKVYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLTF
Sbjct  365  LIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTF  424

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            V V GAGHEV LHRP+ A  L  SFL   SMPG
Sbjct  425  VTVTGAGHEVPLHRPRQAFILFMSFLGNKSMPG  457



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS EC + L  A  E G+ID YSI+T  C  + S     LKR  R     + 
Sbjct  249  CDLGSSQHPSVECMRALKIAETEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMS  303

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+EL
Sbjct  304  RAYDPCTERYSEVYFNRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSMLPIYKEL  363

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGGW+Q Y+GLTFV
Sbjct  364  IAAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWNDNGKVGGWSQVYKGLTFV  423

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+LA  L  SFL   +MP
Sbjct  424  TVTGAGHEVPLHRPRLAFILFRSFLGSKAMP  454



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   255 bits (652),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS  CN  L+ A  E G+ID YSI+T  C  + S M R L  R      + R
Sbjct  247  CLSGSSQHPSIICNTALEAADSEFGNIDPYSIYTRPCKSTAS-MKRSLNGR---YPWMSR  302

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+ST YFN P+VQ ALH ++T  S+ W TCSD V ++W + P T+L +YQELI
Sbjct  303  AYDPCTERYSTEYFNRPDVQLALHANSTKISYPWSTCSDIVGNYWSESPLTMLPIYQELI  362

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+P+T+TRYSIDALKLPTV+ W PWYDNG+VGGW+Q YEGLTFV 
Sbjct  363  AAGLRIWVYSGDTDAVVPITATRYSIDALKLPTVTNWYPWYDNGRVGGWSQVYEGLTFVT  422

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            ++GAGHEV LHRP+ A  L   FL   SMP
Sbjct  423  IKGAGHEVPLHRPRQAFILFNHFLKNKSMP  452



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 150/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S +HPS +C + L  A  E G+ID YSI+TP C  + S+ S +  R       +
Sbjct  249  IACDFGSSLHPSVQCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTERHS +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y E
Sbjct  305  SRAYDPCTERHSDVYFNCPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT 
Sbjct  365  LINAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTL  424

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V +RGAGHEV LH+P+ A  L  SFL    MP
Sbjct  425  VTIRGAGHEVPLHKPREAFILFRSFLENKDMP  456



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 150/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S +HPS +C + L  A  E G+ID YSI+TP C  + S+ S +  R       +
Sbjct  249  IACDFGSSLHPSVQCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTERHS +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y E
Sbjct  305  SRAYDPCTERHSDVYFNRPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT 
Sbjct  365  LINAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTL  424

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V +RGAGHEV LH+P+ A  L  SFL    MP
Sbjct  425  VTIRGAGHEVPLHKPREAFILFRSFLENKDMP  456



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 150/214 (70%), Gaps = 6/214 (3%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVG  708
             + CD  S  HPS EC   L+ A  E G+ID YSIFT  C ++ S     L+R  R    
Sbjct  247  QVACDMGSATHPSSECTTALEVAEAEQGNIDPYSIFTQPCADTTS-----LRRNLRGHYP  301

Query  707  LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVY  528
             + R +DPCTER+S  YFN PEVQKALH + T   ++W TCSD +   W D P ++L +Y
Sbjct  302  WMSRAFDPCTERYSKEYFNRPEVQKALHANVTGIPYQWETCSDVIGYNWTDSPLSMLPIY  361

Query  527  QELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGL  348
            QELI AG+RIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWY+NG+VGGW+QEY+GL
Sbjct  362  QELIAAGIRIWVYSGDTDAVVPVTATRYSIDALKLPTINKWHPWYENGKVGGWSQEYKGL  421

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            TFV V GAGHEV LHRP+ A  L  SFL   SMP
Sbjct  422  TFVTVTGAGHEVPLHRPRQAFILFRSFLENKSMP  455



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 149/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S +HPS EC K L+ A  E G+ID YSIFT  C ++ S     L+R  R     + 
Sbjct  250  CDLGSSMHPSSECTKALNLAEAEQGNIDPYSIFTRPCNDTSS-----LRRNLRGHYPWMS  304

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFNLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQEL
Sbjct  305  RAYDPCTERYSEVYFNLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQEL  364

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTDAV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLTFV
Sbjct  365  IAAGLRIWVFSGDTDAVVPVTATRYSIDALKLPTITNWYAWYDNHKVGGWSQVYKGLTFV  424

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  425  TVTGAGHEVPLHRPRQAYILFRSFLENKPMP  455



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 153/212 (72%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E G ID YSI+T TC  E+ ++ SR L+ R      
Sbjct  241  ITCEFVSSEHPSPECSKAMEAADKEQGGIDPYSIYTITCKKEAAALRSRFLRVRHP---W  297

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S+ YFN PEVQKA+H +TT  +++W TCSD V + W D P ++L +Y+
Sbjct  298  MWRAYDPCTERYSSTYFNSPEVQKAMHANTTGLAYQWKTCSDIVGEKWSDSPLSMLPIYK  357

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGDTD+V+PVT TRYSI ALKLP VS W PWYDNGQVGGW+Q Y+GLT
Sbjct  358  ELIAAGIRIWVFSGDTDSVVPVTGTRYSIRALKLPPVSKWYPWYDNGQVGGWSQVYKGLT  417

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
             V + GAGHEV LHRP+    L +SFLA   M
Sbjct  418  LVTIHGAGHEVPLHRPRRGFLLFKSFLANKPM  449



>ref|XP_008805039.1| PREDICTED: serine carboxypeptidase-like 27 [Phoenix dactylifera]
Length=461

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 152/210 (72%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C+ QS  HPS EC K L+ AS E G+ID YSI+T  C +S S + R L+ R      + R
Sbjct  255  CNLQSSQHPSAECVKNLNVASTEQGNIDPYSIYTSPCNDS-SALKRNLRGR---YPWMSR  310

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCT+R++ +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI
Sbjct  311  AYDPCTDRYAKVYYNRPEVQRALHANVTGIHYAWDTCSDIVGNYWADSPRSMLPIYQELI  370

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLTFV 
Sbjct  371  AAGVRIWVFSGDTDAVVPVTATRYSIDALKLPTLLRWYPWYDHGKVGGWSQVYKGLTFVT  430

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL L   FL    MP
Sbjct  431  ITGAGHEVPLHRPRQALILFRHFLQNKPMP  460



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD+ S  HPS EC + L  A  E G+ID YSIFT  C  + S+   +          + R
Sbjct  191  CDFGSAQHPSVECMRALKMAEMEQGNIDPYSIFTRPCNSTESLKHNLRGHYP----WMSR  246

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+ELI
Sbjct  247  AYDPCTERYSEVYFNHPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELI  306

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLTFV 
Sbjct  307  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVT  366

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V GAGHEV LHRP+ A  + +SFL G  M
Sbjct  367  VTGAGHEVPLHRPRQAFIVFKSFLEGKPM  395



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   253 bits (646),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            L CD+ S  HPS EC K L  A  E G+ID YSIFT  C  + ++   +          +
Sbjct  249  LTCDFVSSTHPSVECMKALKLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+E
Sbjct  305  SRAYDPCTERYSKVYFNRPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLTF
Sbjct  365  LIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTF  424

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            V V GAGHEV L RP+ A  L  SFL   SMPG
Sbjct  425  VTVTGAGHEVPLRRPRQAFILFMSFLGNKSMPG  457



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 150/213 (70%), Gaps = 6/213 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            + CD  S  HPS +C K L  A  E G+ID YSI+T  C  + S     L+R  R     
Sbjct  248  ITCDKGSSEHPSTDCTKALLLAEQEQGNIDPYSIYTRPCASTSS-----LRRNLRGHYPW  302

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFNLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQ
Sbjct  303  MSRAYDPCTERYSEVYFNLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQ  362

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI+AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELISAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLT  422

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V V GAGHEV LHRP+ A  L+ SFL    MP
Sbjct  423  LVTVTGAGHEVPLHRPRQAFILLRSFLENKPMP  455



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 149/213 (70%), Gaps = 6/213 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            + CD  S  HPS +C K L  A  E G+ID YSI+T  C  + S     L+R  R     
Sbjct  248  ITCDKGSSEHPSTDCTKALLLAEQEQGNIDPYSIYTRPCASTSS-----LRRNLRGHYPW  302

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S IYFNLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQ
Sbjct  303  MSRAYDPCTERYSEIYFNLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQ  362

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLRIWVFSGDTDSVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLT  422

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V V GAGHEV LHRP+ A  L+ SFL    MP
Sbjct  423  LVTVTGAGHEVPLHRPRQAFILLRSFLENKPMP  455



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 151/210 (72%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C+ QS  HPS EC K L+ A  E G+ID YSI+T  C +S S + R LK R      + R
Sbjct  256  CNLQSSQHPSAECVKNLNIAGSEQGNIDPYSIYTRPCNDS-SALKRNLKGR---YPWMSR  311

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCT+R++ +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI
Sbjct  312  AYDPCTDRYAKVYYNRPEVQRALHANVTGIRYAWDTCSDIVGNYWADSPRSMLPIYQELI  371

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+PVT+TRYSIDAL+LPT+  W PWYD+G+VGGW+Q Y+GLTFV 
Sbjct  372  AAGVRIWVFSGDTDAVVPVTATRYSIDALELPTLRRWYPWYDHGKVGGWSQVYKGLTFVT  431

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL L   FL    MP
Sbjct  432  ITGAGHEVPLHRPRQALILFRHFLQNKPMP  461



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 150/212 (71%), Gaps = 25/212 (12%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C ++SFIH S++CNK+L+ A  E+G+ID YS+FTP C  + S               
Sbjct  221  QLQCGFESFIHSSKQCNKILEIADKEIGNIDQYSVFTPACVANAS---------------  265

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
                YDPCTE+H+T+YFNLPEVQKALH+        W+ CSD V + W D P++VL++Y 
Sbjct  266  -HEQYDPCTEKHTTVYFNLPEVQKALHL--------WL-CSDVVSEHWNDSPSSVLNIYH  315

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL 
Sbjct  316  ELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLN  375

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
            FV VRGAGHEV LHRPK AL L ++F++GT +
Sbjct  376  FVTVRGAGHEVPLHRPKQALALFKAFISGTPL  407



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + C++ S  HPS +C + L  A+ E G+ID YS++T  C  + S + R LK R      +
Sbjct  250  IACNFGSSQHPSVQCMQALRVATVEQGNIDPYSVYTRPCNNTAS-LRRGLKGR---YPWM  305

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKA H + T   + W  CSD V ++W D P ++L +Y+E
Sbjct  306  SRAYDPCTERYSDLYFNRPEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRE  365

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI+AGLRIWV+SGDTDAV+P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT 
Sbjct  366  LISAGLRIWVYSGDTDAVVPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTL  425

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+ A  L  SFL   SMP
Sbjct  426  VTVRGAGHEVPLHRPRQAFILFRSFLENKSMP  457



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + C++ S  HPS +C + L  A+ E G+ID YS++T  C  + S + R LK R      +
Sbjct  249  IACNFGSSQHPSVQCMQALRVATVEQGNIDPYSVYTRPCNNTAS-LRRGLKGR---YPWM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKA H + T   + W  CSD V ++W D P ++L +Y+E
Sbjct  305  SRAYDPCTERYSDLYFNRPEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI+AGLRIWV+SGDTDAV+P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT 
Sbjct  365  LISAGLRIWVYSGDTDAVVPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTL  424

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+ A  L  SFL   SMP
Sbjct  425  VTVRGAGHEVPLHRPRQAFILFRSFLENKSMP  456



>ref|XP_003564543.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=451

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + S  HPS EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R
Sbjct  244  CIFDSSEHPSPECVKNLNLASSEEGNIDPYSLYTKPCNNSASLKLGLGGRYP----WLSR  299

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER++ +Y+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  300  AYDPCTERYANVYYNLPEVQMALHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELI  359

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  360  AAGIRIWVFSGDTDAVVPVTATRYSIKALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVT  419

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ AL L   FL  T MP
Sbjct  420  VTGAGHEVPLHRPRQALILFRHFLKDTPMP  449



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 149/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD QS  HPS  C KVL+ A++ELG+ID YSI+T  C E+       LKR+ R     + 
Sbjct  265  CDLQSSQHPSAGCLKVLEAAANELGNIDPYSIYTRACNET-----TTLKRKLRGHYPWMS  319

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTE ++ +Y+N PEVQ ALH + T   + W TCS+ V + W D P ++L +Y+EL
Sbjct  320  RAYDPCTENYAEVYYNRPEVQMALHANVTGIPYPWNTCSNIVGNHWADSPRSMLPIYREL  379

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTD+V+PVT+TRYSIDAL L TV  W PWYDNG+VGGWTQ YEGLTFV
Sbjct  380  IAAGLRIWVFSGDTDSVVPVTATRYSIDALNLSTVISWYPWYDNGKVGGWTQVYEGLTFV  439

