BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5491

Length=843
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09740.1|  unnamed protein product                                269   1e-81   Coffea canephora [robusta coffee]
ref|XP_010053261.1|  PREDICTED: glutamate--cysteine ligase, chlor...    244   4e-81   Eucalyptus grandis [rose gum]
ref|XP_011080960.1|  PREDICTED: glutamate--cysteine ligase, chlor...    264   1e-80   Sesamum indicum [beniseed]
gb|AFP93564.1|  GCS                                                     263   4e-80   Cestrum nocturnum [night jessamine]
ref|XP_011072645.1|  PREDICTED: glutamate--cysteine ligase, chlor...    261   2e-79   Sesamum indicum [beniseed]
ref|XP_009617977.1|  PREDICTED: glutamate--cysteine ligase, chlor...    260   3e-79   Nicotiana tomentosiformis
ref|XP_009766955.1|  PREDICTED: glutamate--cysteine ligase, chlor...    260   4e-79   Nicotiana sylvestris
gb|AFF18844.2|  gamma-glutamylcysteine synthetase                       259   5e-79   Dimocarpus longan [longan]
dbj|BAP47506.1|  gamma-glutamylcysteine synthetase                      259   1e-78   Gentiana triflora
dbj|BAD27390.1|  gamma-glutamylcysteine synthetase                      259   1e-78   Zinnia elegans [garden zinnia]
gb|KDO76210.1|  hypothetical protein CISIN_1g010751mg                   255   2e-78   Citrus sinensis [apfelsine]
gb|KJB37542.1|  hypothetical protein B456_006G209400                    258   2e-78   Gossypium raimondii
ref|XP_010529570.1|  PREDICTED: glutamate--cysteine ligase, chlor...    258   2e-78   Tarenaya hassleriana [spider flower]
gb|KJB37540.1|  hypothetical protein B456_006G209400                    258   3e-78   Gossypium raimondii
ref|XP_002509800.1|  Glutamate--cysteine ligase, chloroplast prec...    258   4e-78   Ricinus communis
ref|XP_007040225.1|  Glutamate-cysteine ligase isoform 1                258   4e-78   
gb|ABK96626.1|  unknown                                                 257   1e-77   Populus trichocarpa x Populus deltoides
gb|KDO76209.1|  hypothetical protein CISIN_1g010751mg                   256   1e-77   Citrus sinensis [apfelsine]
ref|XP_006439553.1|  hypothetical protein CICLE_v10019696mg             256   1e-77   Citrus clementina [clementine]
gb|KDO76206.1|  hypothetical protein CISIN_1g010751mg                   255   1e-77   Citrus sinensis [apfelsine]
ref|XP_008437270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    256   1e-77   Cucumis melo [Oriental melon]
ref|XP_002273626.1|  PREDICTED: glutamate--cysteine ligase, chlor...    256   1e-77   Vitis vinifera
ref|NP_001234010.1|  glutamate--cysteine ligase, chloroplastic          256   1e-77   
ref|XP_011022699.1|  PREDICTED: glutamate--cysteine ligase, chlor...    256   1e-77   Populus euphratica
ref|XP_010325297.1|  PREDICTED: glutamate--cysteine ligase, chlor...    256   1e-77   
ref|XP_006343987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    256   2e-77   Solanum tuberosum [potatoes]
ref|XP_006476577.1|  PREDICTED: glutamate--cysteine ligase, chlor...    256   2e-77   
emb|CAL59719.1|  gamma-glutamylcysteinyl synthetase                     246   2e-77   Medicago sativa [alfalfa]
ref|XP_008392576.1|  PREDICTED: glutamate--cysteine ligase, chlor...    246   3e-77   
gb|ABM46854.1|  gamma-glutamylcysteine synthetase                       255   3e-77   Chorispora bungeana
ref|XP_010255398.1|  PREDICTED: glutamate--cysteine ligase, chlor...    255   4e-77   Nelumbo nucifera [Indian lotus]
gb|EPS61788.1|  gamma-glutamylcysteine synthetase                       253   6e-77   Genlisea aurea
ref|XP_002867730.1|  hypothetical protein ARALYDRAFT_492552             254   6e-77   
gb|AAL16161.1|AF428393_1  AT4g23100/F7H19_290                           254   6e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194041.1|  glutamate-cysteine ligase                             254   6e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AAL61610.1|AF401621_1  gamma-glutamylcysteine synthetase             253   7e-77   Allium cepa
emb|CAA71075.1|  gamma-glutamylcysteine synthetase                      254   8e-77   Arabidopsis thaliana [mouse-ear cress]
gb|EYU23478.1|  hypothetical protein MIMGU_mgv1a004459mg                254   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_009350437.1|  PREDICTED: glutamate--cysteine ligase, chlor...    253   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_008341055.1|  PREDICTED: glutamate--cysteine ligase, chlor...    254   1e-76   Malus domestica [apple tree]
gb|KJB37541.1|  hypothetical protein B456_006G209400                    253   2e-76   Gossypium raimondii
gb|ABJ98542.1|  gamma-glutamylcysteine synthetase                       253   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283533.1|  hypothetical protein CARUB_v10004582mg             253   3e-76   Capsella rubella
ref|XP_009350436.1|  PREDICTED: glutamate--cysteine ligase, chlor...    253   3e-76   Pyrus x bretschneideri [bai li]
gb|AAL08228.1|  AT4g23100/F7H19_290                                     253   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298035.2|  hypothetical protein POPTR_0001s09340g             253   3e-76   Populus trichocarpa [western balsam poplar]
ref|XP_011029270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    253   3e-76   Populus euphratica
gb|KCW77523.1|  hypothetical protein EUGRSUZ_D01848                     245   5e-76   Eucalyptus grandis [rose gum]
gb|KDP25439.1|  hypothetical protein JCGZ_20595                         250   6e-76   Jatropha curcas
ref|XP_012086908.1|  PREDICTED: glutamate--cysteine ligase, chlor...    252   7e-76   
ref|XP_010540831.1|  PREDICTED: glutamate--cysteine ligase, chlor...    251   9e-76   Tarenaya hassleriana [spider flower]
ref|XP_006413578.1|  hypothetical protein EUTSA_v10024916mg             251   1e-75   
ref|XP_007209899.1|  hypothetical protein PRUPE_ppa004151mg             251   2e-75   Prunus persica
ref|XP_011463882.1|  PREDICTED: glutamate--cysteine ligase, chlor...    251   2e-75   Fragaria vesca subsp. vesca
ref|XP_010448772.1|  PREDICTED: glutamate--cysteine ligase, chlor...    251   2e-75   Camelina sativa [gold-of-pleasure]
gb|AAF22137.1|AF128455_1  gamma-glutamylcysteine synthetase precu...    250   2e-75   Pisum sativum [garden pea]
gb|ERN13322.1|  hypothetical protein AMTR_s00041p00090940               248   2e-75   Amborella trichopoda
gb|AHC02699.1|  gamma-glutamylcysteine synthetase                       249   3e-75   Pyrus calleryana [Bradford pear]
gb|ADE06226.1|  gamma-glutamylcysteine synthetase                       250   4e-75   Hevea brasiliensis [jebe]
ref|XP_010439228.1|  PREDICTED: glutamate--cysteine ligase, chlor...    250   4e-75   Camelina sativa [gold-of-pleasure]
gb|KHN16824.1|  Glutamate--cysteine ligase, chloroplastic               249   4e-75   Glycine soja [wild soybean]
gb|AHJ60103.1|  gamma-glutamylcysteine synthetase                       250   4e-75   Pyrus betulifolia
pdb|2GWD|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    248   5e-75   Brassica juncea [brown mustard]
ref|XP_003525397.1|  PREDICTED: glutamate--cysteine ligase, chlor...    249   6e-75   Glycine max [soybeans]
ref|XP_009402382.1|  PREDICTED: glutamate--cysteine ligase A, chl...    249   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003630512.1|  Glutamate-cysteine ligase                          249   7e-75   Medicago truncatula
sp|O23736.1|GSH1_BRAJU  RecName: Full=Glutamate--cysteine ligase,...    249   8e-75   Brassica juncea [brown mustard]
ref|XP_008238836.1|  PREDICTED: glutamate--cysteine ligase, chlor...    249   8e-75   Prunus mume [ume]
ref|XP_010433943.1|  PREDICTED: glutamate--cysteine ligase, chlor...    249   9e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010695135.1|  PREDICTED: glutamate--cysteine ligase, chlor...    248   9e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW77522.1|  hypothetical protein EUGRSUZ_D01848                     245   1e-74   Eucalyptus grandis [rose gum]
gb|KGN50100.1|  hypothetical protein Csa_5G153150                       248   1e-74   Cucumis sativus [cucumbers]
gb|ABK23872.1|  unknown                                                 239   1e-74   Picea sitchensis
ref|XP_006851855.2|  PREDICTED: glutamate--cysteine ligase, chlor...    248   1e-74   Amborella trichopoda
ref|XP_011654747.1|  PREDICTED: glutamate--cysteine ligase, chlor...    248   2e-74   Cucumis sativus [cucumbers]
ref|NP_001292626.1|  glutamate--cysteine ligase, chloroplastic          248   2e-74   Cucumis sativus [cucumbers]
ref|XP_009364899.1|  PREDICTED: glutamate--cysteine ligase, chlor...    248   2e-74   Pyrus x bretschneideri [bai li]
emb|CAC27145.1|  glutamate-cysteine ligase                              238   3e-74   Picea abies
ref|XP_010920822.1|  PREDICTED: glutamate--cysteine ligase, chlor...    247   5e-74   Elaeis guineensis
ref|XP_009137315.1|  PREDICTED: glutamate--cysteine ligase, chlor...    246   5e-74   Brassica rapa
emb|CAD91714.1|  glutamate-cysteine ligase                              246   6e-74   Brassica juncea [brown mustard]
ref|XP_010053262.1|  PREDICTED: glutamate--cysteine ligase, chlor...    246   8e-74   Eucalyptus grandis [rose gum]
gb|ADX30738.2|  truncated gamma-glutamyl-cysteine synthetase            243   9e-74   Populus x canadensis [Canadian poplar]
emb|CDY10914.1|  BnaA03g45730D                                          246   9e-74   Brassica napus [oilseed rape]
ref|XP_010937863.1|  PREDICTED: glutamate--cysteine ligase A, chl...    246   1e-73   Elaeis guineensis
ref|XP_009364919.1|  PREDICTED: glutamate--cysteine ligase, chlor...    246   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_008789126.1|  PREDICTED: glutamate--cysteine ligase A, chl...    246   1e-73   Phoenix dactylifera
gb|AEA77156.1|  chloroplast gamma glutamyl cysteine synthetase          245   2e-73   Vigna radiata [mung bean]
ref|XP_009136711.1|  PREDICTED: glutamate--cysteine ligase, chlor...    245   2e-73   Brassica rapa
emb|CAA06613.1|  gamma-glutamylcysteine synthetase                      243   2e-73   Brassica juncea [brown mustard]
ref|XP_007160058.1|  hypothetical protein PHAVU_002G289200g             245   2e-73   Phaseolus vulgaris [French bean]
gb|AAF22136.1|AF128454_1  gamma-glutamylcysteine synthetase precu...    245   2e-73   Phaseolus vulgaris [French bean]
ref|XP_004503722.1|  PREDICTED: glutamate--cysteine ligase, chlor...    245   2e-73   Cicer arietinum [garbanzo]
emb|CAK24967.1|  gamma-glutamylcysteine synthetase                      245   3e-73   Brassica napus [oilseed rape]
ref|XP_007210716.1|  hypothetical protein PRUPE_ppa022884mg             231   6e-73   
emb|CAR82640.1|  putative glutamyl cysteine ligase                      243   9e-73   Brassica napus [oilseed rape]
ref|XP_008792987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    243   2e-72   Phoenix dactylifera
emb|CDY41369.1|  BnaC03g65140D                                          241   2e-72   Brassica napus [oilseed rape]
emb|CDY41249.1|  BnaA01g12900D                                          242   4e-72   Brassica napus [oilseed rape]
pdb|2GWC|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    240   4e-72   Brassica juncea [brown mustard]
gb|AAO45821.1|  gamma-glutamylcysteine synthetase                       241   5e-72   Lotus japonicus
ref|XP_008341054.1|  PREDICTED: glutamate--cysteine ligase, chlor...    242   6e-72   Malus domestica [apple tree]
ref|XP_008792975.1|  PREDICTED: glutamate--cysteine ligase, chlor...    242   1e-71   
ref|XP_008792981.1|  PREDICTED: glutamate--cysteine ligase, chlor...    242   1e-71   
ref|XP_010089108.1|  Glutamate--cysteine ligase                         242   1e-71   
ref|XP_008341053.1|  PREDICTED: glutamate--cysteine ligase, chlor...    241   2e-71   Malus domestica [apple tree]
ref|XP_009364953.1|  PREDICTED: glutamate--cysteine ligase, chlor...    239   5e-71   Pyrus x bretschneideri [bai li]
gb|ACX70134.1|  gamma-glutamylcysteine synthetase                       238   1e-70   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006586325.1|  PREDICTED: glutamate--cysteine ligase, chlor...    237   2e-70   
gb|AAW58147.1|  gamma-glutamylcysteine synthetase                       230   3e-69   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ84988.1|  predicted protein                                      229   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001168108.1|  uncharacterized protein LOC100381846               222   2e-68   
ref|XP_003569058.1|  PREDICTED: glutamate--cysteine ligase B, chl...    230   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_009380693.1|  PREDICTED: glutamate--cysteine ligase A, chl...    230   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380691.1|  PREDICTED: glutamate--cysteine ligase A, chl...    230   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001757520.1|  predicted protein                                  226   1e-66   
gb|ACK38262.1|  gamma-glutamylcysteine synthetase                       223   2e-66   Phragmites australis
ref|XP_002965328.1|  hypothetical protein SELMODRAFT_83292              225   2e-66   
ref|XP_002977172.1|  hypothetical protein SELMODRAFT_232900             223   8e-66   
ref|NP_001059579.2|  Os07g0462000                                       213   2e-65   
dbj|BAJ21770.1|  putative gamma-glutamylcysteine synthetase             224   2e-65   Pteris vittata
ref|XP_001785532.1|  predicted protein                                  223   4e-65   
ref|XP_009362009.1|  PREDICTED: glutamate--cysteine ligase, chlor...    216   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_008655177.1|  PREDICTED: uncharacterized protein LOC100381...    223   5e-65   
ref|XP_002867731.1|  hypothetical protein ARALYDRAFT_914292             214   5e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_008648285.1|  PREDICTED: gamma-glutamylcysteine synthetase...    223   6e-65   Zea mays [maize]
ref|XP_004960382.1|  PREDICTED: glutamate--cysteine ligase B, chl...    223   6e-65   Setaria italica
ref|XP_009137312.1|  PREDICTED: glutamate--cysteine ligase, chlor...    215   9e-65   Brassica rapa
ref|XP_010435330.1|  PREDICTED: glutamate--cysteine ligase, chlor...    216   1e-64   Camelina sativa [gold-of-pleasure]
gb|KFK30813.1|  hypothetical protein AALP_AA6G029500                    221   1e-64   Arabis alpina [alpine rockcress]
emb|CDX94156.1|  BnaC07g37900D                                          214   1e-64   
ref|XP_006654002.1|  PREDICTED: glutamate--cysteine ligase B, chl...    220   2e-64   
ref|XP_002439220.1|  hypothetical protein SORBIDRAFT_09g002470          221   2e-64   Sorghum bicolor [broomcorn]
ref|NP_001105142.1|  gamma-glutamylcysteine synthetase1                 219   2e-64   Zea mays [maize]
ref|XP_002875199.1|  predicted protein                                  218   3e-64   Arabidopsis lyrata subsp. lyrata
emb|CAD48598.1|  gamma-glutamylcysteine synthetase                      219   3e-64   Oryza sativa Japonica Group [Japonica rice]
emb|CDY63259.1|  BnaA03g58670D                                          212   5e-64   Brassica napus [oilseed rape]
sp|Q6Z3A3.1|GSH1B_ORYSJ  RecName: Full=Glutamate--cysteine ligase...    219   8e-64   Oryza sativa Japonica Group [Japonica rice]
emb|CAD48599.3|  gamma-glutamylcysteine synthetase                      219   8e-64   Oryza sativa Japonica Group [Japonica rice]
sp|Q8GU95.2|GSH1A_ORYSI  RecName: Full=Glutamate--cysteine ligase...    219   9e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_010440632.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   1e-63   
gb|EEE62203.1|  hypothetical protein OsJ_16990                          228   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60294.1|  Glutamate--cysteine ligase B, chloroplastic             217   2e-63   Triticum urartu
gb|ACV71026.1|  gamma-glutamylcysteine synthetase                       210   2e-63   Agropyron cristatum [crested wheatgrass]
gb|EEE67118.1|  hypothetical protein OsJ_24143                          220   3e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054541.1|  Os05g0129000                                       218   3e-63   
sp|A2YL07.2|GSH1B_ORYSI  RecName: Full=Glutamate--cysteine ligase...    218   4e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_003611086.1|  Glutamate-cysteine ligase                          194   2e-62   
ref|XP_003516702.1|  PREDICTED: glutamate--cysteine ligase, chlor...    187   3e-62   Glycine max [soybeans]
ref|XP_008375303.1|  PREDICTED: glutamate--cysteine ligase, chlor...    214   6e-62   
gb|EEC81979.1|  hypothetical protein OsI_25896                          218   7e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_010448777.1|  PREDICTED: glutamate--cysteine ligase, chlor...    206   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010439229.1|  PREDICTED: glutamate--cysteine ligase, chlor...    212   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010448773.1|  PREDICTED: glutamate--cysteine ligase, chlor...    208   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_004511574.1|  PREDICTED: glutamate--cysteine ligase, chlor...    190   3e-61   Cicer arietinum [garbanzo]
ref|XP_007158499.1|  hypothetical protein PHAVU_002G157600g             183   2e-60   Phaseolus vulgaris [French bean]
ref|XP_010439234.1|  PREDICTED: glutamate--cysteine ligase, chlor...    204   2e-60   
ref|XP_010439231.1|  PREDICTED: glutamate--cysteine ligase, chlor...    202   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010433942.1|  PREDICTED: glutamate--cysteine ligase, chlor...    206   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_004971557.1|  PREDICTED: glutamate--cysteine ligase B, chl...    188   1e-59   
ref|XP_006283598.1|  hypothetical protein CARUB_v10004654mg             206   7e-59   Capsella rubella
ref|XP_010439235.1|  PREDICTED: glutamate--cysteine ligase, chlor...    205   9e-59   
ref|XP_010448775.1|  PREDICTED: glutamate--cysteine ligase, chlor...    205   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003611085.1|  Glutamate-cysteine ligase                          184   3e-58   
gb|KFK30815.1|  hypothetical protein AALP_AA6G029800                    198   4e-57   Arabis alpina [alpine rockcress]
ref|XP_010540840.1|  PREDICTED: glutamate--cysteine ligase, chlor...    199   4e-56   Tarenaya hassleriana [spider flower]
emb|CAA82626.1|  gamma-glutamylcysteine synthetase                      197   3e-55   Arabidopsis thaliana [mouse-ear cress]
gb|ADR66071.1|  gamma-glutamylcysteine synthetase                       184   9e-55   Aster amellus [Italian starwort]
ref|XP_002974231.1|  hypothetical protein SELMODRAFT_101407             194   1e-54   
ref|XP_002985600.1|  hypothetical protein SELMODRAFT_122883             193   4e-54   
gb|ADR66074.1|  gamma-glutamylcysteine synthetase                       180   3e-53   Zinnia elegans [garden zinnia]
gb|AES94043.2|  gamma glutamyl cysteine synthetase                      180   1e-52   Medicago truncatula
ref|WP_039718559.1|  glutamate--cysteine ligase                         162   4e-52   
gb|ADR66069.1|  gamma-glutamylcysteine synthetase                       176   8e-52   Cichorium intybus [radicchio]
ref|WP_011995572.1|  glutamate--cysteine ligase                         163   8e-52   Parvibaculum lavamentivorans
gb|ADR66068.1|  gamma-glutamylcysteine synthetase                       174   5e-51   Cichorium intybus [radicchio]
ref|WP_009803181.1|  glutamate--cysteine ligase                         165   3e-50   Oceanicaulis sp. HTCC2633
ref|XP_004971558.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    153   3e-50   
ref|WP_011628951.1|  glutamate--cysteine ligase                         158   4e-50   Alkalilimnicola ehrlichii
ref|XP_002507857.1|  predicted protein                                  160   1e-49   Micromonas commoda
dbj|GAN45514.1|  glutamate--cysteine ligase                             164   2e-49   