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+ AL L + FL    MP
Sbjct  440  TVXGAGHEVPLHRPRQALVLFKHFLQNRPMP  470



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      
Sbjct  239  ITCEFVSSEHPSPECSKAIEAADKEQGDIDPYSIYTVTCKKEAAALRSRFLRVRHP---W  295

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+
Sbjct  296  MWRAYDPCTERYSGMYFNSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYK  355

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+PVT TRYSI ALKL  VS W PWYDNGQVGGW+Q Y+GLT
Sbjct  356  ELIGAGLRIWVFSGDTDSVVPVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLT  415

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
             V + GAGHEV LHRP+    L +SFL    M
Sbjct  416  LVTIHGAGHEVPLHRPRRGFLLFQSFLNNKPM  447



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S  HPS +C   L  A  E G+ID YSI+TP C ++ S + R L  R      +
Sbjct  251  IACDFGSSQHPSVQCMTALRVAVAEQGNIDPYSIYTPPCNDTAS-LRRGLNGR---YPWM  306

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +YQE
Sbjct  307  SRAYDPCTERYSDLYFNRPEVQKALHANVTGISYPWKTCSDIVGNYWTDSPLSMLPIYQE  366

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI A LRIWV+SGDTDAV+P+T+TR+SIDALKLPT+  W PWYD+G+VGGW+Q Y+GLTF
Sbjct  367  LINASLRIWVYSGDTDAVVPLTATRHSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTF  426

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+ +  L  SFL    MP
Sbjct  427  VTVRGAGHEVPLHRPRESFILFRSFLENKYMP  458



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CD+ S  HPS +C + L  A  E G+ID YSI TP C  + S+ S +  R       
Sbjct  248  NIGCDFGSIQHPSVQCLQALTVAITEQGNIDGYSINTPPCNNTASLRSGLHDRYP----W  303

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPC ER+S +YFN PEVQKALH + T  S+ W  CS  V+D+W D P ++L +YQ
Sbjct  304  MYRAYDPCAERYSDVYFNRPEVQKALHANVTGISYAWKACSGTVWDYWTDSPLSMLPIYQ  363

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI A LRIWV+SGDTDAVIP+T+TRYSI ALKLPT+  W PWYDNG+V GW+Q Y+GLT
Sbjct  364  ELINADLRIWVYSGDTDAVIPLTATRYSIGALKLPTIMNWYPWYDNGKVCGWSQVYKGLT  423

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V VRGAGHEV LHRP+ A  L  SFL   +MP
Sbjct  424  LVTVRGAGHEVPLHRPREAFILFRSFLENKNMP  456



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD QS  HPS EC KVLD A+ E G ID YSI+T  CT++ S     LKR+ R     + 
Sbjct  271  CDLQSSTHPSAECVKVLDAATIEQGHIDPYSIYTSPCTDATS-----LKRKIRGHYPWMS  325

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTE ++ +Y+N PEVQKALH + T   + W TCS+ V  +W D P ++L +Y+EL
Sbjct  326  RAYDPCTENYARVYYNHPEVQKALHANVTGIPYPWDTCSNIVGIYWADSPRSMLPIYREL  385

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTD+V+P+T+TRYSIDAL L TV  W PWYD+G+VGGWTQ YEGLTFV
Sbjct  386  IAAGLRIWVFSGDTDSVVPLTATRYSIDALNLSTVISWYPWYDHGKVGGWTQVYEGLTFV  445

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             VRGAGHEV LHRP+ AL L   FL    MP
Sbjct  446  TVRGAGHEVPLHRPRQALILFRHFLQDKLMP  476



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 145/209 (69%), Gaps = 4/209 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD+ S  HPS EC + L  A  E G+ID YSIFT  C  + S+   +          + R
Sbjct  249  CDFGSTQHPSVECMRALKIAEMEQGNIDPYSIFTRPCNSTESLKHNLRGHYP----WMSR  304

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+ELI
Sbjct  305  AYDPCTERYSEVYFNHPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELI  364

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLTFV 
Sbjct  365  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVT  424

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V GAGHEV LHRP+ A  +  SFL G  M
Sbjct  425  VTGAGHEVPLHRPRQAFIVFRSFLEGKPM  453



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 150/214 (70%), Gaps = 6/214 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S +HPS +C + L  A  E G+ID YSI+TP C  + S+ S +  R       +
Sbjct  249  IACDFGSSLHPSVQCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTERHS +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y E
Sbjct  305  SRAYDPCTERHSDVYFNRPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ--VGGWTQEYEGL  348
            LI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT+  W PWYD+G+  VGGW+Q Y+GL
Sbjct  365  LINAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGVGGWSQVYKGL  424

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            T V +RGAGHEV LH+P+ A  L  SFL    MP
Sbjct  425  TLVTIRGAGHEVPLHKPREAFILFRSFLENKDMP  458



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      
Sbjct  239  ITCEFVSSEHPSPECSKAIEAADKEQGDIDPYSIYTVTCKKEAAALRSRFLRVRHP---W  295

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+
Sbjct  296  MWRAYDPCTERYSGMYFNSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYK  355

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKL  VS W PWYDNGQVGGW+Q Y+GLT
Sbjct  356  ELIGAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLT  415

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
             V + GAGHEV LHRP+    L +SFL    M
Sbjct  416  LVTIHGAGHEVPLHRPRRGFLLFQSFLNNKPM  447



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 150/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      
Sbjct  239  ITCEFVSSEHPSPECSKAIEAADKEQGDIDPYSIYTVTCKREAAALRSRFLRVRHP---W  295

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+
Sbjct  296  MWRAYDPCTERYSGMYFNSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYK  355

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+PVT TRYSI ALKL  VS W PWYDNGQVGGW+Q Y GLT
Sbjct  356  ELIGAGLRIWVFSGDTDSVVPVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYNGLT  415

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
             V + GAGHEV LHRP+    L +SFL    M
Sbjct  416  LVTIHGAGHEVPLHRPRRGFLLFQSFLNNKPM  447



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   250 bits (639),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 149/212 (70%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + C++ S  HPS +C + L  A+ E G+ID YS++T  C  + S + R LK R      +
Sbjct  250  IACNFGSSQHPSVQCMQALRVATVEQGNIDPYSVYTQPCNNTAS-LRRGLKGR---YPWM  305

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S  YFN PEVQKA H + T   +EW  CSD V ++W D P ++L +YQE
Sbjct  306  SRAYDPCTERYSDSYFNRPEVQKAFHANVTGIPYEWKACSDIVGNYWTDSPLSMLPIYQE  365

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AG RIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT 
Sbjct  366  LIRAGYRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTM  425

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LHRP+ A  L  SFL   SMP
Sbjct  426  VTVRGAGHEVPLHRPREAFILFSSFLQNKSMP  457



>gb|KJB76568.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=304

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 143/210 (68%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD  S  HPS +C   L  A  E G+ID YSIFT  C ++    S +          + R
Sbjct  98   CDLGSSTHPSLQCMNALRAAQIEQGNIDPYSIFTQPCKDT----STLRHNMRGHYPWMSR  153

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI
Sbjct  154  AYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELI  213

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V 
Sbjct  214  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVT  273

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  274  VTGAGHEVPLHRPRQAFILFRSFLENKLMP  303



>ref|XP_003566533.2| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=466

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + SFIHPS  CN   DTA+ E G+ID YS++TP C ++ S+ SR   R   +   +  
Sbjct  251  CLHDSFIHPSPACNAAQDTAATEQGNIDMYSLYTPVCNQTASV-SR--PRPRGRYPWMSG  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+ST+Y+N PEVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  308  SYDPCTERYSTVYYNRPEVQRALHANVTGINYTWATCSDTINKNWGDAPRSMLPIYKELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWVFSGDTDAV+P+T+TRYSIDAL LPT   W PW D+ +VGGW+Q Y+GLT V 
Sbjct  368  QAGLRIWVFSGDTDAVVPLTATRYSIDALDLPTTIGWYPWSDSKEVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            +RGAGHEV LHRP+ AL + ++FL G  +P
Sbjct  428  IRGAGHEVPLHRPRQALIMFQNFLRGMPLP  457



>dbj|BAJ99174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + S  HPS EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R
Sbjct  237  CLFDSSEHPSPECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSR  292

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI
Sbjct  293  AYDPCTERYSNIYYNLPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELI  352

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  353  AAGIRIWVFSGDTDAVVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVT  412

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ AL L   FL  T MP
Sbjct  413  VAGAGHEVPLHRPRQALILFRHFLKDTPMP  442



>tpg|DAA53383.1| TPA: hypothetical protein ZEAMMB73_784297 [Zea mays]
Length=340

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  854  HPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTE  675
            +PSEEC K+ + A  E G+ID YSI+TPTC ++ S+  R L R   ++  L R YDPCTE
Sbjct  132  NPSEECQKIYEVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTE  188

Query  674  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  495
             + T Y NLPEVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIW
Sbjct  189  LYITKYCNLPEVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIW  248

Query  494  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  315
            VFSGDTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHE
Sbjct  249  VFSGDTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHE  308

Query  314  VALHRPKLALTLVESFLAGTSMP  246
            V LHRP   L L E FL G  MP
Sbjct  309  VPLHRPPQGLKLFEHFLRGEPMP  331



>ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group]
 dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group]
 gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group]
 dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS EC K L+ AS E G+ID YS++T  C  + S+   +  R       L R
Sbjct  247  CLLESSEHPSPECLKNLNLASSEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSR  302

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S+IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  303  AYDPCTERYSSIYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELI  362

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  363  AAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLTLVT  422

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL L   FL  T MP
Sbjct  423  IAGAGHEVPLHRPREALILFRHFLQNTPMP  452



>gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group]
Length=454

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 148/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS EC K L+ AS E G+ID YS++T  C  + S+   +  R       L R
Sbjct  247  CLLESSEHPSPECLKNLNLASSEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSR  302

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S+IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  303  AYDPCTERYSSIYYNRPEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELI  362

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  363  AAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVT  422

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL L   FL  T MP
Sbjct  423  IAGAGHEVPLHRPREALILFRHFLQNTPMP  452



>ref|XP_010937832.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=470

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 151/213 (71%), Gaps = 6/213 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            ++CD QS  HPS +C KVL+ AS+E+G+ID YSI+T  C ++       LKR+ R     
Sbjct  260  VICDLQSSQHPSADCMKVLEAASNEMGNIDPYSIYTRPCNDA-----TTLKRKLRGHYPW  314

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTE ++ +Y+N PEVQKALH + T   + W TCS+ V  +W D P ++L +Y+
Sbjct  315  MSRAYDPCTENYANVYYNRPEVQKALHANVTGIPYPWDTCSNIVGKYWTDSPRSMLPIYR  374

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL L TV  W  WYD G VGGWTQ Y+GLT
Sbjct  375  ELIAAGLRIWVFSGDTDSVVPLTATRYSIDALNLSTVISWYAWYDQGMVGGWTQVYKGLT  434

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV VRGAGHEV LHRP+ AL L + FL    MP
Sbjct  435  FVTVRGAGHEVPLHRPRQALVLFKHFLQNRPMP  467



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD  S  HPS +C K L  A  E G+ID YSI+T  C  S + + R L+        + R
Sbjct  250  CDTGSSEHPSADCTKALLIAEHEQGNIDPYSIYTRPCA-STNALHRNLRGH---YPWMSR  305

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFNLPEVQKA H + T  ++ W TCSD V D+W D P ++L +YQELI
Sbjct  306  AYDPCTERYSDVYFNLPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYQELI  365

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V 
Sbjct  366  AAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQLYKGLTLVT  425

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ A  L  SFL    MP
Sbjct  426  ITGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 144/221 (65%), Gaps = 32/221 (14%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N +CD+QSF+H S EC K+LD AS+ELG+ID YSIFTP+C  S +     L +R    G 
Sbjct  253  NFICDFQSFVHASSECEKILDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGR  312

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
                YDPCTE+HST+YFNLPEVQKALHV+   +  +W TCS                   
Sbjct  313  AGEKYDPCTEKHSTVYFNLPEVQKALHVNPAVAPSKWETCS-------------------  353

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
                         GDTDAVIPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLT
Sbjct  354  -------------GDTDAVIPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLT  400

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            FV VRGAGHEV LHRPK AL L +SFL+G+ MP L    DS
Sbjct  401  FVTVRGAGHEVPLHRPKQALVLFKSFLSGSPMPTLSEFDDS  441



>ref|XP_003560871.1| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=482

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 151/219 (69%), Gaps = 8/219 (4%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIM---SRVLKRRDRKVG-  708
            C + +F+H S  C      +S+E G+ID YSI+TPTC  + S +   S V+ RR    G 
Sbjct  256  CLHDAFVHLSPACLAAFRASSEEQGNIDAYSIYTPTCNTNASALPTPSSVVSRRQHPKGR  315