ref|WP_019959805.1|  glutamate--cysteine ligase                         160   3e-49   Woodsholea maritima
ref|WP_017463721.1|  glutamate--cysteine ligase                         167   4e-49   Dyella ginsengisoli
ref|WP_014416028.1|  glutamate--cysteine ligase                         158   4e-49   Pararhodospirillum photometricum
ref|WP_036515476.1|  glutamate--cysteine ligase                         159   5e-49   Oceanicaulis sp. HL-87
ref|XP_003062187.1|  predicted protein                                  164   7e-49   Micromonas pusilla CCMP1545
ref|WP_022701642.1|  glutamate--cysteine ligase                         160   8e-49   Oceanicaulis alexandrii
ref|WP_028098740.1|  glutamate--cysteine ligase                         157   1e-48   Dongia sp. URHE0060
gb|KIQ97509.1|  Glutamate--cysteine ligase                              161   2e-48   Lysobacter sp. A03
ref|WP_037519317.1|  glutamate--cysteine ligase                         158   2e-48   Sphingobium yanoikuyae
ref|WP_010337529.1|  glutamate--cysteine ligase                         158   2e-48   Sphingomonadaceae
ref|WP_043958070.1|  glutamate--cysteine ligase                         161   2e-48   Lysobacter sp. A03
ref|WP_029003893.1|  glutamate--cysteine ligase                         160   2e-48   Azorhizobium doebereinerae
ref|WP_022698585.1|  glutamate--cysteine ligase                         162   3e-48   Euryhalocaulis caribicus
ref|WP_004209288.1|  glutamate-cysteine ligase                          158   3e-48   Sphingobium
ref|WP_007705830.1|  glutamate--cysteine ligase                         157   3e-48   Sphingobium sp. AP49
ref|WP_037513223.1|  glutamate--cysteine ligase                         157   3e-48   Sphingobium yanoikuyae
ref|WP_017502900.1|  glutamate--cysteine ligase                         157   5e-48   Sphingobium yanoikuyae
ref|WP_021244404.1|  glutamate--cysteine ligase                         153   5e-48   Sphingobium baderi
ref|WP_012171491.1|  glutamate--cysteine ligase                         159   6e-48   Azorhizobium caulinodans
ref|WP_014129677.1|  glutamate--cysteine ligase                         156   6e-48   Pelagibacterium
gb|ADR66075.1|  gamma-glutamylcysteine synthetase                       166   6e-48   Helianthus annuus
ref|WP_036195140.1|  glutamate--cysteine ligase                         155   7e-48   Lysobacter concretionis
ref|WP_012568753.1|  glutamate--cysteine ligase                         159   1e-47   Rhodospirillum centenum
gb|ADR66079.1|  gamma-glutamylcysteine synthetase                       165   1e-47   Hieracium umbellatum
ref|WP_012116172.1|  glutamate--cysteine ligase                         158   2e-47   Xanthobacter autotrophicus
ref|WP_037338607.1|  glutamate--cysteine ligase                         175   2e-47   Salinisphaera hydrothermalis
ref|WP_011388328.1|  glutamate--cysteine ligase                         154   3e-47   Rhodospirillum rubrum
gb|ADR66082.1|  gamma-glutamylcysteine synthetase                       164   4e-47   Hieracium scabrum
ref|WP_039288065.1|  glutamate--cysteine ligase                         152   6e-47   Novosphingobium malaysiense
ref|WP_040849077.1|  glutamate--cysteine ligase                         159   6e-47   Nitrospirillum amazonense
gb|ADR66077.1|  gamma-glutamylcysteine synthetase                       163   7e-47   Hieracium porrifolium
ref|WP_028967581.1|  glutamate--cysteine ligase                         155   7e-47   Sphingomonas phyllosphaerae
ref|WP_042597021.1|  glutamate--cysteine ligase                         173   9e-47   Xanthomonas campestris
ref|XP_001778732.1|  predicted protein                                  159   1e-46   
ref|WP_034157617.1|  glutamate--cysteine ligase                         153   1e-46   Sphingomonas sp. ERG5
ref|WP_011038494.1|  glutamate--cysteine ligase                         173   1e-46   Xanthomonas campestris
ref|WP_010217933.1|  glutamate--cysteine ligase                         153   1e-46   Sphingomonas sp. PAMC 26621
gb|AEL08593.1|  glutamate--cysteine ligase                              173   1e-46   Xanthomonas campestris pv. raphani 756C
emb|CEN59071.1|  Glutamate-cysteine ligase, chloroplastic               173   1e-46   Xanthomonas campestris pv. campestris
ref|WP_036212296.1|  glutamate--cysteine ligase                         156   1e-46   Lysobacter arseniciresistens
gb|KGM54711.1|  glutamate--cysteine ligase                              155   2e-46   Lysobacter arseniciresistens ZS79
ref|WP_010160442.1|  glutamate--cysteine ligase                         154   2e-46   Sphingomonas sp. PAMC 26617
ref|WP_006913439.1|  glutamate--cysteine ligase                         172   2e-46   Salinisphaera shabanensis
gb|ADR66076.1|  gamma-glutamylcysteine synthetase                       162   2e-46   Galinsoga parviflora
ref|WP_045665217.1|  glutamate--cysteine ligase                         150   2e-46   
ref|WP_007013078.1|  glutamate--cysteine ligase                         151   2e-46   Novosphingobium pentaromativorans
ref|WP_005419277.1|  glutamate--cysteine ligase                         172   2e-46   Stenotrophomonas
ref|WP_037474880.1|  glutamate--cysteine ligase                         150   2e-46   Sphingobium sp. ba1
ref|WP_013831914.1|  glutamate--cysteine ligase                         151   2e-46   Novosphingobium sp. PP1Y
ref|WP_010480897.1|  glutamate--cysteine ligase [                       172   3e-46   Stenotrophomonas maltophilia
ref|WP_029558402.1|  glutamate--cysteine ligase                         155   3e-46   Xanthobacter sp. 91
ref|WP_022684910.1|  glutamate--cysteine ligase                         153   3e-46   Sphingomonas phyllosphaerae
ref|WP_010414293.1|  glutamate--cysteine ligase                         154   3e-46   Citromicrobium sp. JLT1363
emb|CAP50142.1|  glutamate-cysteine ligase                              173   4e-46   Xanthomonas campestris pv. campestris
gb|ADR66084.1|  gamma-glutamylcysteine synthetase                       161   4e-46   Hieracium intybaceum
ref|WP_011413551.1|  glutamate--cysteine ligase                         158   4e-46   Erythrobacter litoralis
ref|WP_043153593.1|  glutamate--cysteine ligase                         149   4e-46   Sphingobium sp. Ant17
ref|WP_032972191.1|  glutamate--cysteine ligase                         172   4e-46   Stenotrophomonas maltophilia
ref|WP_010187657.1|  glutamate--cysteine ligase                         151   4e-46   Sphingomonas sp. PAMC 26605
ref|WP_006955629.1|  Glutamate--cysteine ligase                         150   5e-46   Sphingobium japonicum
ref|WP_008995338.1|  glutamate--cysteine ligase                         151   5e-46   Novosphingobium sp. Rr 2-17
ref|WP_012512090.1|  glutamate--cysteine ligase                         171   5e-46   Stenotrophomonas maltophilia
ref|WP_014038468.1|  glutamate--cysteine ligase                         171   5e-46   Stenotrophomonas
ref|WP_014648396.1|  glutamate--cysteine ligase                         171   5e-46   Stenotrophomonas maltophilia
ref|WP_019336459.1|  glutamate--cysteine ligase                         171   5e-46   Stenotrophomonas maltophilia
emb|CCP17893.1|  glutamate--cysteine ligase                             172   5e-46   Stenotrophomonas maltophilia RA8
gb|ADR66080.1|  gamma-glutamylcysteine synthetase                       161   6e-46   Hieracium umbellatum
dbj|GAN00159.1|  glutamate--cysteine ligase                             149   6e-46   alpha proteobacterium U9-1i
ref|XP_001701647.1|  gamma-glutamylcysteine synthetase                  171   8e-46   Chlamydomonas reinhardtii
ref|WP_021203943.1|  glutamate--cysteine ligase                         171   8e-46   Stenotrophomonas maltophilia
ref|WP_019662096.1|  glutamate--cysteine ligase                         171   1e-45   Stenotrophomonas maltophilia
ref|WP_032129893.1|  glutamate--cysteine ligase                         171   1e-45   Stenotrophomonas
gb|ADR66088.1|  gamma-glutamylcysteine synthetase                       160   1e-45   Pilosella onegensis
ref|WP_035310533.1|  glutamate--cysteine ligase                         139   1e-45   Brevundimonas sp. EAKA
ref|WP_025294444.1|  glutamate--cysteine ligase                         148   2e-45   Sphingomonas sanxanigenens
ref|WP_005411018.1|  glutamate--cysteine ligase                         170   2e-45   Stenotrophomonas maltophilia
ref|WP_017182936.1|  glutamate--cysteine ligase                         149   2e-45   Sphingobium
ref|WP_024279173.1|  glutamate--cysteine ligase                         152   2e-45   Xanthobacter sp. 126
ref|WP_024956060.1|  glutamate--cysteine ligase                         170   2e-45   Stenotrophomonas
ref|WP_008265020.1|  glutamate--cysteine ligase                         170   2e-45   Stenotrophomonas sp. SKA14
ref|WP_019053443.1|  glutamate--cysteine ligase                         149   2e-45   Sphingobium xenophagum
ref|WP_010404296.1|  glutamate--cysteine ligase                         148   2e-45   Sphingomonas echinoides
ref|WP_027164308.1|  glutamate--cysteine ligase                         170   2e-45   Mesorhizobium sp. WSM3224
gb|ADR66087.1|  gamma-glutamylcysteine synthetase                       159   2e-45   Pilosella lactucella
ref|WP_029349626.1|  glutamate--cysteine ligase                         149   3e-45   Bosea sp. 117
ref|WP_017505763.1|  glutamate--cysteine ligase                         140   3e-45   alpha proteobacterium L41A
gb|KDA02929.1|  glutamate--cysteine ligase                              143   3e-45   Hyphomonas oceanitis SCH89
ref|WP_033965593.1|  glutamate--cysteine ligase                         149   3e-45   Sphingomonas sp. Ant H11
ref|WP_043400077.1|  glutamate--cysteine ligase                         169   4e-45   Stenotrophomonas maltophilia
gb|AFC88288.1|  gamma-glutamylcysteine synthetase                       169   4e-45   Chlamydomonas sp. ICE-L
ref|WP_043971591.1|  glutamate--cysteine ligase                         148   4e-45   Novosphingobium sp. P6W