Query  707  ---LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVL  537
               +    YDPCTER+ST Y+N PEVQKALH + T  ++ W  CSD +   W D P ++L
Sbjct  316  YPWMTGGSYDPCTERYSTAYYNRPEVQKALHANVTGINYAWAACSDTINGNWSDSPRSML  375

Query  536  DVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQE  360
             +Y+E+I AGLRIWVFSGDTD+V+P T+TRYSIDAL LPT + W PWYD+ Q VGGW+Q 
Sbjct  376  SIYKEIIQAGLRIWVFSGDTDSVVPSTATRYSIDALVLPTTTDWYPWYDDNQEVGGWSQV  435

Query  359  YEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            YEGLT V VRGAGHEVALHRP+ AL L ++FL G  MPG
Sbjct  436  YEGLTLVTVRGAGHEVALHRPRQALILFQNFLQGKPMPG  474



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD+ S  HPS EC K L  A  E G+ID YSI+T  C  + S+   +          + R
Sbjct  251  CDFGSSQHPSAECKKALTVAEFEQGNIDPYSIYTRPCNSTASLRHNLRGHYP----WMSR  306

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S  YFN P+VQKA H + T  ++ W TCSD V ++W D P ++L +YQELI
Sbjct  307  AYDPCTERYSVAYFNHPDVQKAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELI  366

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             +G+RIWVFSGDTD+V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLTFV 
Sbjct  367  VSGIRIWVFSGDTDSVVPVTATRYSIDALKLPTISNWYPWYDHGKVGGWSQIYKGLTFVT  426

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    +P
Sbjct  427  VAGAGHEVPLHRPREAFILFRSFLEDKPLP  456



>gb|EMS47606.1| Serine carboxypeptidase-like 27 [Triticum urartu]
Length=470

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + S  HPS EC K L+ AS E G+ID YS++T  C  S S+   +  R       L R
Sbjct  263  CLFDSSEHPSPECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSR  318

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S IY+NLPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI
Sbjct  319  AYDPCTERYSNIYYNLPEVQAALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELI  378

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG++IWVFSGDTDAV+PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  379  AAGIKIWVFSGDTDAVVPVTATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVT  438

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ AL L   FL  T MP
Sbjct  439  VAGAGHEVPLHRPRQALILFRHFLKDTPMP  468



>gb|EMT21139.1| putative Serine carboxypeptidase II-1 [Aegilops tauschii]
Length=419

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 146/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C++ S  H SE CNK+ D A  E G ID YSI+TPTC ++     R +K R      
Sbjct  201  QLACEFDSSEHASEACNKIYDVAEAEEGLIDAYSIYTPTCKKTSLHRRRQIKGRRP---W  257

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA   + T   + W +CSD ++++WKD P ++L +Y 
Sbjct  258  LPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYAWTSCSDVLFEYWKDSPRSMLPIYH  317

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGD D+V+P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT
Sbjct  318  ELIAAGIRIWVFSGDADSVVPLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLT  377

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  378  LVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  410



>ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha]
Length=455

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS EC K L+ AS E G+ID YS++T  C  + S+   +  R       L R
Sbjct  248  CLLESSEHPSPECAKNLNIASTEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSR  303

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  304  AYDPCTERYSNIYYNRPEVQIAMHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELI  363

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG+RIWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  364  AAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVT  423

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ AL L   FL    MP
Sbjct  424  VTGAGHEVPLHRPREALILFRHFLQNIPMP  453



>ref|XP_008649461.1| PREDICTED: serine carboxypeptidase 2-like isoform X2 [Zea mays]
 gb|AFW77518.1| hypothetical protein ZEAMMB73_509500 [Zea mays]
Length=491

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 149/225 (66%), Gaps = 15/225 (7%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG----  708
            C + S  HPS  CN   D A+ E GDID YSI+TPTC ++ +  S    RR R  G    
Sbjct  260  CVHDSGEHPSPRCNAAYDKATAEQGDIDPYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPW  319

Query  707  LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSS-----FEWVTCSDEVYDFWKDCPTT  543
            +    YDPCTERHST+Y+N PEVQ+ALH + T  +     + W TCSD + + W D P +
Sbjct  320  MRGSSYDPCTERHSTVYYNRPEVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKS  379

Query  542  VLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD------NGQ  381
            VL +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL LPTV  W PWYD        +
Sbjct  380  VLHIYKELIAAGLRIWVFSGDTDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQKQQQE  439

Query  380  VGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            VGGW+Q YEGLT V VRGAGHEV LHRP+ AL L   FL G  MP
Sbjct  440  VGGWSQVYEGLTLVTVRGAGHEVPLHRPRQALILFRHFLRGKPMP  484



>sp|P55747.1|CBP21_HORVU RecName: Full=Serine carboxypeptidase II-1; AltName: Full=CP-MII.1; 
Contains: RecName: Full=Serine carboxypeptidase II-1 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-1 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 324 aa]
 emb|CAB58992.1| serine carboxypeptidase II-1 [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 146/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C++ S  H SE CNK+ + A  E G ID YSI+TPTC ++     R++K R      
Sbjct  106  QLACEFDSAEHESEACNKINNVAEAEEGLIDAYSIYTPTCKKTSLHRRRLIKGRR---PW  162

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA   + T   + W  CSD + D WKD P ++L +Y+
Sbjct  163  LPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYR  222

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT
Sbjct  223  ELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLT  282

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  283  LVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP  315



>ref|XP_002459313.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
 gb|EER95834.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
Length=478

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 146/213 (69%), Gaps = 7/213 (3%)
 Frame = -2

Query  863  SFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSR-------VLKRRDRKVGL  705
            S IHPS  CN   D A+ E GDID YSI+TP C ++ S  ++       ++ R       
Sbjct  260  SIIHPSPACNTATDVAAVEQGDIDMYSIYTPLCGQTSSSSTKRSSQSSPLIGRHYHHPWR  319

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE HST+Y+N PEVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+
Sbjct  320  MGGSYDPCTESHSTVYYNRPEVQRALHANLTGINYPWATCSDLINTNWGDSPKSMLPIYK  379

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTDAVIP+TSTRYS+DAL LPT + W PWYD  QVGGW+Q YEGLT
Sbjct  380  ELIAAGLRIWVFSGDTDAVIPLTSTRYSVDALGLPTTTSWYPWYDKKQVGGWSQVYEGLT  439

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V VRGAGHEV LHRP+ AL L + FL G  MP
Sbjct  440  LVTVRGAGHEVPLHRPRQALILFQQFLKGEPMP  472



>gb|EMS66624.1| Serine carboxypeptidase II-1 [Triticum urartu]
Length=357

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 146/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C++ S  H S+ CNK+ D A  E G ID YSI+TPTC ++     R +K R      
Sbjct  139  QLACEFDSSEHASDACNKIYDVAEAEEGLIDAYSIYTPTCKKTSLHRRRQIKGRRP---W  195

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA   + T   + W  CSD ++++WKD P ++L +Y+
Sbjct  196  LPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYR  255

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGD D+V+P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT
Sbjct  256  ELIAAGIRIWVFSGDADSVVPLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLT  315

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  316  LVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  348



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 149/212 (70%), Gaps = 5/212 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CDYQ+  HPS+ C   LDTA  E+G+ID YSI+T  C +      R LKR  R     + 
Sbjct  265  CDYQASEHPSDACVNALDTADSEMGNIDPYSIYTLPCNDH----PRSLKRNLRGHYPWMS  320

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S IY+N  +VQ+A+H + T   + W TCSD + + W D P ++L +Y+EL
Sbjct  321  RAYDPCTERYSRIYYNRADVQRAMHANVTGIPYGWDTCSDTISENWGDSPKSMLPIYREL  380

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTDAV+P+T+TRYSIDAL+L T+  W PWYD+G+VGGW+Q Y+GLT+V
Sbjct  381  IAAGLRIWVFSGDTDAVVPLTATRYSIDALRLRTLEKWYPWYDHGKVGGWSQIYKGLTYV  440

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
             V GAGHEV LHRP+ AL L E FL    MP 
Sbjct  441  TVTGAGHEVPLHRPRQALMLFEHFLKNKPMPA  472



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD  S  HPS EC   L  A  E G+ID YSIFT  C ++ ++   +          + R
Sbjct  246  CDLGSSTHPSLECMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSR  301

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI
Sbjct  302  AYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELI  361

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V 
Sbjct  362  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQAYKGLTLVT  421

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  422  VTGAGHEVPLHRPRQAFILFRSFLENKLMP  451



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 148/211 (70%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS EC +VL  A  E G+ID YSI+T  C  + S     LKR  R     + 
Sbjct  249  CDSGSSQHPSVECMRVLKLAEMEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMS  303

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+EL
Sbjct  304  RAYDPCTERYSEVYFNRPDVQKALHANVTKVSYPWQTCSDIVGNYWADSPLSMLPIYKEL  363

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGL+IWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGG  Q Y+GLTFV
Sbjct  364  IAAGLKIWVFSGDTDSVVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRCQIYKGLTFV  423

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+LA  L  SFL    MP
Sbjct  424  TVTGAGHEVPLHRPRLAFILFRSFLESKPMP  454



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD+ S  HPS EC K L  A  E G+ID YSI+T  C  + S+   +          + R
Sbjct  249  CDFGSSQHPSAECKKALTIAEFEQGNIDPYSIYTRPCNSTASLRHNLRGHYP----WMSR  304

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S  YFN P+VQ+A H + T  ++ W TCSD V ++W D P ++L +YQELI
Sbjct  305  AYDPCTERYSVAYFNHPDVQEAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELI  364

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             +G+RIWVFSGDTD+V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLTFV 
Sbjct  365  GSGIRIWVFSGDTDSVVPVTATRYSIDALKLPTLSNWYPWYDHGKVGGWSQIYKGLTFVT  424

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    +P
Sbjct  425  VAGAGHEVPLHRPREAFILFRSFLENKPLP  454



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 147/212 (69%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD  S  HPS +C K L  A  E G+ID YSI+T  C  S + + R L+        +
Sbjct  248  ITCDTGSSEHPSTDCTKALLLADHEQGNIDPYSIYTRPCA-STNALHRNLRGH---YPWM  303

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+S +YFNLPEVQKA H + T  ++ W TCSD V D+W D P ++L +Y E
Sbjct  304  SRAYDPCTERYSDVYFNLPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYHE  363

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT 
Sbjct  364  LIAAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQIYKGLTL  423

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V + GAGHEV LHRP+ A  L  SFL    MP
Sbjct  424  VTITGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_003566409.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
 ref|XP_003568700.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
Length=469

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 148/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C++ S  H S+ CN++ D A  E G ID YSI+TPTC ++     R++K R      
Sbjct  251  QLACEFDSSAHASKACNQIYDVAEAEEGLIDAYSIYTPTCKKASLRKRRLIKGRRP---W  307

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA H + T   + W  CSD++++ WKD P ++L +Y 
Sbjct  308  LPRGYDPCTEKYSTKYYNLPEVQKAFHANVTGMPYAWNPCSDDLFEHWKDSPRSMLPIYH  367

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWY+  +V GW Q Y+GLT
Sbjct  368  ELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYEEEEVAGWCQVYKGLT  427

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  428  LVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP  460



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD  S  HPS +C   L  A  E G+ID YSIFT  C ++ ++   +          + R
Sbjct  246  CDLGSSTHPSLQCMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSR  301

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI
Sbjct  302  AYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELI  361

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V 
Sbjct  362  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVT  421

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  422  VTGAGHEVPLHRPRQAFILFRSFLENKLMP  451



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD  S  HPS +C   L  A  E G+ID YSIFT  C ++ ++   +          + R
Sbjct  245  CDLGSSTHPSLQCMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSR  300

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI
Sbjct  301  AYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELI  360

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V 
Sbjct  361  AAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVT  420

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  421  VTGAGHEVPLHRPRQAFILFRSFLENKLMP  450



>ref|XP_006655142.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 2-like 
[Oryza brachyantha]
Length=469

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 148/224 (66%), Gaps = 3/224 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG-  708
            N  C + S  HP+  C   L+ ++ E GDID YS++TPTC E+ S  +R  ++R  K G 
Sbjct  241  NASCVHDSGEHPAPACLAALNASTAEQGDIDMYSLYTPTCNETSSPAARARQQRRLKRGH  300

Query  707  --LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLD  534
               +   YDPCTE +ST Y+N PEVQ ALH + T  ++ W TCSD + + W+D P TVL 
Sbjct  301  YPWMTGSYDPCTEIYSTAYYNRPEVQTALHANVTGINYTWATCSDILNNNWRDSPRTVLP  360

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y ELI AGLRIWVFSGDTDAV+P+T TRYSIDAL LPT   W PWYD  +VGGW+Q Y+
Sbjct  361  IYHELIAAGLRIWVFSGDTDAVVPLTGTRYSIDALGLPTTINWYPWYDAIKVGGWSQVYK  420

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  222
            GLT V VRGAGHEV LHRP+ A  L   FL G  MP    I  +
Sbjct  421  GLTLVTVRGAGHEVPLHRPRQAFILFNHFLKGKPMPNAPTIKSA  464



>gb|AAV43957.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
Length=483

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 150/216 (69%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG-  708
            N  C + S  HP+  C   L+ ++ E GDID YS++TPTC E+ S  S   ++R  K G 
Sbjct  259  NASCVHDSGEHPAPACLAALNASTVEQGDIDMYSLYTPTCNET-STSSAAARQRRLKQGH  317

Query  707  --LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLD  534
               +   YDPCTER+ST Y+N PEVQ+ALH + T  ++ W TCSD + D W+D P +VL 
Sbjct  318  YPWMTGSYDPCTERYSTEYYNRPEVQRALHANVTGINYTWATCSDILNDNWRDSPRSVLP  377

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL LPT   W PWYD  +VGGW+Q Y+
Sbjct  378  IYHELIAAGLRIWVFSGDTDAVVPLTATRYSIDALGLPTTVSWYPWYDAMKVGGWSQVYK  437

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            GL+ V VRGAGHEV LHRP+ AL L + FL G  MP
Sbjct  438  GLSLVTVRGAGHEVPLHRPRQALILFKHFLQGKPMP  473



>tpg|DAA53384.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  854  HPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTE  675
            +PSEEC K+ + A  E G+ID YSI+TPTC ++ S+  R L R   ++  L R YDPCTE
Sbjct  266  NPSEECQKIYEVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTE  322

Query  674  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  495
             + T Y NLPEVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIW
Sbjct  323  LYITKYCNLPEVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIW  382

Query  494  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  315
            VFSGDTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHE
Sbjct  383  VFSGDTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHE  442

Query  314  VALHRPKLALTLVESFLAGTSMP  246
            V LHRP   L L E FL G  MP
Sbjct  443  VPLHRPPQGLKLFEHFLRGEPMP  465



>ref|XP_009410600.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 149/216 (69%), Gaps = 4/216 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N  C+ QS  HPS EC K L+ A+ E G+ID YSI+T  C  S S+ S +    + +   
Sbjct  248  NATCNLQSSEHPSVECVKNLNAATAEQGNIDPYSIYTQPCNSSRSLKSSL----NGRYPW  303

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCT+R++ +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQ
Sbjct  304  MSRAYDPCTDRYAKVYYNRPEVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQ  363

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIW+FSGDTDAV+PVT+TRYSIDAL L T+  W PWYD G+VGGW+Q Y+GLT
Sbjct  364  ELIAAGLRIWMFSGDTDAVVPVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLT  423

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQ  237
            FV + GAGHEV LH P+ A+ L   FL    MP  Q
Sbjct  424  FVTIMGAGHEVPLHHPRQAMILFRQFLKNRPMPRCQ  459



>ref|NP_001150676.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39970.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=484

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  854  HPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTE  675
            +PSEEC K+ + A  E G+ID YSI+TPTC ++ S+  R L R   ++  L R YDPCTE
Sbjct  276  NPSEECQKIYEVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTE  332

Query  674  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  495
             + T Y NLPEVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIW
Sbjct  333  LYITKYCNLPEVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIW  392

Query  494  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  315
            VFSGDTD+V+P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHE
Sbjct  393  VFSGDTDSVVPLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHE  452

Query  314  VALHRPKLALTLVESFLAGTSMP  246
            V LHRP   L L E FL G  MP
Sbjct  453  VPLHRPPQGLKLFEHFLRGEPMP  475



>emb|CDM82001.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 146/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C++ S  H S+ CNK+ D A  E G ID YSI+TPTC ++     R +K R      
Sbjct  245  QLACEFDSSEHASDACNKIYDVAEAEEGPIDAYSIYTPTCKKTSLHRRRQIKGRRP---W  301

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA   + T   + W  CSD ++++WKD P ++L +Y+
Sbjct  302  LPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYR  361

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGD D+V+P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT
Sbjct  362  ELIAAGIRIWVFSGDADSVVPLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLT  421

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  422  LVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP  454



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 148/211 (70%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS +C + L  A  E G+ID YSI+T  C  + S     LKR  R     + 
Sbjct  249  CDSGSSQHPSVDCMRALXLAEMEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMS  303

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFN P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+EL
Sbjct  304  RAYDPCTERYSEVYFNRPDVQKALHANVTKVSYPWQTCSDXVGNYWADSPLSMLPIYKEL  363

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGL+IWVFSGDTD+V+PVT+TRYSIDALKLPT++ W PW DNG+VGG +Q Y+GLTFV
Sbjct  364  IAAGLKIWVFSGDTDSVVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRSQIYKGLTFV  423

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+LA  L  SFL    MP
Sbjct  424  TVTGAGHEVPLHRPRLAFILFRSFLESKPMP  454



>ref|XP_008649460.1| PREDICTED: serine carboxypeptidase 2-like isoform X1 [Zea mays]
Length=492

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 149/226 (66%), Gaps = 16/226 (7%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG----  708
            C + S  HPS  CN   D A+ E GDID YSI+TPTC ++ +  S    RR R  G    
Sbjct  260  CVHDSGEHPSPRCNAAYDKATAEQGDIDPYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPW  319

Query  707  LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSS-----FEWVTCSDEVYDFWKDCPTT  543
            +    YDPCTERHST+Y+N PEVQ+ALH + T  +     + W TCSD + + W D P +
Sbjct  320  MRGSSYDPCTERHSTVYYNRPEVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKS  379

Query  542  VLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-------NG  384
            VL +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL LPTV  W PWYD         
Sbjct  380  VLHIYKELIAAGLRIWVFSGDTDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQQKQQQ  439

Query  383  QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            +VGGW+Q YEGLT V VRGAGHEV LHRP+ AL L   FL G  MP
Sbjct  440  EVGGWSQVYEGLTLVTVRGAGHEVPLHRPRQALILFRHFLRGKPMP  485



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 148/211 (70%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD++   HPS+ C K LD A  E+G+ID YSI+T  C ++ S     L+R  R     + 
Sbjct  266  CDHEVSEHPSDACIKALDDADTEMGNIDPYSIYTLPCNDTGS-----LRRNLRGHYPWMS  320

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +Y+N PEVQKALH + T   + W TCSD + D W D P +VL +Y EL
Sbjct  321  RAYDPCTERYSMVYYNRPEVQKALHANVTGIPYSWETCSDTIGDNWGDSPKSVLPIYHEL  380

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGLRIWVFSGDTD+V+P+T+TRYSIDALKL T+  W PWY +G+VGGW+Q YEGLTFV
Sbjct  381  IAAGLRIWVFSGDTDSVVPLTATRYSIDALKLKTLKNWYPWYYDGKVGGWSQIYEGLTFV  440

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V GAGHEV LHRP+ AL L + FL    MP
Sbjct  441  TVTGAGHEVPLHRPRQALILFKRFLKNKPMP  471



>ref|XP_009410601.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N  C+ QS  HPS EC K L+ A+ E G+ID YSI+T  C  S S+ S +  R       
Sbjct  248  NATCNLQSSEHPSVECVKNLNAATAEQGNIDPYSIYTQPCNSSRSLKSSLNGRYP----W  303

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCT+R++ +Y+N PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQ
Sbjct  304  MSRAYDPCTDRYAKVYYNRPEVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQ  363

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIW+FSGDTDAV+PVT+TRYSIDAL L T+  W PWYD G+VGGW+Q Y+GLT
Sbjct  364  ELIAAGLRIWMFSGDTDAVVPVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLT  423

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV + GAGHEV LH P+ A+ L   FL    MP
Sbjct  424  FVTIMGAGHEVPLHHPRQAMILFRQFLKNRPMP  456



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   245 bits (625),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 148/213 (69%), Gaps = 6/213 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            + C+  S  HPS +C K L +A  E G+ID YSIFT  C  + S     L+R  R     
Sbjct  248  IACESGSSEHPSLDCMKALKSAEMEQGNIDPYSIFTRPCNGTAS-----LRRNLRGHYPW  302

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+
Sbjct  303  MSRAYDPCTERYSEVYFNHPEVQKALHANVTWISYPWRTCSEIVGDNWTDSPLSMLPIYK  362

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGL+IWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLKIWVFSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLT  422

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 147/213 (69%), Gaps = 6/213 (3%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGL  705
            + C+  S  HPS +C   L +A  E G+ID YSIFT  C  + S     L+R  R     
Sbjct  248  IACESGSSEHPSLDCMTALKSAEMEQGNIDPYSIFTRPCNGTAS-----LRRNLRGHYPW  302

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+
Sbjct  303  MSRAYDPCTERYSEVYFNHPEVQKALHANVTGISYPWRTCSEIVGDNWTDSPLSMLPIYK  362

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGL+IWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLT
Sbjct  363  ELIAAGLKIWVFSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLT  422

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            FV V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  423  FVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 146/211 (69%), Gaps = 6/211 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD +   HPS  C + L  A  E G+ID YSIFT  C+ +       LKR  R     + 
Sbjct  252  CDLEVSQHPSLACMEALKLADSEQGNIDPYSIFTRPCSSA-----AALKRNLRGHYPWMS  306

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S  YFN PEVQKALH + T  S+ W TCSD V ++W D P ++L +YQEL
Sbjct  307  RAYDPCTERYSEKYFNHPEVQKALHANVTGLSYPWKTCSDFVGNYWSDSPRSMLPIYQEL  366

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  339
            I AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PW D+G+VGGW+Q Y+GLT V
Sbjct  367  IAAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTINNWSPWSDSGKVGGWSQIYKGLTLV  426

Query  338  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             + GAGHEV LHRP+ A  L +SFL    MP
Sbjct  427  TITGAGHEVPLHRPREAFILFKSFLENKPMP  457



>gb|AIN39846.1| hypothetical protein [Zoysia matrella]
Length=172

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -2

Query  728  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  549
            +R   VG +   YDPCTE+HS +YFNLPEVQKALHV    S  +W TCS+ V   W DC 
Sbjct  2    KRLHSVGKMGEQYDPCTEKHSIVYFNLPEVQKALHVSPVISKSKWETCSEVVNTHWGDCE  61

Query  548  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGG  372
             +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYS+DALKLPTV+PW  WYD +G+VGG
Sbjct  62   RSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSVDALKLPTVTPWHAWYDEDGEVGG  121

Query  371  WTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            WT+ YEGLTFV VRGAGHEV LHRPK ALTL++SFLAG+ MP
Sbjct  122  WTEGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMP  163



>gb|EMT12249.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=468

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 151/213 (71%), Gaps = 4/213 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            C + SFIHPS  C+   D A+ E G+ID YS++TP C  + S  S + +RR R +   L 
Sbjct  250  CLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNITSS--SSLSQRRPRGRYPWLT  307

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
              YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+E
Sbjct  308  GSYDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWTTCSDTINTHWHDAPRSMLPIYRE  367

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT 
Sbjct  368  LIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWHPWYDDQEVGGWSQVYKGLTL  427

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            V+VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  428  VSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  460



>dbj|BAK02399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 146/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
             L C++ S  H SE CNK+ + A  E G ID YSI+TPTC ++     R++K R      
Sbjct  245  QLACEFDSAEHESEACNKINNVAEAEEGLIDAYSIYTPTCKKTSLHRRRLIKGRRP---W  301

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            L R YDPCTE++ST Y+NLPEVQKA   + T   + W  CSD + D WKD P ++L +Y+
Sbjct  302  LPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYR  361

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT
Sbjct  362  ELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLT  421

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V +RGAGHEV LHRP+ AL L E FL    MP
Sbjct  422  LVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP  454



>gb|ACU19747.1| unknown [Glycine max]
Length=282

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 144/212 (68%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + C + S  HP E C + L+ A+ E G+ID YSI+TP C +  +I  R+  R       L
Sbjct  36   IACGFYSSEHPPENCVEALELATLEQGNIDPYSIYTPVCNDIAAIKRRLGGRYP----WL  91

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+ST+YFN PEVQKALH + T   + W  C+D + + W D P ++L +YQE
Sbjct  92   SRAYDPCTERYSTLYFNRPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLSIYQE  151

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI  G+RIWVFSGDTD+V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT 
Sbjct  152  LIEGGIRIWVFSGDTDSVVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTL  211

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LH+P+    L ++FL   +MP
Sbjct  212  VTVRGAGHEVPLHKPRQGFILFKTFLEDKNMP  243



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 143/209 (68%), Gaps = 4/209 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + S  HPS +C K LD AS E G+ID YSIFT  C  + S+   +          + R
Sbjct  261  CPHGSSQHPSADCMKALDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYP----WMSR  316

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +YQELI
Sbjct  317  AYDPCTERYSEVYFNKPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELI  376

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLTFV 
Sbjct  377  AAGLRIWVYSGDTDAVVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVT  436

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V GAGHEV L RP+ A  L  SFL    M
Sbjct  437  VTGAGHEVPLLRPRQAFILFRSFLENKPM  465