ref|WP_024848624.1|  glutamate--cysteine ligase                         162   4e-45   Aminobacter sp. J41
ref|WP_035537514.1|  glutamate--cysteine ligase                         142   4e-45   Hyphomonas oceanitis
ref|WP_037532766.1|  glutamate--cysteine ligase                         147   4e-45   Sphingomonas sp. Ant20
ref|WP_040973710.1|  glutamate--cysteine ligase                         169   4e-45   Mesorhizobium sp. ORS 3324
ref|WP_009540610.1|  Glutamate--cysteine ligase                         149   4e-45   Caenispirillum salinarum
ref|WP_046021998.1|  glutamate--cysteine ligase                         147   5e-45   Magnetospira sp. QH-2
ref|WP_029582439.1|  glutamate--cysteine ligase                         146   5e-45   Bradyrhizobium sp. URHD0069
ref|WP_045809784.1|  glutamate--cysteine ligase                         139   5e-45   
ref|WP_013419374.1|  glutamate--cysteine ligase                         143   5e-45   
ref|WP_029011247.1|  glutamate--cysteine ligase                         169   5e-45   
ref|WP_017670488.1|  glutamate--cysteine ligase                         146   6e-45   
ref|WP_031439554.1|  glutamate--cysteine ligase                         148   6e-45   
ref|WP_042640977.1|  glutamate--cysteine ligase                         168   7e-45   
gb|ADR66085.1|  gamma-glutamylcysteine synthetase                       158   7e-45   
ref|WP_010238314.1|  glutamate--cysteine ligase                         151   7e-45   
ref|WP_034900690.1|  glutamate--cysteine ligase                         149   8e-45   
ref|WP_034744831.1|  glutamate--cysteine ligase                         141   8e-45   
ref|XP_008375304.1|  PREDICTED: glutamate--cysteine ligase, chlor...    168   8e-45   
ref|WP_042614137.1|  glutamate--cysteine ligase                         168   9e-45   
ref|WP_008263221.1|  glutamate--cysteine ligase                         138   9e-45   
ref|WP_039244794.1|  glutamate--cysteine ligase                         139   9e-45   
ref|WP_040963341.1|  glutamate--cysteine ligase                         149   9e-45   
ref|WP_034952828.1|  glutamate--cysteine ligase                         147   9e-45   
ref|WP_028840266.1|  glutamate--cysteine ligase                         150   9e-45   
ref|XP_006439556.1|  hypothetical protein CICLE_v10019696mg             169   1e-44   
ref|WP_037242001.1|  glutamate--cysteine ligase                         142   1e-44   
gb|KAI93336.1|  glutamate--cysteine ligase                              142   1e-44   
ref|WP_040990658.1|  glutamate--cysteine ligase                         168   1e-44   
ref|WP_039332706.1|  glutamate--cysteine ligase                         145   1e-44   
ref|WP_041003537.1|  glutamate--cysteine ligase                         168   1e-44   
ref|WP_027840761.1|  glutamate--cysteine ligase                         168   1e-44   
ref|WP_041004352.1|  glutamate--cysteine ligase                         168   1e-44   
ref|WP_022671788.1|  glutamate--cysteine ligase                         148   1e-44   
ref|WP_039390333.1|  glutamate--cysteine ligase                         149   1e-44   
ref|WP_008389016.1|  glutamate--cysteine ligase                         147   1e-44   
ref|WP_043099349.1|  glutamate--cysteine ligase                         147   1e-44   
ref|WP_041010010.1|  glutamate--cysteine ligase                         167   1e-44   
ref|WP_024018374.1|  glutamate--cysteine ligase                         145   1e-44   
ref|WP_025874082.1|  MULTISPECIES: glutamate--cysteine ligase           167   2e-44   
ref|WP_007687357.1|  MULTISPECIES: glutamate--cysteine ligase           145   2e-44   
ref|WP_012973384.1|  glutamate--cysteine ligase                         167   2e-44   
ref|WP_020591012.1|  hypothetical protein                               167   2e-44   
ref|WP_007163579.1|  glutamate--cysteine ligase                         146   2e-44   
ref|WP_008593913.1|  glutamate--cysteine ligase                         158   2e-44   
ref|WP_015316493.1|  glutamate--cysteine ligase                         167   2e-44   
ref|XP_002949586.1|  hypothetical protein VOLCADRAFT_104352             166   2e-44   
ref|WP_036525919.1|  glutamate--cysteine ligase                         146   2e-44   
ref|WP_020820318.1|  MULTISPECIES: glutamate--cysteine ligase           144   2e-44   
ref|WP_027135070.1|  glutamate--cysteine ligase                         145   2e-44   
ref|WP_012041133.1|  glutamate--cysteine ligase                         145   2e-44   
ref|WP_033924126.1|  glutamate--cysteine ligase                         144   2e-44   
ref|WP_021227628.1|  glutamate--cysteine ligase                         145   2e-44   
ref|WP_038229828.1|  glutamate--cysteine ligase                         149   2e-44   
ref|WP_004089170.1|  glutamate--cysteine ligase                         149   2e-44   
ref|WP_006834684.1|  glutamate-cysteine ligase precursor                147   3e-44   
ref|WP_008968192.1|  glutamate--cysteine ligase                         144   3e-44   
ref|WP_042489498.1|  glutamate--cysteine ligase                         145   3e-44   
ref|XP_005646648.1|  plant glutamate cysteine ligase in complex w...    152   3e-44   
ref|WP_024515885.1|  glutamate--cysteine ligase                         141   3e-44   
ref|WP_021688541.1|  putative glutamate--cysteine ligase                142   3e-44   
ref|WP_014247076.1|  glutamate--cysteine ligase                         167   3e-44   
ref|WP_017666103.1|  glutamate--cysteine ligase                         145   3e-44   
ref|WP_038659465.1|  glutamate--cysteine ligase                         147   4e-44   
ref|WP_028467521.1|  glutamate--cysteine ligase                         166   4e-44   
ref|WP_034959236.1|  glutamate--cysteine ligase                         145   5e-44   
ref|WP_008828922.1|  glutamate--cysteine ligase                         145   5e-44   
ref|WP_027840020.1|  glutamate--cysteine ligase                         143   6e-44   
ref|WP_009820454.1|  glutamate--cysteine ligase                         143   6e-44   
ref|WP_027581420.1|  glutamate--cysteine ligase                         142   7e-44   
ref|WP_036799971.1|  glutamate--cysteine ligase                         145   7e-44   
ref|WP_015663884.1|  gamma-glutamylcysteine synthetase                  142   7e-44   
ref|WP_018644967.1|  glutamate--cysteine ligase                         149   7e-44   
ref|WP_007685474.1|  glutamate--cysteine ligase                         145   8e-44   
ref|WP_037536576.1|  glutamate--cysteine ligase                         145   8e-44   
ref|WP_023432400.1|  Glutamate--cysteine ligase                         166   8e-44   
ref|WP_028179833.1|  MULTISPECIES: glutamate--cysteine ligase           149   8e-44   
ref|WP_028639856.1|  glutamate--cysteine ligase                         145   8e-44   
ref|WP_025030022.1|  glutamate--cysteine ligase                         158   9e-44   
ref|NP_001031701.1|  glutamate-cysteine ligase                          166   9e-44   
ref|WP_022727621.1|  glutamate--cysteine ligase                         165   9e-44   
ref|WP_007009691.1|  glutamate--cysteine ligase                         157   9e-44   
ref|WP_006613045.1|  glutamate--cysteine ligase                         141   1e-43   
ref|WP_019195232.1|  glutamate--cysteine ligase                         145   1e-43   
ref|WP_027542380.1|  glutamate--cysteine ligase                         148   1e-43   
ref|WP_010893929.1|  glutamate--cysteine ligase                         146   1e-43   
ref|WP_020850908.1|  Glutamate--cysteine ligase, plant                  146   1e-43   
ref|WP_012337765.1|  glutamate--cysteine ligase                         146   2e-43   
ref|WP_008960217.1|  glutamate--cysteine ligase                         143   2e-43   
ref|WP_011444608.1|  glutamate--cysteine ligase                         146   2e-43   
ref|WP_027442700.1|  glutamate--cysteine ligase                         147   2e-43   
gb|ADR66070.1|  gamma-glutamylcysteine synthetase                       154   2e-43   
ref|WP_028795898.1|  glutamate--cysteine ligase                         152   2e-43   
ref|WP_042841007.1|  glutamate--cysteine ligase                         159   2e-43   
ref|XP_005844806.1|  hypothetical protein CHLNCDRAFT_26566              165   2e-43   
gb|KCZ97952.1|  glutamate--cysteine ligase                              142   2e-43   
ref|WP_035599559.1|  glutamate--cysteine ligase                         142   2e-43   
ref|WP_013480080.1|  glutamate--cysteine ligase                         136   2e-43   
ref|WP_016847102.1|  glutamate--cysteine ligase                         140   2e-43   
ref|WP_028167945.1|  glutamate--cysteine ligase                         141   2e-43   
ref|WP_038210987.1|  glutamate--cysteine ligase                         145   3e-43   
ref|WP_007081607.1|  glutamate--cysteine ligase                         164   3e-43   
ref|WP_018426605.1|  glutamate--cysteine ligase                         164   3e-43   
ref|WP_035612545.1|  glutamate--cysteine ligase                         139   3e-43   
ref|WP_045581954.1|  glutamate--cysteine ligase                         164   3e-43   
ref|WP_028338997.1|  glutamate--cysteine ligase                         139   3e-43   
ref|WP_004083760.1|  glutamate--cysteine ligase                         145   3e-43   
ref|WP_029077808.1|  glutamate--cysteine ligase                         140   3e-43   
ref|WP_012284466.1|  glutamate--cysteine ligase                         143   3e-43   
ref|WP_029086242.1|  glutamate--cysteine ligase                         133   3e-43   
ref|WP_037014257.1|  glutamate--cysteine ligase                         148   3e-43   
ref|WP_009027020.1|  glutamate--cysteine ligase                         142   3e-43   
ref|WP_037059638.1|  glutamate--cysteine ligase                         157   3e-43   
ref|WP_023907787.1|  glutamate--cysteine ligase                         145   4e-43   
ref|WP_029418256.1|  glutamate--cysteine ligase                         140   4e-43   
gb|EFF42187.1|  glutamate-cysteine ligase precursor                     159   4e-43   
ref|WP_008215925.1|  glutamate--cysteine ligase                         164   4e-43   
ref|WP_008838626.1|  glutamate--cysteine ligase                         164   4e-43   
ref|WP_024510111.1|  glutamate--cysteine ligase                         139   4e-43   
ref|WP_024577221.1|  MULTISPECIES: glutamate--cysteine ligase           144   4e-43   
ref|WP_013847990.1|  glutamate--cysteine ligase                         140   4e-43   
ref|WP_035700676.1|  glutamate--cysteine ligase                         147   5e-43   
ref|WP_042696029.1|  glutamate--cysteine ligase                         163   5e-43   
gb|ABI75913.1|  glutamate--cysteine ligase                              139   5e-43   
ref|WP_023906733.1|  glutamate--cysteine ligase                         144   5e-43   
ref|WP_027537383.1|  glutamate--cysteine ligase                         143   5e-43   
ref|WP_028334620.1|  glutamate--cysteine ligase                         139   5e-43   
ref|WP_021076896.1|  glutamate-cysteine ligase                          141   6e-43   
ref|WP_024581805.1|  MULTISPECIES: glutamate--cysteine ligase           139   6e-43   
ref|WP_039514204.1|  glutamate--cysteine ligase                         163   6e-43   
ref|WP_035590604.1|  MULTISPECIES: glutamate--cysteine ligase           139   6e-43   
ref|WP_039530743.1|  glutamate--cysteine ligase                         163   7e-43   
gb|KER80321.1|  glutamate--cysteine ligase                              163   7e-43   
ref|WP_029221192.1|  glutamate--cysteine ligase                         163   7e-43   
gb|AEQ94987.1|  glutamate--cysteine ligase                              163   7e-43   
ref|WP_021233943.1|  glutamate--cysteine ligase                         144   8e-43   
ref|WP_013268243.1|  glutamate--cysteine ligase                         134   8e-43   
ref|WP_033074105.1|  glutamate--cysteine ligase                         141   8e-43   
ref|WP_027549698.1|  glutamate--cysteine ligase                         147   9e-43   
ref|WP_041183612.1|  glutamate--cysteine ligase                         162   9e-43   
ref|WP_008944552.1|  glutamate--cysteine ligase                         162   9e-43   
gb|ADR66072.1|  gamma-glutamylcysteine synthetase                       152   9e-43   
ref|WP_014241129.1|  glutamate--cysteine ligase                         162   1e-42   
ref|WP_038272234.1|  glutamate--cysteine ligase                         142   1e-42   
ref|WP_005000090.1|  glutamate--cysteine ligase                         162   1e-42   
ref|WP_035675217.1|  glutamate--cysteine ligase                         162   1e-42   
ref|WP_035975148.1|  glutamate--cysteine ligase                         145   1e-42   
gb|AAW77131.1|  glutamate-cysteine ligase precursor                     162   1e-42   
ref|WP_027278591.1|  glutamate--cysteine ligase                         142   1e-42   
ref|WP_037457639.1|  glutamate--cysteine ligase                         162   1e-42   
ref|WP_028173709.1|  MULTISPECIES: glutamate--cysteine ligase           146   1e-42   
ref|WP_027298647.1|  glutamate--cysteine ligase                         140   1e-42   
ref|WP_039523512.1|  glutamate--cysteine ligase                         162   1e-42   
ref|WP_041182495.1|  glutamate--cysteine ligase                         162   1e-42   
gb|EHR04633.1|  glutamate--cysteine ligase, plant type                  145   1e-42   
ref|WP_024939451.1|  glutamate--cysteine ligase                         162   1e-42   
ref|WP_011083983.1|  MULTISPECIES: glutamate--cysteine ligase           145   1e-42   
ref|WP_025549406.1|  glutamate--cysteine ligase                         139   1e-42   
ref|WP_037448627.1|  glutamate--cysteine ligase                         138   1e-42   
ref|WP_045696674.1|  glutamate--cysteine ligase                         138   1e-42   
ref|WP_015826863.1|  glutamate--cysteine ligase                         144   2e-42   
ref|WP_043948471.1|  glutamate--cysteine ligase                         162   2e-42   
ref|WP_029041764.1|  glutamate--cysteine ligase                         141   2e-42   
ref|WP_013500772.1|  glutamate--cysteine ligase                         143   2e-42   
ref|WP_044416297.1|  glutamate--cysteine ligase                         140   2e-42   
ref|WP_044559775.1|  glutamate--cysteine ligase                         162   2e-42   
ref|WP_008070184.1|  glutamate--cysteine ligase                         139   2e-42   
ref|WP_002805033.1|  glutamate--cysteine ligase                         161   2e-42   
gb|AGU12197.1|  Glutamate-cysteine ligase family 2                      161   2e-42   
ref|WP_019517624.1|  glutamate--cysteine ligase                         140   2e-42   
ref|WP_012030186.1|  glutamate--cysteine ligase                         140   2e-42   
gb|ACD57632.1|  glutamate--cysteine ligase                              161   2e-42   
ref|WP_027574300.1|  glutamate--cysteine ligase                         144   2e-42   
ref|WP_033003907.1|  glutamate--cysteine ligase                         161   2e-42   
ref|WP_033013154.1|  glutamate--cysteine ligase                         161   3e-42   
ref|WP_006329395.1|  Glutamate--cysteine ligase B, chloroplastic        161   3e-42   
ref|WP_033005706.1|  glutamate--cysteine ligase                         161   3e-42   
ref|WP_016552865.1|  glutamate-cysteine ligase                          154   3e-42   
ref|WP_027521448.1|  glutamate--cysteine ligase                         144   3e-42   
ref|WP_023776646.1|  glutamate--cysteine ligase                         161   3e-42   
ref|WP_024339129.1|  glutamate--cysteine ligase                         143   3e-42   
ref|WP_013165179.1|  glutamate--cysteine ligase                         139   3e-42   
ref|WP_044660447.1|  glutamate--cysteine ligase                         137   4e-42   
ref|WP_006451634.1|  glutamate--cysteine ligase                         161   4e-42   
ref|WP_023903510.1|  glutamate-cysteine ligase                          161   4e-42   
ref|WP_045445239.1|  glutamate--cysteine ligase                         161   4e-42   
ref|WP_006022905.1|  MULTISPECIES: glutamate-cysteine ligase            140   4e-42   
ref|WP_007799281.1|  glutamate--cysteine ligase                         154   4e-42   
ref|WP_019370398.1|  glutamate--cysteine ligase                         138   4e-42   
ref|WP_042828083.1|  glutamate--cysteine ligase                         160   5e-42   
ref|WP_015448887.1|  MULTISPECIES: glutamate--cysteine ligase           160   5e-42   
ref|WP_015459003.1|  glutamate--cysteine ligase                         140   5e-42   
ref|WP_027561951.1|  MULTISPECIES: glutamate--cysteine ligase           143   5e-42   
ref|WP_039419904.1|  glutamate--cysteine ligase                         160   5e-42   
ref|WP_024588372.1|  glutamate--cysteine ligase                         160   5e-42   
ref|WP_008877385.1|  Glutamate--cysteine ligase B, chloroplastic        160   5e-42   
ref|WP_019463764.1|  glutamate--cysteine ligase                         160   5e-42   
ref|WP_037113952.1|  glutamate--cysteine ligase                         153   6e-42   
gb|KFA28827.1|  glutamate--cysteine ligase                              160   6e-42   
gb|KEZ99145.1|  glutamate--cysteine ligase                              160   6e-42   
ref|WP_007808142.1|  glutamate--cysteine ligase                         160   6e-42   
ref|WP_005925232.1|  glutamate--cysteine ligase                         160   6e-42   
ref|WP_016850319.1|  glutamate--cysteine ligase                         160   6e-42   
ref|WP_024317768.1|  MULTISPECIES: glutamate--cysteine ligase           153   6e-42   
emb|CAE26266.1|  gamma-glutamylcysteine synthetase                      139   7e-42   
ref|WP_003482597.1|  MULTISPECIES: glutamate--cysteine ligase           160   7e-42   
ref|WP_033486365.1|  glutamate--cysteine ligase                         160   7e-42   
ref|WP_045829033.1|  glutamate--cysteine ligase                         147   7e-42   
ref|WP_023756833.1|  glutamate--cysteine ligase                         160   7e-42   
ref|WP_042440790.1|  glutamate--cysteine ligase                         139   7e-42   
ref|WP_033473523.1|  glutamate--cysteine ligase                         160   7e-42   
gb|EGD09129.1|  glutamate--cysteine ligase, plant type                  160   7e-42   
ref|WP_043089784.1|  glutamate--cysteine ligase                         160   7e-42   
ref|WP_022722034.1|  glutamate--cysteine ligase                         141   7e-42   
ref|WP_034464274.1|  glutamate--cysteine ligase                         139   7e-42   
ref|WP_033006831.1|  MULTISPECIES: glutamate--cysteine ligase           160   7e-42   
ref|WP_024927210.1|  MULTISPECIES: glutamate--cysteine ligase           160   8e-42   
ref|WP_028749942.1|  glutamate--cysteine ligase                         152   8e-42   
ref|WP_023767841.1|  glutamate--cysteine ligase                         160   8e-42   
ref|WP_028134036.1|  glutamate--cysteine ligase                         143   8e-42   
ref|WP_027035577.1|  glutamate--cysteine ligase                         160   9e-42   
ref|WP_012494507.1|  glutamate--cysteine ligase                         139   9e-42   
ref|WP_002717395.1|  glutamate-cysteine ligase                          137   9e-42   
ref|WP_012048580.1|  MULTISPECIES: glutamate--cysteine ligase           134   9e-42   
ref|WP_026986595.1|  glutamate--cysteine ligase                         160   9e-42   
ref|WP_044427601.1|  glutamate--cysteine ligase                         160   1e-41   
ref|XP_002304493.2|  hypothetical protein POPTR_0003s12700g             160   1e-41   
emb|CEH52138.1|  Glutamate--cysteine ligase, chloroplastic              160   1e-41   
ref|WP_018460014.1|  glutamate--cysteine ligase                         142   1e-41   