>ref|NP_001151874.1| LOC100285510 precursor [Zea mays]
 gb|ACG44727.1| virulence-related protein Nf314 [Zea mays]
Length=467

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS +C K L+ AS E G+ID YS+ T  C ++ S+   +  R       L R
Sbjct  260  CLLESSQHPSPDCVKNLNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSR  315

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+++IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  316  AYDPCTERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELI  375

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG++IWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + 
Sbjct  376  AAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLIT  435

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL +   FL    MP
Sbjct  436  IAGAGHEVPLHRPRQALIMFRHFLQNKPMP  465



>ref|XP_008673013.1| PREDICTED: LOC100285510 isoform X1 [Zea mays]
 gb|ACR34277.1| unknown [Zea mays]
 tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays]
Length=467

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 147/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS +C K L+ AS E G+ID YS+ T  C ++ S+   +  R       L R
Sbjct  260  CLLESSQHPSPDCVKNLNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSR  315

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+++IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  316  AYDPCTERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELI  375

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG++IWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + 
Sbjct  376  AAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLIT  435

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL +   FL    MP
Sbjct  436  IAGAGHEVPLHRPRQALIMFRHFLQNKPMP  465



>ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
 gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
Length=467

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C K L+ AS E G+ID YS+ T  C ++ S+   +  R       L R
Sbjct  260  CLLDSSQHPSSDCVKNLNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSR  315

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+++IY+N PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  316  AYDPCTERYASIYYNRPEVQMAMHANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQELI  375

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG++IWVFSGDTDAV+PVT+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  376  AAGIKIWVFSGDTDAVVPVTATRYSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLTLVT  435

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL +   FL    MP
Sbjct  436  IAGAGHEVPLHRPRQALIMFRHFLQNKPMP  465



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 151/213 (71%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      
Sbjct  240  ITCEFGSSEHPSPECSKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---W  296

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCT+R+S +YFN PEVQKA+H + T  S+ W TCSD V + W D P ++L +Y+
Sbjct  297  MWRAYDPCTDRYSGMYFNSPEVQKAMHANITGLSYPWKTCSDIVGEKWADSPLSMLPIYK  356

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT
Sbjct  357  ELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLT  416

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV LHRP+ A  L +SFL    +P
Sbjct  417  LVTIHGAGHEVPLHRPRRAYLLFQSFLDNKPLP  449



>ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=457

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS +C K L+ AS E G+ID YS+ T  C  + S+   +  R       L R
Sbjct  250  CLLESSQHPSPDCVKNLNLASAEEGNIDPYSLNTKPCNYTASLKVSLGGRYP----WLSR  305

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+++IY+N PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI
Sbjct  306  AYDPCTERYASIYYNRPEVQMALHANTTGIHYPWQTCSDIVGTYWADSPRSMLPIYQELI  365

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AG++IWVFSGDTDAV+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  366  AAGMKIWVFSGDTDAVVPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVT  425

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGHEV LHRP+ AL +   FL    MP
Sbjct  426  IAGAGHEVPLHRPRQALIMFRHFLKNKPMP  455



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 143/209 (68%), Gaps = 4/209 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C + S  HPS +C K LD AS E G+ID YSIFT  C  + S+   +          + R
Sbjct  322  CPHGSSQHPSADCMKALDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYP----WMSR  377

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +YQELI
Sbjct  378  AYDPCTERYSEVYFNKPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELI  437

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGLRIWV+SGDTDAV+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLTFV 
Sbjct  438  AAGLRIWVYSGDTDAVVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVT  497

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSM  249
            V GAGHEV L RP+ A  L  SFL    M
Sbjct  498  VTGAGHEVPLLRPRQAFILFRSFLENKPM  526



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 142/203 (70%), Gaps = 4/203 (2%)
 Frame = -2

Query  854  HPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTE  675
            HPS +C + L TA  E G+ID YSIFT  C  + ++   ++ R       + R YDPCTE
Sbjct  257  HPSLQCMEALRTAELEQGNIDPYSIFTRPCNNTVTLKRFLMGRYP----WMSRAYDPCTE  312

Query  674  RHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIW  495
            R+S  YFN P VQKALH + T   + W  CSD V  +W D P ++L +Y+ELI AG++IW
Sbjct  313  RYSNSYFNRPNVQKALHANVTRLPYPWKACSDIVGSYWTDSPVSMLPIYKELIAAGVKIW  372

Query  494  VFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  315
            VFSGDTDAV+PVT+TRYSI+ALKLPT++ W PWYD G+VGGW+Q Y+GLTFV+V GAGHE
Sbjct  373  VFSGDTDAVVPVTATRYSINALKLPTITNWYPWYDQGKVGGWSQVYKGLTFVSVAGAGHE  432

Query  314  VALHRPKLALTLVESFLAGTSMP  246
            V LHRP+ A  L  SFL    MP
Sbjct  433  VPLHRPRQAFILFRSFLEDKPMP  455



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 150/213 (70%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      
Sbjct  240  ITCEFGSSEHPSPECSKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---W  296

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCT+R+S +YFN PEVQKA+H + T  S+ W  CSD V + W D P ++L +Y+
Sbjct  297  MWRAYDPCTDRYSGMYFNSPEVQKAMHANITGLSYPWKGCSDIVGEKWADSPLSMLPIYK  356

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT
Sbjct  357  ELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLT  416

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV LHRP+ A  L +SFL    +P
Sbjct  417  LVTIHGAGHEVPLHRPRRAFLLFQSFLDNKPLP  449



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   240 bits (613),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L  A  E G+ID YSIFT  C  +   + R LK R      + R
Sbjct  254  CYSVSSQHPSMQCMEALRNAELEQGNIDPYSIFTKPCNNTVQ-LKRFLKGR---YPWMSR  309

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T   + W +CSD V  +W D P ++L +Y+ELI
Sbjct  310  AYDPCTERYSNVYFNRVEVQKALHANVTRLPYPWKSCSDIVGSYWTDSPVSMLPIYRELI  369

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  370  TAGLKIWVFSGDTDAVVPVTATRYSIDALKLETITNWYPWYDHGKVGGWSQVYKGLTLVT  429

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  430  VAGAGHEVPLHRPRQAFILFRSFLENKPMP  459



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S +HPS +C   L  A  E G+ID YSIFT  C  +  + S +  R       + R
Sbjct  249  CYSVSSLHPSLQCMVALRNAELEQGNIDPYSIFTKPCNNTVQLKSFLRGRYP----WMSR  304

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T   + W +CSD V  +W+D P ++L +Y+ELI
Sbjct  305  AYDPCTERYSNVYFNRVEVQKALHANVTRLPYPWKSCSDIVGSYWRDSPVSMLPIYRELI  364

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  365  TAGLKIWVFSGDTDAVVPVTATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  424

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  425  VAGAGHEVPLHRPRQAFILFRSFLESKPMP  454



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S  HP E C + L+ A+ E G+ID YSI+TP C +    ++ + +R   +   L
Sbjct  247  IACDFYSSEHPPENCVEALELATLEQGNIDPYSIYTPVCND----IAAIKRRLGGRYPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+ST+YFN PEVQKALH + T   + W  C+D + + W D P ++L +YQE
Sbjct  303  SRAYDPCTERYSTLYFNRPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLPIYQE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI  G+RIWVFSGDTD+V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT 
Sbjct  363  LIEGGIRIWVFSGDTDSVVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LH+P+    L ++FL   +MP
Sbjct  423  VTVRGAGHEVPLHKPRQGFILFKTFLEDKNMP  454



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC KV++ A  E G ID YSI+T TC  E+ ++ SR  + R      
Sbjct  243  ITCEFGSSEHPSPECKKVMEAADLEQGSIDPYSIYTITCKKEAAALRSRFSRVRHP---W  299

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+
Sbjct  300  MWRAYDPCTERYSGMYFNSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYK  359

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW DNGQVGGW Q Y+GLT
Sbjct  360  ELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWIQVYKGLT  419

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV LHRP+    L +SFL    +P
Sbjct  420  LVTIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  452



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S  HP E C + L+ A+ E G+ID YSI+TP C +    ++ + +R   +   L
Sbjct  247  IACDFYSSEHPPENCVEALELATLEQGNIDPYSIYTPVCND----IAAIKRRLGGRYPWL  302

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTER+ST+YFN PEVQKALH + T   + W  C+D + + W D P ++L +YQE
Sbjct  303  SRAYDPCTERYSTLYFNRPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLPIYQE  362

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTF  342
            LI  G+RIWVFSGDTD+V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT 
Sbjct  363  LIEGGIRIWVFSGDTDSVVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTL  422

Query  341  VAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V VRGAGHEV LH+P+    L ++FL   +MP
Sbjct  423  VTVRGAGHEVPLHKPRQGFILFKTFLEDKNMP  454



>ref|XP_004962519.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=490

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = -2

Query  854  HPSEECNKVLDTASDELGDIDTYSIFTPTCTE-SFSIMSRVLKRRDRKVGLLRRIYDPCT  678
            H S  C+   D A+ E GDID YSI+TPTC + S S  +R   R       +R  YDPCT
Sbjct  281  HTSPPCDAAYDAATVEQGDIDPYSIYTPTCNQTSSSTTARKNWRLKGHYPWMRGSYDPCT  340

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E HST+Y+N PEVQ+ALH + T  ++ W TCS  +   W D P ++L +Y+ELI AGLRI
Sbjct  341  EMHSTVYYNRPEVQRALHANVTGINYTWTTCSGIINTNWGDSPRSMLPIYKELIAAGLRI  400

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WV+SGDTD+V+P+T+TRYSIDAL LPTV  W PWYD  +VGGW+Q Y+GLT V +RGAGH
Sbjct  401  WVYSGDTDSVVPLTATRYSIDALGLPTVVSWYPWYDKKEVGGWSQVYKGLTLVTIRGAGH  460

Query  317  EVALHRPKLALTLVESFLAGTSMP  246
            EV LHRPK AL L   FL G  MP
Sbjct  461  EVPLHRPKQALILFRHFLHGKPMP  484



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R
Sbjct  252  CYSVSSQHPSLQCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI
Sbjct  308  AYDPCTERYSNVYFNRVEVQKALHANVTRLSYSWKSCSDIVGNYWTDSPVSMLPIYRELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  368  AAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  +  SFL    MP
Sbjct  428  VTGAGHEVPLHRPRQAFIIFRSFLENKPMP  457



>emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum]
Length=260

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 147/217 (68%), Gaps = 6/217 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-----ESFSIMSRVLKRRDRKV  711
            C + SFIHPS  C+   D A+ E G+ID YS++TP C       S S      +R   + 
Sbjct  36   CLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNITSSSSSSSSSLSQQRRSRGRY  95

Query  710  GLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLD  534
              L   YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L 
Sbjct  96   PWLTGSYDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWSTCSDTINTHWHDAPRSMLP  155

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+
Sbjct  156  IYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYK  215

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            GLT V+VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  216  GLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  252



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R
Sbjct  243  CYSVSSQHPSLQCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSR  298

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI
Sbjct  299  AYDPCTERYSNVYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELI  358

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  359  AAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  418

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  +  SFL    MP
Sbjct  419  VTGAGHEVPLHRPRQAFIIFRSFLENKPMP  448



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L  A  E G+ID YSIFT  C  +   + R LK R      + R
Sbjct  252  CYSVSSQHPSLQCMEALRNAELEQGNIDPYSIFTKPCNNTVQ-LKRFLKGR---YPWMSR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPC+ER+S +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELI
Sbjct  308  AYDPCSERYSNVYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  368  TAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  428  VAGAGHEVPLHRPRQAFILFRSFLENKPMP  457



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC KV++ A  E G ID YSI+T TC  E+ ++ SR  + R      
Sbjct  241  ITCEFGSSEHPSPECKKVMEAADLEQGSIDPYSIYTITCKKEAAALRSRFSRVRHP---W  297

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+
Sbjct  298  MWRAYDPCTERYSGMYFNSPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYK  357

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW DNGQVGGW+Q Y+GLT
Sbjct  358  ELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWSQVYKGLT  417

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV LHRP+    L +SFL    +P
Sbjct  418  LVTIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  450



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 147/244 (60%), Gaps = 39/244 (16%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLR  699
            CD  S  HPS +C   L  A  E G+ID YSIFT  C ++       LKR  R     + 
Sbjct  313  CDLGSSTHPSLQCMSALRVAEVEQGNIDPYSIFTQPCKDT-----ATLKRNMRGHYPWMS  367

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQEL  519
            R YDPCTER+S +YFNLPEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+EL
Sbjct  368  RAYDPCTERYSKVYFNLPEVQKALHANVTGISYPWQTCSDLVGNYWADAPLSMLPIYKEL  427

Query  518  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG---------------  384
            I AG RIWV+SGDTDAV+PVT+TRYSIDALKLPTV+ W PWYDNG               
Sbjct  428  IAAGFRIWVYSGDTDAVVPVTATRYSIDALKLPTVTNWYPWYDNGKVSTDNVIQFLELVS  487