>emb|CDP09740.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ISLQSVLDMTADWT  ER+MLRN
Sbjct  472  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQSVLDMTADWTAEERQMLRN  531

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGLNTPFRDGLLKHVAQDV+ LAK GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  532  KVPKSGLNTPFRDGLLKHVAQDVVKLAKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLL  591

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ+VDPVFEELLY
Sbjct  592  ELYHGKWGQSVDPVFEELLY  611


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K+Y++C GMSFRDFMAGKLP IPGEYP+LNDWENHLTTIFP     +   + G   G WR
Sbjct  433  KEYVNCAGMSFRDFMAGKLPSIPGEYPSLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  492

Query  672  TLAAI  658
             L A+
Sbjct  493  RLCAL  497



>ref|XP_010053261.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=556

 Score =   244 bits (624),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  728  YFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLR  549
            YF +VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLR
Sbjct  416  YFIQVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMVADWTPEERQMLR  475

Query  548  NKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKL  369
            NKVPK+GL TPFRDG L+H+A+ V+ LAK GLERRG+KE+GFLN V EVV TGVTPAEKL
Sbjct  476  NKVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERRGFKESGFLNEVKEVVRTGVTPAEKL  535

Query  368  LELYHGKWGQNVDPVFEELLY  306
            LE+Y+GKWGQ+VDPVFEELLY
Sbjct  536  LEMYNGKWGQSVDPVFEELLY  556


 Score = 85.5 bits (210),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP
Sbjct  348  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFP  388



>ref|XP_011080960.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDMTADWT GER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMTADWTQGERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLLKHVAQ+V+  AK GLERRG+KETGFLN V EVVNTGVTPAEKLL
Sbjct  447  KVPKSGLKTPFRDGLLKHVAQEVVKFAKDGLERRGFKETGFLNEVMEVVNTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LYHGKWGQN+DPVFEELLY
Sbjct  507  ALYHGKWGQNIDPVFEELLY  526


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDFMAGKLP +PGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCAGMSFRDFMAGKLPCLPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|AFP93564.1| GCS [Cestrum nocturnum]
Length=518

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ SLQSVLDMTADWT  EREMLRN
Sbjct  379  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEASLQSVLDMTADWTAEEREMLRN  438

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLLKHVAQDV+ LAK GLERRGYKETGFLN V EVV TGVTPAEKLL
Sbjct  439  KVPKSGLKTPFRDGLLKHVAQDVMKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLL  498

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LYHGKWGQ+VDPVFEELLY
Sbjct  499  DLYHGKWGQSVDPVFEELLY  518


 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC G+SFRDF+ GKL PIPGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  340  KKYIDCAGLSFRDFLNGKLAPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  399

Query  672  TLAAI  658
             L A+
Sbjct  400  RLCAL  404



>ref|XP_011072645.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
 ref|XP_011072650.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQSVLDM ADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQSVLDMVADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLLKHVAQ+VL LAK GLERRG+KETGFLN V EVVNTGVTPAEKLL
Sbjct  447  KVPKSGLKTPFRDGLLKHVAQEVLKLAKDGLERRGFKETGFLNEVTEVVNTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ+VDPVFEELLY
Sbjct  507  ELYYGKWGQSVDPVFEELLY  526


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFMAGKLP +PGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMSFRDFMAGKLPCLPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
tomentosiformis]
Length=522

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLDMT+DWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQTVLDMTSDWTAEEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGL TPFRDGLLKHVAQDV+ LAK GLERRGYKETGFLN V EVV TGVTPAEKLL
Sbjct  443  KVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVKTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG++VDPVFEELLY
Sbjct  503  ELYHGKWGRSVDPVFEELLY  522


 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDFM GKLPPIPG+YPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  344  KKYIDCAGMSFRDFMNGKLPPIPGDYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  403

Query  672  TLAAI  658
             L A+
Sbjct  404  RLCAL  408



>ref|XP_009766955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
sylvestris]
 sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Nicotiana tabacum]
 gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum]
Length=522

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLDMT+DWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQTVLDMTSDWTAEEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGL TPFRDGLLKHVAQDV+ LAK GLERRGYKETGFLN V EVV TGVTPAEKLL
Sbjct  443  KVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG++VDPVFEELLY
Sbjct  503  ELYHGKWGRSVDPVFEELLY  522


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDFM GKL PIPG+YPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  344  KKYIDCAGMSFRDFMNGKLSPIPGDYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  403

Query  672  TLAAI  658
             L A+
Sbjct  404  RLCAL  408



>gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus longan]
Length=511

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+ LD+TADWT  ER+MLRN
Sbjct  372  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNALDLTADWTSEERQMLRN  431

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVAQD+L LAK GLERRG+KE+GFLNAVAEVV TGVTPAEKLL
Sbjct  432  KVPKTGLKTPFRDGLLRHVAQDILKLAKDGLERRGFKESGFLNAVAEVVRTGVTPAEKLL  491

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+YHGKWGQ+VDPVFEELLY
Sbjct  492  EMYHGKWGQSVDPVFEELLY  511


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+ GKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  333  KKYIDCTGMSFRDFLVGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  392

Query  672  TLAAI  658
             L A+
Sbjct  393  RLCAL  397



>dbj|BAP47506.1| gamma-glutamylcysteine synthetase [Gentiana triflora]
Length=526

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYDDISLQSVLD+ ADWT  EREMLR 
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDDISLQSVLDLVADWTSAEREMLRK  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV +SGLNTPFRDGLLKHVAQDV+ LAK GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  447  KVAQSGLNTPFRDGLLKHVAQDVVKLAKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG NV+PVFEELLY
Sbjct  507  ELYHGKWGGNVEPVFEELLY  526


 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC+GMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCSGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans]
Length=523

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYDDISLQ+VLDMTADWT  ER+MLRN
Sbjct  384  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGVLYDDISLQNVLDMTADWTQEERQMLRN  443

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA++VL  AK GLERRGYKETGFLN VAEVV TG+TPAEKLL
Sbjct  444  KVPVAGLKTPFRDGLLKHVAEEVLKFAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKLL  503

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ+VDPVFEELLY
Sbjct  504  ELYHGKWGQSVDPVFEELLY  523


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC G+SFRDF+AGKLPPIPGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  345  KKYIDCAGLSFRDFLAGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  404

Query  672  TLAAI  658
             L A+
Sbjct  405  RLCAL  409



>gb|KDO76210.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=396

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ+VLDMTADWT GER+MLRN
Sbjct  257  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRN  316

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVAQDVL L+K GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  317  KVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  376

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ++YHGKW ++VDPVFEELLY
Sbjct  377  DMYHGKWRESVDPVFEELLY  396


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  218  KKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  277

Query  672  TLAAI  658
             L A+
Sbjct  278  RLCAL  282



>gb|KJB37542.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=490

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQS+LDMTADWT  EREMLRN
Sbjct  351  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQSILDMTADWTSEEREMLRN  410

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL H+A+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAEKLL
Sbjct  411  KVPKTGLKTPFRDGLLWHIAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAEKLL  470

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ+VDPVFEELLY
Sbjct  471  ELYNGKWGQSVDPVFEELLY  490


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDFMAGKLP IPGE P LNDWENHLTTIFP     +   + G   G WR
Sbjct  312  KKYIDCTGMTFRDFMAGKLPCIPGELPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  371

Query  672  TLAAI  658
             L A+
Sbjct  372  RLCAL  376



>ref|XP_010529570.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Tarenaya 
hassleriana]
Length=524

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ SLQ+VLD+TADWT  EREMLRN
Sbjct  385  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEESLQAVLDITADWTAEEREMLRN  444

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG LKHVA+DVL LAK GLERRGYKETGFLNAVAEVVNTGVTPAEKLL
Sbjct  445  KVPVTGLKTPFRDGRLKHVAEDVLKLAKDGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  504

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHG+WGQNV+PVF+ELLY
Sbjct  505  ELYHGEWGQNVEPVFQELLY  524


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTG +FRDFM GKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  346  KKYIDCTGSTFRDFMVGKLPRLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  405

Query  672  TLAAI  658
             L A+
Sbjct  406  RLCAL  410



>gb|KJB37540.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37543.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37544.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=526

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQS+LDMTADWT  EREMLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQSILDMTADWTSEEREMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL H+A+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRDGLLWHIAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ+VDPVFEELLY
Sbjct  507  ELYNGKWGQSVDPVFEELLY  526


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDFMAGKLP IPGE P LNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFMAGKLPCIPGELPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
Length=526

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ISLQ+VLDMTADWT  EREMLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQNVLDMTADWTPEEREMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLN V EVV TGVTPAE+LL
Sbjct  447  KVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEIGFLNEVTEVVRTGVTPAERLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ+VDPVFEELLY
Sbjct  507  ELYNGKWGQSVDPVFEELLY  526


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_007040225.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 ref|XP_007040226.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24726.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24727.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
Length=525

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ++LDM ADWT  EREMLRN
Sbjct  386  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNILDMIADWTPEEREMLRN  445

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDG L+HVA+DVL LAK GLERRG+KE+GFLNAVA+VV TGVTPAEKLL
Sbjct  446  KVPKTGLKTPFRDGFLQHVAEDVLTLAKDGLERRGFKESGFLNAVADVVRTGVTPAEKLL  505

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ+VDPVFEELLY
Sbjct  506  ELYHGKWGQSVDPVFEELLY  525


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  347  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  406

Query  672  TLAAI  658
             L A+
Sbjct  407  RLCAL  411



>gb|ABK96626.1| unknown [Populus trichocarpa x Populus deltoides]
Length=526

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQSVLDMTADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVA++VL LAK GLERRG+KE GFLNAVAEV +TG+TPAEKLL
Sbjct  447  KVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFKEVGFLNAVAEVASTGITPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ++DP FEELLY
Sbjct  507  ELYHGKWGQSIDPAFEELLY  526


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            +KYIDCTGMSFRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  EKYIDCTGMSFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|KDO76209.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=502

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ+VLDMTADWT GER+MLRN
Sbjct  363  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRN  422

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVAQDVL L+K GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  423  KVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  482

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ++YHGKW ++VDPVFEELLY
Sbjct  483  DMYHGKWRESVDPVFEELLY  502


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  324  KKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  383

Query  672  TLAAI  658
             L A+
Sbjct  384  RLCAL  388



>ref|XP_006439553.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 ref|XP_006439554.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52793.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52794.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=526

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ+VLDMTADWT GER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVAQDVL L+K GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ++YHGKW ++VDPVFEELLY
Sbjct  507  DMYHGKWRESVDPVFEELLY  526


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|KDO76206.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76207.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76208.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=488

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ+VLDMTADWT GER+MLRN
Sbjct  349  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRN  408

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVAQDVL L+K GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  409  KVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  468

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ++YHGKW ++VDPVFEELLY
Sbjct  469  DMYHGKWRESVDPVFEELLY  488


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  310  KKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  369

Query  672  TLAAI  658
             L A+
Sbjct  370  RLCAL  374



>ref|XP_008437270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
Length=525

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRG+DGGPWRRLCALPAFWVGLLYD++SLQ+VLD+TADWT GER+MLRN
Sbjct  386  FPEVRLKRYLEMRGSDGGPWRRLCALPAFWVGLLYDEVSLQNVLDITADWTQGERQMLRN  445

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGLNTPFRDGL+KHVAQD++ LAK GLERRG+KE+GFLN V EV  TGVTPAEKLL
Sbjct  446  KVPVSGLNTPFRDGLVKHVAQDIVKLAKDGLERRGFKESGFLNEVTEVARTGVTPAEKLL  505

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWG+NVDPVFEELLY
Sbjct  506  ELYNGKWGRNVDPVFEELLY  525


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC+GMSFRDFMAGKLPP+PGE PTL DWENHLTTIFP     +   + G+  G WR
Sbjct  347  KKYIDCSGMSFRDFMAGKLPPVPGELPTLTDWENHLTTIFPEVRLKRYLEMRGSDGGPWR  406

Query  672  TLAAI  658
             L A+
Sbjct  407  RLCAL  411



>ref|XP_002273626.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660724.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660727.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 emb|CBI34672.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+ LD+ ADWT+ ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDIIADWTLEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLLKHVA+DVL LAK GLERRG+KETGFLNAVAEVV TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFKETGFLNAVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+YHG WGQ VDPVFEELLY
Sbjct  507  EMYHGPWGQCVDPVFEELLY  526


 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP +PGE P  NDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMSFRDFIAGKLPSLPGELPNFNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|NP_001234010.1| glutamate--cysteine ligase, chloroplastic [Solanum lycopersicum]
 sp|O22493.1|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Solanum lycopersicum]
 gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum]
Length=523

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ SLQSVLDMT DWT  ER+MLRN
Sbjct  384  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSLQSVLDMTFDWTAEERDMLRN  443

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLL HVAQDV+ LAK GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  444  KVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFKETGFLNEVAEVVKTGVTPAEKLL  503

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ+VDP+FEELLY
Sbjct  504  ELYHGKWGQSVDPIFEELLY  523


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTG+SFRDFM GKLPPIPGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  345  KKYVDCTGLSFRDFMNGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  404

Query  672  TLAAI  658
             L A+
Sbjct  405  RLCAL  409



>ref|XP_011022699.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMTADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSILDMTADWTSEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVA++VL LAK GLERRG+KE GFLNAVAEV +TG+TPAE+LL
Sbjct  447  KVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFKEVGFLNAVAEVASTGITPAEQLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ++DPVFEELLY
Sbjct  507  ELYHGKWGQSIDPVFEELLY  526


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMSFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_010325297.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Solanum lycopersicum]
 gb|ACQ91100.1| GSH1 [Solanum lycopersicum]
Length=523

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ SLQSVLDMT DWT  ER+MLRN
Sbjct  384  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSLQSVLDMTFDWTAEERDMLRN  443

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLL HVAQDV+ LAK GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  444  KVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFKETGFLNEVAEVVKTGVTPAEKLL  503

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ+VDP+FEELLY
Sbjct  504  ELYHGKWGQSVDPIFEELLY  523


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTG+SFRDFM GKLPPIPGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  345  KKYVDCTGLSFRDFMNGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  404

Query  672  TLAAI  658
             L A+
Sbjct  405  RLCAL  409



>ref|XP_006343987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Solanum 
tuberosum]
Length=523

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ SLQSVLDMT+DWT  ER+MLRN
Sbjct  384  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSLQSVLDMTSDWTAEERDMLRN  443

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLL HVAQDV+ LAK GLERRG+KETGFLN V EVV TGVTPAEKLL
Sbjct  444  KVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFKETGFLNEVTEVVKTGVTPAEKLL  503

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ+VDP+FEELLY
Sbjct  504  ELYHGKWGQSVDPIFEELLY  523


 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DC+G+SFRDFM GKLPPIPGEYPTLNDWENHLTTIFP     +   + G   G WR
Sbjct  345  KKYVDCSGLSFRDFMNGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  404

Query  672  TLAAI  658
             L A+
Sbjct  405  RLCAL  409



>ref|XP_006476577.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476578.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=526

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ+VLDMTADWT GER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVAQDVL L+K GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ++YHGKW ++VDPVFEELLY
Sbjct  507  DMYHGKWRESVDPVFEELLY  526


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>emb|CAL59719.1| gamma-glutamylcysteinyl synthetase [Medicago sativa]
Length=206

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ VLDMTADWT+ EREMLRN
Sbjct  67   FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLEEREMLRN  126

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLLKHVA++VL LAK GLERRG+KE+GFLNAVAEVV TGVTPAE+LL
Sbjct  127  KVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFKESGFLNAVAEVVRTGVTPAERLL  186

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VF+ELLY
Sbjct  187  ELYHGKWEQSVDHVFDELLY  206


 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  28   KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  87

Query  672  TLAAI  658
             L A+
Sbjct  88   RLCAL  92



>ref|XP_008392576.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus 
domestica]
Length=218