Query  383  ------------------QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAG  258
                              QVGGW+Q Y GLTFV V GAGHEV LHRP+ A  L  SFL  
Sbjct  488  VEIGLHRCLSHQISHFLIQVGGWSQAYRGLTFVTVTGAGHEVPLHRPRQAFILFRSFLEN  547

Query  257  TSMP  246
              MP
Sbjct  548  KPMP  551



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R
Sbjct  252  CYSVSSQHPSLQCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI
Sbjct  308  AYDPCTERYSNVYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  368  AAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  +  SFL    MP
Sbjct  428  VTGAGHEVPLHRPRQAFIIFRSFLENKPMP  457



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L +A  E G+ID YSIFT  C  +  + S  LK R      + R
Sbjct  252  CYSVSSQHPSLQCMEALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI
Sbjct  308  AYDPCTERYSNVYFNRVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  368  AAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  +  SFL    MP
Sbjct  428  VTGAGHEVPLHRPRQAFIIFRSFLENKPMP  457



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 146/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+  +  A  E G ID YSI+T TCT E+ ++ SR  + R      
Sbjct  241  ITCEFVSSEHPSPECSNAMKAADLEQGKIDPYSIYTITCTKEAAALRSRFSRVRHP---W  297

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+
Sbjct  298  MWRAYDPCTERYSGMYFNSPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYK  357

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+PVT TRYSI ALKL  VS W PW DNGQVGGW+Q Y+GLT
Sbjct  358  ELIAAGLRIWVFSGDTDSVVPVTGTRYSIRALKLQPVSKWYPWNDNGQVGGWSQVYQGLT  417

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV LHRP+    L +SFL    +P
Sbjct  418  LVTIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  450



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 157/217 (72%), Gaps = 3/217 (1%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C ++ +++ S EC    + A++E+G ID YS++TP CT S S  S +L +R   + L  +
Sbjct  273  CAHEPYLNASSECGNAHNFAANEIGRIDYYSVYTPKCTSSSSTTSNLLSKRWPTL-LRSQ  331

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTE HS IYFNLPEVQ+ALHV    S  +W TC   V+  WKD   ++L+  +EL 
Sbjct  332  GYDPCTEAHSIIYFNLPEVQQALHVR--GSPVKWETCGLTVHYAWKDSARSLLNTIKELT  389

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            T+G+RIW++SG+TDAVIP+TSTRYS+ AL LPTV  + PWY++GQVGGWTQ+YEGLTFVA
Sbjct  390  TSGIRIWIYSGNTDAVIPITSTRYSLRALNLPTVGSYLPWYEDGQVGGWTQQYEGLTFVA  449

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISD  225
            V  AGHEV LH+PK ALT+ ++FLAGT +   ++ SD
Sbjct  450  VNAAGHEVPLHKPKQALTIFKAFLAGTPLATSKQFSD  486



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 150/244 (61%), Gaps = 36/244 (15%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLL  702
            + CD+ S +HPS +C + L  A  E G+ID YSI+TP C  + S+ S +  R       +
Sbjct  249  IACDFGSSLHPSVQCFQALRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WM  304

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
             R YDPCTERHS +YFN PEVQKALH + T   + W TCSD V ++W D P ++L +Y E
Sbjct  305  SRAYDPCTERHSDVYFNRPEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHE  364

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNG--------------  384
            LI AGLRIWVFSGDTD+V+P+T+TRYSIDALKLPT+  W PWYD+G              
Sbjct  365  LINAGLRIWVFSGDTDSVVPLTATRYSIDALKLPTIINWYPWYDSGKVGANFCKEKLFKF  424

Query  383  ------------------QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAG  258
                              +VGGW+Q Y+GLT V +RGAGHEV LH+P+ A  L  SFL  
Sbjct  425  ILIGMNSGKFDTKIYSSVKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLEN  484

Query  257  TSMP  246
              MP
Sbjct  485  KDMP  488



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C   L  A  E G+ID YSIFT  C  + + + R LK R      + R
Sbjct  252  CYSVSSQHPSMQCMVALRNAELEQGNIDPYSIFTKPCNSTVA-LKRFLKGR---YPWMSR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  +VQKALH + T  S+ W  CSD V  +W D P ++L +Y+ELI
Sbjct  308  AYDPCTERYSNVYFNRLDVQKALHANVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+P+T+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  368  TAGLKIWVFSGDTDAVVPITATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  428  VAGAGHEVPLHRPRQAFILFRSFLESKPMP  457



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L  A  E G+ID YSIFT  C  + ++ +  LK R      + R
Sbjct  253  CYSVSSQHPSLQCMEALRNAELEQGNIDPYSIFTKPCNNTVALKT-FLKGR---YPWMSR  308

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  EVQKALH + T   + W  CSD V  +W D P ++L +Y+ELI
Sbjct  309  AYDPCTERYSNVYFNRVEVQKALHANVTRLRYPWKACSDIVGSYWTDSPMSMLPIYRELI  368

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  369  TAGLKIWVFSGDTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  428

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L +SFL    MP
Sbjct  429  VAGAGHEVPLHRPRQAFILFKSFLENKPMP  458



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +S  HPS +C   L  A  E G+ID YSIFT  C  + ++ S  LK R      + R
Sbjct  249  CYSESSQHPSLQCMVALRNAELEQGNIDPYSIFTKPCNSTVALKS-FLKGR---YPWMSR  304

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPCTER+S +YFN  +VQKALH + T   + W  CSD V  +W+D P ++L +Y+ELI
Sbjct  305  AYDPCTERYSNVYFNRADVQKALHANVTRLPYPWKACSDIVGSYWEDSPLSMLPIYRELI  364

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IW+FSGDTDAV+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  365  TAGLKIWIFSGDTDAVVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVT  424

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  425  VAGAGHEVPLHRPRQAFILFRSFLDSKPMP  454



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 148/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS EC+K ++ A  E G ID YSI+T TC  E+ ++ SR  + R      
Sbjct  244  ITCEFGSSEHPSPECSKAMEAADLEQGHIDPYSIYTITCKKEAAALRSRFSRVRHP---W  300

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+
Sbjct  301  MWRAYDPCTERYSGMYFNSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYK  360

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT
Sbjct  361  ELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDSGQVGGWSQVYKGLT  420

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV LHRP+    L +SFL    +P
Sbjct  421  LVTIHGAGHEVPLHRPRRGFLLFQSFLDNKPLP  453



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HP+ +C + L  A  E G+ID YSIFT  C  +  + S  LK R      + R
Sbjct  252  CYSVSSQHPTLQCMEALRNAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPC+ER+S +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELI
Sbjct  308  AYDPCSERYSNVYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V 
Sbjct  368  TAGLKIWVFSGDTDAVVPITATRYSIDALKLTTITNWYPWYDHGKVGGWSQVYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  428  VAGAGHEVPLHRPRQAFILFRSFLENKPMP  457



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 144/210 (69%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C   S  HPS +C + L  A  E G+ID YSIFT  C  +  + S  LK R      + R
Sbjct  250  CYSVSSQHPSLQCMEALRNAELEQGNIDPYSIFTKPCNNTVELKS-FLKGR---YPWMSR  305

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPC+ER+S +YFN  EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELI
Sbjct  306  AYDPCSERYSNVYFNRVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELI  365

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
            TAGL+IWVFSGDTDAV+P+T+TRYSIDALKL T++ W PWYD+G+V GW+Q Y+GLT V 
Sbjct  366  TAGLKIWVFSGDTDAVVPITATRYSIDALKLATITNWYPWYDHGKVAGWSQVYKGLTLVT  425

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  426  VAGAGHEVPLHRPRQAFILFRSFLENKPMP  455



>sp|P08819.2|CBP2_WHEAT RecName: Full=Serine carboxypeptidase 2; AltName: Full=CPDW-II; 
Short=CP-WII; AltName: Full=Carboxypeptidase D; AltName: 
Full=Serine carboxypeptidase II; Contains: RecName: Full=Serine 
carboxypeptidase 2 chain A; AltName: Full=Serine carboxypeptidase 
II chain A; Contains: RecName: Full=Serine carboxypeptidase 
2 chain B; AltName: Full=Serine carboxypeptidase II 
chain B; Flags: Precursor [Triticum aestivum]
Length=444

 Score =   234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 147/217 (68%), Gaps = 6/217 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-----ESFSIMSRVLKRRDRKV  711
            C + SFIHPS  C+   D A+ E G+ID YS++TP C       S S      +R   + 
Sbjct  222  CLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNITSSSSSSSSSLSQQRRSRGRY  281

Query  710  GLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLD  534
              L   YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L 
Sbjct  282  PWLTGSYDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLP  341

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+
Sbjct  342  IYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYK  401

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            GLT V+VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  402  GLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  438



>ref|XP_010527107.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=207

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 135/190 (71%), Gaps = 1/190 (1%)
 Frame = -2

Query  797  IDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVH  618
            +D Y +FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV 
Sbjct  2    VDQYIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVP  60

Query  617  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  438
               +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI
Sbjct  61   PEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSI  120

Query  437  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAG  258
            +AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHRPK +L L ++F++G
Sbjct  121  EALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSG  180

Query  257  TSMPGLQRIS  228
              +P  ++ S
Sbjct  181  NPLPTSEKNS  190



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++    HPS +C+K ++ A +E G+ID YSI+T TC  E+ ++ SR L+ R      
Sbjct  241  ITCEFGYSEHPSPKCSKAMEAAYNEQGNIDPYSIYTITCKKEAEALRSRFLRVRHP---W  297

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTER+S +YFN  EVQKA+H + T  S+ W +CSD V   W D P ++L +Y+
Sbjct  298  MWRAYDPCTERYSGMYFNSLEVQKAMHANRTGISYPWTSCSDIVGAKWADSPLSMLPIYK  357

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+PVT TRYSI +LKL  +S W PWYDN QVGGW Q Y+GLT
Sbjct  358  ELIAAGLRIWVFSGDTDSVVPVTGTRYSIRSLKLQPISKWYPWYDNEQVGGWCQVYKGLT  417

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSM  249
             V + GAGHEV L RP+ A  L +SFL    M
Sbjct  418  LVTIHGAGHEVPLFRPRRAFLLFKSFLENKPM  449



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 147/213 (69%), Gaps = 4/213 (2%)
 Frame = -2

Query  881  LLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGL  705
            + C++ S  HPS +C K ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      
Sbjct  242  ITCEFGSSEHPSSKCTKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---W  298

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            + R YDPCTE++S +YFN PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+
Sbjct  299  MWRAYDPCTEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYK  358

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLT  345
            ELI AGLRIWVFSGDTD+V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT
Sbjct  359  ELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLT  418

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
             V + GAGHEV L RP+ A  L +SFL    +P
Sbjct  419  LVTIHGAGHEVPLFRPRRAFLLFQSFLDNKPLP  451



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 144/240 (60%), Gaps = 34/240 (14%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            CD  S  HPS +C   L  A  E G+ID YSIFT  C ++ ++   +          + R
Sbjct  246  CDLGSSTHPSLQCMNALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSR  301

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTC-----------------------  585
             YDPCTER+S +YFN  EVQKALH + T  S+ W TC                       
Sbjct  302  AYDPCTERYSKVYFNRLEVQKALHANVTALSYPWQTCRYDHFLNTSRIFKIFVSNIYFIR  361

Query  584  -------SDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALK  426
                   SD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALK
Sbjct  362  ICKSLFYSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDALK  421

Query  425  LPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            LPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  422  LPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  481



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -2

Query  884  NLLCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGL  705
            N+ CDY+SF+H S +C+K++D AS E G+ID+YSIFTPTC  SF+     + +R    G 
Sbjct  252  NVFCDYESFVHSSPQCDKIMDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGK  311

Query  704  LRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
            +   YDPCTE+HST+YFNL EVQKALHV+T     +W TCS+ V   W DC  +VL +Y 
Sbjct  312  MGEQYDPCTEKHSTVYFNLAEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYH  371

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGL  348
            ELI  GLRIWVFSGDTDAVIPVTSTRYSIDALKLPT++PW  WY D+G+VG ++ +  GL
Sbjct  372  ELIQYGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTITPWHAWYDDDGEVGPFSPKLIGL  431



>emb|CAA70815.1| serine carboxypeptidase II, CP-MII [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86051.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=476

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 147/215 (68%), Gaps = 4/215 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT--ESFSIMSRVLKRRDRKVGLL  702
            C + SFIHPS  C+   D A+ E G+ID YS++TP C    S S  S   +R   +   L
Sbjct  254  CLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNISSSSSSSSLSRRRTRGRYPWL  313

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
               YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+
Sbjct  314  TGSYDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYR  373

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGL  348
            ELI AGLRIWVFSGDTDAV+P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GL
Sbjct  374  ELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGL  433

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            T V+VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  434  TLVSVRGAGHEVPLHRPRQALILFQQFLQGKPMPG  468



>sp|P08818.2|CBP2_HORVU RecName: Full=Serine carboxypeptidase 2; AltName: Full=CP-MII; 
AltName: Full=Carboxypeptidase D; AltName: Full=Serine carboxypeptidase 
II; Contains: RecName: Full=Serine carboxypeptidase 
2 chain A; AltName: Full=Serine carboxypeptidase II chain 
A; Contains: RecName: Full=Serine carboxypeptidase 2 chain 
B; AltName: Full=Serine carboxypeptidase II chain B; Flags: 
Precursor [Hordeum vulgare]
Length=476

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 146/215 (68%), Gaps = 4/215 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT--ESFSIMSRVLKRRDRKVGLL  702
            C + SFIHPS  C+   D A+ E G+ID YS++TP C    S S  S   +R   +   L
Sbjct  254  CLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNISSSSSSSSLSRRRTRGRYPWL  313

Query  701  RRIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQ  525
               YDPCTER+ST Y+N  +VQ ALH + T + ++ W  CSD +   W D P ++L +Y+
Sbjct  314  TGSYDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWTNCSDTINTHWHDAPRSMLPIYR  373

Query  524  ELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGL  348
            ELI AGLRIWVFSGDTDAV+P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GL
Sbjct  374  ELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGL  433

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPG  243
            T V+VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  434  TLVSVRGAGHEVPLHRPRQALILFQQFLQGKPMPG  468



>gb|KDP38690.1| hypothetical protein JCGZ_04043 [Jatropha curcas]
Length=254

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 144/214 (67%), Gaps = 4/214 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLR  699
            C+++     SE+C++ ++ A + E GDID YSI+TP+C +  +  S +   R  K  LLR
Sbjct  39   CNFKDENRSSEKCDEAVNYAMNHEFGDIDQYSIYTPSCIQLQNNKSNLRPLRLFKNTLLR  98

Query  698  -RI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVY  528
             RI  YDPCTE ++  Y+N P+VQKA+H + T   ++W  CSD +   W+D  ++VL +Y
Sbjct  99   GRISGYDPCTENYAEKYYNRPDVQKAMHANVTGIPYKWTACSDVLIKNWRDSESSVLPIY  158

Query  527  QELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGL  348
            +ELI AGLRIWVFSGDTD+V+PVT+TR+S+  L L   + W PWY   QVGGWT+ Y GL
Sbjct  159  KELIAAGLRIWVFSGDTDSVVPVTATRFSLSHLNLTVKTRWYPWYSGNQVGGWTEAYNGL  218

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            TF  VRGAGHEV L +P+ A  L  SF+AG  +P
Sbjct  219  TFATVRGAGHEVPLFQPRRAFILFRSFVAGKELP  252



>ref|XP_002440854.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
 gb|EES19284.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
Length=495

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 144/228 (63%), Gaps = 18/228 (8%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG----  708
            C +    H S  CN   D A+ E GDID YS++TPTC ++ S  S    RR R++     
Sbjct  262  CVHDEIEHASPPCNAAYDAATAEQGDIDPYSMYTPTCNQTSSSSSSSTPRRIRRLKGRYP  321

Query  707  LLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWV-------------TCSDEVYD  567
             +R  YD CTERHST+Y+N PEVQ+ALH + T                      SD + +
Sbjct  322  WMRASYDTCTERHSTVYYNRPEVQRALHANVTGIKLHMGHLQFGAYMHVLLNDSSDTISN  381

Query  566  FWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN  387
             W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPTV  W PWYD+
Sbjct  382  NWGDSPKSMLHIYKELIAAGLRIWVFSGDTDSVVPLTATRYSIDALDLPTVVSWYPWYDD  441

Query  386  -GQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
              +VGGW++ Y GLT V VRGAGHEV LHRP+ AL L + FL G  MP
Sbjct  442  IKEVGGWSKVYNGLTLVTVRGAGHEVPLHRPRQALMLFQHFLNGEPMP  489



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 138/210 (66%), Gaps = 7/210 (3%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +   H S  C + L+ A  E G+ID  SIFT  C  + ++   +        G   R
Sbjct  252  CHLEFAQHLSLACTEALELADSEFGNIDPTSIFTRPCGSAAALKGNL-------SGHYSR  304

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPC ER+S  YFN PEVQKALH + T  S+ W TCSD + + W D P ++L +YQELI
Sbjct  305  AYDPCAERYSEKYFNHPEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELI  364

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V 
Sbjct  365  AAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVT  424

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGH V L RP+ A  L +SFL    MP
Sbjct  425  ITGAGHLVPLLRPREAFILFKSFLENKPMP  454



>ref|XP_008352213.1| PREDICTED: serine carboxypeptidase 24-like, partial [Malus domestica]
Length=332

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 142/205 (69%), Gaps = 7/205 (3%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPC  681
            S++C+  ++ A+D + GDID YSI+TP C    +   R L+ ++    LLRR    YDPC
Sbjct  128  SKQCDDAINYATDHDFGDIDPYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPC  184

Query  680  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  501
            TE ++  Y+N P+VQKA+H + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLR
Sbjct  185  TENYAEKYYNRPDVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLR  244

Query  500  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAG  321
            IWVFSGDTD+V+PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAG
Sbjct  245  IWVFSGDTDSVVPVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAG  304

Query  320  HEVALHRPKLALTLVESFLAGTSMP  246
            HEV L + +  LTL +SFLAG  +P
Sbjct  305  HEVPLIQAERGLTLFKSFLAGKKLP  329



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 141/202 (70%), Gaps = 4/202 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTER  672
            S++C+ V   A + E G+ID YSI+TPTCT S +   R ++ ++     L   YDPCTE 
Sbjct  261  SKKCDDVYSYAVNYEFGNIDQYSIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTEN  317

Query  671  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  492
            ++  Y+NLPEVQ A+H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGLRIWV
Sbjct  318  YAEKYYNLPEVQIAMHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWV  377

Query  491  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  312
            FSGDTD+V+PVT+TR+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV
Sbjct  378  FSGDTDSVVPVTATRFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEV  437

Query  311  ALHRPKLALTLVESFLAGTSMP  246
             L +PK A  L +SFLAG  +P
Sbjct  438  PLFQPKRAYILFKSFLAGNELP  459



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 138/210 (66%), Gaps = 4/210 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRR  696
            C  +   H S  C + L+ A  E G+ID  SIFT  C  + ++   +      K     R
Sbjct  252  CHLEFAQHLSLACTEALELADSEFGNIDPTSIFTRPCGSAAALKGNLSGHYPWK----SR  307

Query  695  IYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELI  516
             YDPC ER+S  YFN PEVQKALH + T  S+ W TCSD + + W D P ++L +YQELI
Sbjct  308  AYDPCAERYSEKYFNHPEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELI  367

Query  515  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  336
             AGL+IWV+SGDTDAV+PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V 
Sbjct  368  AAGLKIWVYSGDTDAVVPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVT  427

Query  335  VRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            + GAGH V L RP+ A  L +SFL    MP
Sbjct  428  ITGAGHLVPLLRPREAFILFKSFLENKPMP  457



>ref|XP_007154876.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
 gb|ESW26870.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
Length=371

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 136/206 (66%), Gaps = 10/206 (5%)
 Frame = -2

Query  848  SEECNKVLDTASD-----ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDP  684
            SEE +K  D A       E G ID YSI+TPTCT S ++     K      G     YDP
Sbjct  169  SEETSKKCDDAYSYAVNYEFGKIDQYSIYTPTCTTSQTVRHIRFKNLHMISG-----YDP  223

Query  683  CTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGL  504
            CTE ++  Y+NLPEVQKA+H + TN  ++W  CS+ +   WKD   +VL +Y+ELI AGL
Sbjct  224  CTENYAEKYYNLPEVQKAMHANLTNIPYKWTACSEVLLKNWKDSEISVLPIYKELIAAGL  283

Query  503  RIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGA  324
            +IWVFSGDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ Y GLTF  VRGA
Sbjct  284  KIWVFSGDTDSVVPVTATRFSLNHLNLSIKTRWYPWYSGGQVGGWTEVYNGLTFATVRGA  343

Query  323  GHEVALHRPKLALTLVESFLAGTSMP  246
            GHEV L +PK A TL +SFLAG  +P
Sbjct  344  GHEVPLFQPKRAYTLFKSFLAGKELP  369



>gb|KDO59486.1| hypothetical protein CISIN_1g0120681mg, partial [Citrus sinensis]
Length=381

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 142/211 (67%), Gaps = 5/211 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCT  678
            S++C+  ++ A + E GDID YSI+TP+C    +  S V   R +   L RR+  YDPCT
Sbjct  172  SKKCDDTVNYAMNHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCT  229

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E ++  Y+N  EVQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+I
Sbjct  230  ENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKI  289

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WVFSGDTD+V+PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGH
Sbjct  290  WVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGH  349

Query  317  EVALHRPKLALTLVESFLAGTSMPGLQRISD  225
            EV L +P+ AL L  SFLAG  +P  + IS 
Sbjct  350  EVPLFQPRRALILFRSFLAGKQLPKSRHISQ  380



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 140/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTER  672
            S++C+ V   A + E G+ID Y I+TPTCT S +   R ++ ++     L   YDPCTE 
Sbjct  260  SKKCDDVYSYAVNYEFGNIDQYIIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTEN  316

Query  671  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  492
            ++  Y+NLPEVQ A+H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGLRIWV
Sbjct  317  YAEKYYNLPEVQIAMHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWV  376

Query  491  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  312
            FSGDTD+V+PVT+TR+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV
Sbjct  377  FSGDTDSVVPVTATRFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEV  436

Query  311  ALHRPKLALTLVESFLAGTSMP  246
             L +PK A  L +SFLAG  +P
Sbjct  437  PLFQPKRAYILFKSFLAGNELP  458



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 139/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTER  672
            S +C+ V   A + E G+ID YSI+TPTCT S +   R ++ ++     L   YDPCTE 
Sbjct  260  SGKCDDVYSYAVNYEFGNIDQYSIYTPTCTASQNNTVRHMRFKNLH---LISGYDPCTEN  316

Query  671  HSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  492
            ++  Y+NLPEVQKA+H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGL+IWV
Sbjct  317  YAEKYYNLPEVQKAMHANVTNIPYKWTACSDVLLKNWKDSAISVLPIYKELIAAGLKIWV  376

Query  491  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEV  312
            FSGDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV
Sbjct  377  FSGDTDSVVPVTATRFSLNHLNLSIRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEV  436

Query  311  ALHRPKLALTLVESFLAGTSMP  246
             L +PK A  L +SFLA   +P
Sbjct  437  PLFQPKRAYILFKSFLAAKELP  458



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 140/204 (69%), Gaps = 5/204 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCT  678
            S++C+  +  A + E GDID YSI+TP+C    +  +R +  R +   L RR+  YDPCT
Sbjct  262  SQKCDDAVSYAMNHEFGDIDQYSIYTPSCLALTNNSARHI--RLKNTLLHRRVSGYDPCT  319

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E ++  Y+N P+VQKA+H +TT   ++W  CSD +   WKD   +VL +Y+ELI AGLRI
Sbjct  320  ENYAEKYYNRPDVQKAMHANTTGIPYKWTACSDVLIKNWKDSENSVLPIYKELIAAGLRI  379

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WVFSGDTD+V+PVT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH
Sbjct  380  WVFSGDTDSVVPVTATRFSLSHLNLHIKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGH  439

Query  317  EVALHRPKLALTLVESFLAGTSMP  246
            EV L +PK A  L +SFLAG  +P
Sbjct  440  EVPLFQPKRAFILYKSFLAGKELP  463



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 142/211 (67%), Gaps = 5/211 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCT  678
            S++C+  ++ A + E GDID YSI+TP+C    +  S V   R +   L RR+  YDPCT
Sbjct  262  SKKCDDTVNYAMNHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCT  319

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E ++  Y+N  EVQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+I
Sbjct  320  ENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKI  379

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WVFSGDTD+V+PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGH
Sbjct  380  WVFSGDTDSVVPVTATRFSVSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGH  439

Query  317  EVALHRPKLALTLVESFLAGTSMPGLQRISD  225
            EV L +P+ AL L  SFLAG  +P  + IS 
Sbjct  440  EVPLFQPRRALILFRSFLAGKQLPKSRHISQ  470



>ref|XP_010656616.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Vitis vinifera]
Length=381

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 6/216 (3%)
 Frame = -2

Query  878  LCDYQSFI--HPSEECNKVLDTA-SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG  708
            + D+  FI    SE+C++ +  A + E GDID YSI+TP+C  +    S +   R +   
Sbjct  162  IMDHCDFIAERTSEKCDEAVSYAINHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSL  220

Query  707  LLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLD  534
            + RR+  YDPCTE ++  Y+N P+VQKA+H ++T   ++W  CS  +  +W D   ++L 
Sbjct  221  VRRRVSGYDPCTENYAEKYYNRPDVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLP  280

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y+ELI AGLRIWVFSGDTDAV+PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YE
Sbjct  281  IYKELIEAGLRIWVFSGDTDAVVPVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYE  340

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            GLTF  VRGAGHEV L +P  A  L  SFL G  +P
Sbjct  341  GLTFATVRGAGHEVPLFQPMRAFLLFRSFLGGKQLP  376



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 142/211 (67%), Gaps = 5/211 (2%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCT  678
            S++C+  ++ A + E GDID YSI+TP+C    +  S V   R +   L RR+  YDPCT
Sbjct  262  SKKCDDTVNYAMNHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCT  319

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E ++  Y+N  EVQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+I
Sbjct  320  ENYAEKYYNRQEVQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKI  379

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WVFSGDTD+V+PVT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGH
Sbjct  380  WVFSGDTDSVVPVTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGH  439

Query  317  EVALHRPKLALTLVESFLAGTSMPGLQRISD  225
            EV L +P+ AL L  SFLAG  +P  + IS 
Sbjct  440  EVPLFQPRRALILFRSFLAGKQLPKSRHISQ  470



>ref|XP_002451122.1| hypothetical protein SORBIDRAFT_05g024440 [Sorghum bicolor]
 gb|EES10110.1| hypothetical protein SORBIDRAFT_05g024440 [Sorghum bicolor]
Length=497

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 144/213 (68%), Gaps = 4/213 (2%)
 Frame = -2

Query  878  LCDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLR  699
            +C   SFIH + EC K+ D A +E G ID YSI+TP C +      R L+ R   + +L 
Sbjct  268  VCPGSSFIHVTPECRKIWDKALEEQGHIDGYSIYTPPCDKGSPYAHR-LQSRPHPLMMLP  326

Query  698  RIYDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQE  522
              YDPCT  +ST Y NLPEVQ A+H + + S  + WV CS+ ++D W D  T++L +Y+E
Sbjct  327  -AYDPCTAFYSTKYLNLPEVQTAMHANVSGSMEYPWVVCSNLLFDNWTDAATSMLPIYRE  385

Query  521  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGGWTQEYEGLT  345
            LI  GL++WVFSGDTD V+P+++TR S+ AL LP  + W PWY  + +VGGWT EYEGLT
Sbjct  386  LIEGGLKVWVFSGDTDTVVPLSATRRSLAALSLPVKTSWYPWYMVSTEVGGWTMEYEGLT  445

Query  344  FVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            +V VRGAGHEV LHRP+ AL L++ FL G  MP
Sbjct  446  YVTVRGAGHEVPLHRPEQALFLLKQFLKGEPMP  478



>ref|XP_008394313.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Malus domestica]
Length=472

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 142/205 (69%), Gaps = 7/205 (3%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPC  681
            S++C+  ++ A+D + GDID YSI+TP C    +   R L+ ++    LLRR    YDPC
Sbjct  268  SKQCDDAINYATDHDFGDIDPYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPC  324

Query  680  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  501
            TE ++  Y+N P+VQKA+H + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLR
Sbjct  325  TENYAEKYYNRPDVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLR  384

Query  500  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAG  321
            IWVFSGDTD+V+PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAG
Sbjct  385  IWVFSGDTDSVVPVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAG  444

Query  320  HEVALHRPKLALTLVESFLAGTSMP  246
            HEV L + +  LTL +SFLAG  +P
Sbjct  445  HEVPLIQAERGLTLFKSFLAGKKLP  469



>gb|EMT11707.1| Serine carboxypeptidase-like 27 [Aegilops tauschii]
Length=607

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 138/215 (64%), Gaps = 28/215 (13%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCTESFSI-----------------  747
            C + S  HPS EC K L+ AS E G+ID YS++T  C  S S+                 
Sbjct  231  CLFDSSEHPSPECVKNLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYFLHKKVQWS  290

Query  746  ---MSR--------VLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSF  600
               MSR        ++ ++  K   L R YDPCTER+S IY+NLPEVQ ALH +TT   +
Sbjct  291  VDSMSRHQCNVNNEMMVKQQPKRPWLSRAYDPCTERYSNIYYNLPEVQAALHANTTGIKY  350

Query  599  EWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLP  420
             W TCSD V  +W D P ++L +Y ELI AG+RIWVFSGDTDAV+PVT+TRYSI ALKLP
Sbjct  351  PWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDAVVPVTATRYSISALKLP  410

Query  419  TVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHE  315
            T+  W PWYD+G+VGGW+Q Y+GLT V V GAGHE
Sbjct  411  TLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHE  445



>ref|XP_012071521.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Jatropha curcas]
Length=470

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 144/214 (67%), Gaps = 4/214 (2%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLR  699
            C+++     SE+C++ ++ A + E GDID YSI+TP+C +  +  S +   R  K  LLR
Sbjct  255  CNFKDENRSSEKCDEAVNYAMNHEFGDIDQYSIYTPSCIQLQNNKSNLRPLRLFKNTLLR  314

Query  698  -RI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVY  528
             RI  YDPCTE ++  Y+N P+VQKA+H + T   ++W  CSD +   W+D  ++VL +Y
Sbjct  315  GRISGYDPCTENYAEKYYNRPDVQKAMHANVTGIPYKWTACSDVLIKNWRDSESSVLPIY  374

Query  527  QELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGL  348
            +ELI AGLRIWVFSGDTD+V+PVT+TR+S+  L L   + W PWY   QVGGWT+ Y GL
Sbjct  375  KELIAAGLRIWVFSGDTDSVVPVTATRFSLSHLNLTVKTRWYPWYSGNQVGGWTEAYNGL  434

Query  347  TFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            TF  VRGAGHEV L +P+ A  L  SF+AG  +P
Sbjct  435  TFATVRGAGHEVPLFQPRRAFILFRSFVAGKELP  468



>ref|XP_009358427.1| PREDICTED: serine carboxypeptidase 24 [Pyrus x bretschneideri]
Length=472

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 141/208 (68%), Gaps = 7/208 (3%)
 Frame = -2

Query  848  SEECNKVLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPC  681
            S++C   ++ A+D + GDID YSI+TP C    +   R L+ ++    LLRR    YDPC
Sbjct  268  SKQCEDAINYATDHDFGDIDPYSIYTPFCLTMLNNRKRHLRLKNT---LLRRRASGYDPC  324

Query  680  TERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLR  501
            TE ++  Y+N P+VQKA+H + T   ++W  CSD ++ +WKD   +VL  Y+ELI AGLR
Sbjct  325  TENYAEKYYNRPDVQKAMHANVTRIPYKWTACSDVLFKYWKDSEYSVLPTYKELIAAGLR  384

Query  500  IWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAG  321
            IWVFSGDTD+V+PVT+TR S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAG
Sbjct  385  IWVFSGDTDSVVPVTATRLSLNHLNLTIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAG  444

Query  320  HEVALHRPKLALTLVESFLAGTSMPGLQ  237
            HEV L + +  LTL +SFLAG  +P L 
Sbjct  445  HEVPLIQAERGLTLFKSFLAGKKLPKLN  472



>emb|CAN79972.1| hypothetical protein VITISV_010072 [Vitis vinifera]
Length=434

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 6/216 (3%)
 Frame = -2

Query  878  LCDYQSFI--HPSEECNKVLDTA-SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG  708
            + D+  FI    SE+C++ +  A + E GDID YSI+TP+C  +    S +   R +   
Sbjct  215  IMDHCDFIAERTSEKCDEAVSYAVNHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSL  273

Query  707  LLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLD  534
            + RR+  YDPCTE ++  Y+N P+VQKA+H ++T   ++W  CS  +  +W D   ++L 
Sbjct  274  VRRRVSGYDPCTENYAEKYYNRPDVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLP  333

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y+ELI AGLRIWVFSGDTDAV+PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YE
Sbjct  334  IYKELIEAGLRIWVFSGDTDAVVPVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYE  393

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            GLTF  VRGAGHEV L +P  A  L  SFL G  +P
Sbjct  394  GLTFATVRGAGHEVPLFQPMRAFHLFRSFLGGKQLP  429



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 137/204 (67%), Gaps = 6/204 (3%)
 Frame = -2

Query  848  SEECNKVLDTA-SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIY--DPCT  678
            S +C+K ++ A + E GDID YSI+TP C  S +    +   R +   L RR+Y  DPCT
Sbjct  223  SSKCDKAINYALNHEFGDIDQYSIYTPICKASKNTTRSI---RLKNTLLHRRVYGYDPCT  279

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E ++  Y+N P+VQKA+H + T   + W  CSD +   WKD   ++L  Y+EL+  GLRI
Sbjct  280  ENYAEKYYNRPDVQKAMHANATGIPYRWTACSDFLLKNWKDSQFSMLPTYKELMEGGLRI  339

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WVFSGDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ YEGLTF  VRGAGH
Sbjct  340  WVFSGDTDSVVPVTATRFSLNHLNLTVKTRWYPWYSGGQVGGWTEVYEGLTFATVRGAGH  399

Query  317  EVALHRPKLALTLVESFLAGTSMP  246
            EV L +P+ ALTL  SFLAG  +P
Sbjct  400  EVPLFQPERALTLFRSFLAGAELP  423



>ref|XP_002275684.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 ref|XP_010656614.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 emb|CBI36538.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 143/216 (66%), Gaps = 6/216 (3%)
 Frame = -2

Query  878  LCDYQSFI--HPSEECNKVLDTA-SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG  708
            + D+  FI    SE+C++ +  A + E GDID YSI+TP+C  +    S +   R +   
Sbjct  250  IMDHCDFIAERTSEKCDEAVSYAINHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSL  308

Query  707  LLRRI--YDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLD  534
            + RR+  YDPCTE ++  Y+N P+VQKA+H ++T   ++W  CS  +  +W D   ++L 
Sbjct  309  VRRRVSGYDPCTENYAEKYYNRPDVQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLP  368

Query  533  VYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYE  354
            +Y+ELI AGLRIWVFSGDTDAV+PVT+TR+S++ L L   +PW PWY  GQVGGWT+ YE
Sbjct  369  IYKELIEAGLRIWVFSGDTDAVVPVTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYE  428

Query  353  GLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  246
            GLTF  VRGAGHEV L +P  A  L  SFL G  +P
Sbjct  429  GLTFATVRGAGHEVPLFQPMRAFLLFRSFLGGKQLP  464



>gb|EMT08964.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=389

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 144/245 (59%), Gaps = 34/245 (14%)
 Frame = -2

Query  875  CDYQSFIHPSEECNKVLDTASDELGDIDTYSIFTPTCT----------------ESFSIM  744
            C   SFIHPS  C+  +D A+ E G+ID YS++TP C                 +  S+ 
Sbjct  137  CLNDSFIHPSPACDAAVDVATAEQGNIDMYSLYTPVCNSTSWSSSRRRDPGGNIDMSSLY  196

Query  743  SRVLKRR-----------------DRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHT  615
            + V                     D     +   YDPCT  +ST Y+N  +VQ+ALH + 
Sbjct  197  TPVCNSTSWSSSRRRPRGRYVSILDPDSPWMTGSYDPCTAGYSTAYYNRRDVQRALHANV  256

Query  614  TNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  438
            T +  + W TCS  +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+ +TR+SI
Sbjct  257  TGAMDYTWATCSHTINTHWHDTPRSMLPIYKELIAAGLRIWVFSGDTDAVVPLAATRHSI  316

Query  437  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAG  258
             AL LPT + W PWYD+ +VGGW+Q Y+GLT V++RGAGHEV LHRP+ AL L + FL G
Sbjct  317  GALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSIRGAGHEVPLHRPRQALVLFQQFLQG  376

Query  257  TSMPG  243
              MPG
Sbjct  377  KPMPG  381



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 137/204 (67%), Gaps = 6/204 (3%)
 Frame = -2

Query  848  SEECNKVLDTA-SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIY--DPCT  678
            S +C+K ++ A + E GDID YSI+TP C  S +    +   R +   L RR+Y  DPCT
Sbjct  254  SSKCDKAINYALNHEFGDIDQYSIYTPICKASKNTTRSI---RLKNTLLHRRVYGYDPCT  310

Query  677  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  498
            E ++  Y+N P+VQKA+H + T   + W  CSD +   WKD   ++L  Y+EL+  GLRI
Sbjct  311  ENYAEKYYNRPDVQKAMHANATGIPYRWTACSDFLLKNWKDSQFSMLPTYKELMEGGLRI  370

Query  497  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  318
            WVFSGDTD+V+PVT+TR+S++ L L   + W PWY  GQVGGWT+ YEGLTF  VRGAGH
Sbjct  371  WVFSGDTDSVVPVTATRFSLNHLNLTVKTRWYPWYSGGQVGGWTEVYEGLTFATVRGAGH  430

Query  317  EVALHRPKLALTLVESFLAGTSMP  246
            EV L +P+ ALTL  SFLAG  +P
Sbjct  431  EVPLFQPERALTLFRSFLAGAELP  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2018536237851