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLD+TADWT  ER++LRN
Sbjct  79   FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQLLRN  138

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LAK GLERRG+KETGFLN V E+V  GVTPAEKLL
Sbjct  139  KVPITGLKTPFRDGLLKHVAQDVVXLAKDGLERRGFKETGFLNEVVELVRAGVTPAEKLL  198

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  199  ELYNGKWGQQIDPVFEELLY  218


 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  40   KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  99

Query  672  TLAAI  658
             L A+
Sbjct  100  RLCAL  104



>gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana]
Length=524

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD +LQ++LD+TADWT  EREMLRN
Sbjct  385  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDTLQAILDLTADWTAAEREMLRN  444

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV+EVV TGVTPAEKLL
Sbjct  445  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVSEVVRTGVTPAEKLL  504

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+G+WGQ+VDPVF+ELLY
Sbjct  505  ELYNGEWGQSVDPVFQELLY  524


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR
Sbjct  346  KKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  405

Query  672  TLAAI  658
             L A+
Sbjct  406  RLCAL  410



>ref|XP_010255398.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nelumbo 
nucifera]
Length=526

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = -2

Query  794  GNCLLFLENIPHLMTGRTI*QQYFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD  615
            G   L L  +P L          FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+
Sbjct  364  GKLPLLLGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDE  423

Query  614  ISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYK  435
            +SLQ +LDMTADWT+ ER+MLRNKVPK+GL TPFRDGLL+HVA+DVL LAK GLERRGYK
Sbjct  424  VSLQHILDMTADWTLEERQMLRNKVPKTGLKTPFRDGLLRHVAEDVLELAKDGLERRGYK  483

Query  434  ETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
            ETGFL  V EVV TGVTPAEKLLELYHG W Q VDP+FEELLY
Sbjct  484  ETGFLKEVTEVVRTGVTPAEKLLELYHGSWSQCVDPIFEELLY  526


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K+YIDCTGMSFRDFMAGKLP + GE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KRYIDCTGMSFRDFMAGKLPLLLGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|EPS61788.1| gamma-glutamylcysteine synthetase, partial [Genlisea aurea]
Length=454

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYDDISLQ+ LD+TADWT  ER MLRN
Sbjct  315  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDDISLQNALDLTADWTPEERLMLRN  374

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPKSGL TPFRDGLLKHVAQ+V+  AK GLERRG+KETGFLN V EVVNTGVTPAEKLL
Sbjct  375  KVPKSGLKTPFRDGLLKHVAQEVVKFAKDGLERRGFKETGFLNEVTEVVNTGVTPAEKLL  434

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW  +VDPVFEELLY
Sbjct  435  ELYHGKWNGSVDPVFEELLY  454


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K Y++C GMSFRDFMAGKLP +PGEYP LNDWENHLTTIFP     +   + G   G WR
Sbjct  276  KSYVNCAGMSFRDFMAGKLPCLPGEYPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  335

Query  672  TLAAI  658
             L A+
Sbjct  336  RLCAL  340



>ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  381  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRN  440

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  441  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLL  500

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  501  EMYNGEWGQSVDPVFEELLY  520


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  343  KYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  402

Query  669  LAAI  658
            L A+
Sbjct  403  LCAL  406



>gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  503  EMYNGEWGQSVDPVFEELLY  522


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+F  F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  345  KYIDCTGMTFSAFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  404

Query  669  LAAI  658
            L A+
Sbjct  405  LCAL  408



>ref|NP_194041.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 ref|NP_001190808.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 sp|P46309.2|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; AltName: Full=Protein ROOT MERISTEMLESS 
1; Short=AtGCL; AltName: Full=Protein cadmium-sensitive 2; 
AltName: Full=Protein phytoalexin-deficient 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
 emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana]
 gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=522

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  503  EMYNGEWGQSVDPVFEELLY  522


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  345  KYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  404

Query  669  LAAI  658
            L A+
Sbjct  405  LCAL  408



>gb|AAL61610.1|AF401621_1 gamma-glutamylcysteine synthetase [Allium cepa]
Length=496

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDI+LQSV+++TADWT  ER+MLR 
Sbjct  357  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDIALQSVIEITADWTREERDMLRR  416

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LA+GGLERRGYKE GFL  VAEVVNTGVTPAEKLL
Sbjct  417  KVPVTGLKTPFRDGLLKHVAEDVLKLAQGGLERRGYKEVGFLREVAEVVNTGVTPAEKLL  476

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG NVDP+F+ELLY
Sbjct  477  ELYHGKWGCNVDPIFQELLY  496


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC+G+SFRDFM GKL P+PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  318  KKYIDCSGLSFRDFMKGKLSPVPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  377

Query  672  TLAAI  658
             L A+
Sbjct  378  RLCAL  382



>emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  503  EMYNGEWGQSVDPVFEELLY  522


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  345  KYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  404

Query  669  LAAI  658
            L A+
Sbjct  405  LCAL  408



>gb|EYU23478.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
 gb|EYU23479.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
Length=526

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+++LQ+VLD+TADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVALQNVLDLTADWTKEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGL TPFRDGLLKHVAQ+V++ AK GLERRG+KETGFLN V EVV TG+TPAEKLL
Sbjct  447  KVPVSGLKTPFRDGLLKHVAQEVVNFAKDGLERRGFKETGFLNEVTEVVKTGITPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWGQ++DPVFEELLY
Sbjct  507  ELYHGKWGQSIDPVFEELLY  526


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K+YIDC+G+SFRDFMAGKLP + GEYP LNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KQYIDCSGLSFRDFMAGKLPGLQGEYPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_009350437.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=503

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLD+TADWT  ER+MLRN
Sbjct  364  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQMLRN  423

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  424  KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  483

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  484  ELYNGKWGQQMDPVFEELLY  503


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  325  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  384

Query  672  TLAAI  658
             L A+
Sbjct  385  RLCAL  389



>ref|XP_008341055.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Malus domestica]
Length=526

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLD+TADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQIDPVFEELLY  526


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+ GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLVGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|KJB37541.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=527

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 132/141 (94%), Gaps = 1/141 (1%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQS+LDMTADWT  EREMLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQSILDMTADWTSEEREMLRN  446

Query  545  K-VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKL  369
            K VPK+GL TPFRDGLL H+A+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAEKL
Sbjct  447  KQVPKTGLKTPFRDGLLWHIAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAEKL  506

Query  368  LELYHGKWGQNVDPVFEELLY  306
            LELY+GKWGQ+VDPVFEELLY
Sbjct  507  LELYNGKWGQSVDPVFEELLY  527


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDFMAGKLP IPGE P LNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFMAGKLPCIPGELPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV +GVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRSGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  503  EMYNGEWGQSVDPVFEELLY  522


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  345  KYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  404

Query  669  LAAI  658
            L A+
Sbjct  405  LCAL  408



>ref|XP_006283533.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
 gb|EOA16431.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
Length=525

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ++LD+TADWT  EREMLRN
Sbjct  386  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQAILDLTADWTPAEREMLRN  445

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL  AK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  446  KVPVTGLKTPFRDGLLKHVAEDVLKHAKDGLERRGYKEAGFLNAVTEVVRTGVTPAEKLL  505

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+YHG+WGQ+VDPVFEELLY
Sbjct  506  EMYHGEWGQSVDPVFEELLY  525


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            +KY+DCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR
Sbjct  347  QKYVDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  406

Query  672  TLAAI  658
             L A+
Sbjct  407  RLCAL  411



>ref|XP_009350436.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=526

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLD+TADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQMDPVFEELLY  526


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFW+GLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWLGLLYDDDSLQAILDLTADWTPAEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  503  EMYNGEWGQSVDPVFEELLY  522


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  345  KYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  404

Query  669  LAAI  658
            L A+
Sbjct  405  LCAL  408



>ref|XP_002298035.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
 gb|EEE82840.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
Length=526

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQSVLDMTADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFR GLL+HVA++VL LAK GLERRG+KE GFLNAV++VV+TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRGGLLRHVAEEVLKLAKDGLERRGFKEVGFLNAVSDVVSTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG+++DPVFEELLY
Sbjct  507  ELYHGKWGRSIDPVFEELLY  526


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_011029270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQSVLDMTADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTADWTSEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLL+HVA++VL LAK GLERRG+KE GFLNAV++VV+TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGFKEVGFLNAVSDVVSTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW +++DPVFEELLY
Sbjct  507  ELYHGKWERSIDPVFEELLY  526


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|KCW77523.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=291

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLRN
Sbjct  152  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMVADWTPEERQMLRN  211

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDG L+H+A+ V+ LAK GLERRG+KE+GFLN V EVV TGVTPAEKLL
Sbjct  212  KVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERRGFKESGFLNEVKEVVRTGVTPAEKLL  271

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+GKWGQ+VDPVFEELLY
Sbjct  272  EMYNGKWGQSVDPVFEELLY  291


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  113  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  172

Query  672  TLAAI  658
             L A+
Sbjct  173  RLCAL  177



>gb|KDP25439.1| hypothetical protein JCGZ_20595 [Jatropha curcas]
Length=471

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ISLQ VLDM ADWT  ER+MLRN
Sbjct  332  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQHVLDMVADWTPEERQMLRN  391

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLL+HVA+DVL LAK GL+RRG+KE GFLN VAEVV TGVTPAEKLL
Sbjct  392  KVPVTGLKTPFRDGLLRHVAEDVLQLAKDGLQRRGFKEVGFLNEVAEVVRTGVTPAEKLL  451

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ+VDPVFEELLY
Sbjct  452  ELYNGKWGQSVDPVFEELLY  471


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDFMAGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  293  KKYIDCTGMTFRDFMAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  352

Query  672  TLAAI  658
             L A+
Sbjct  353  RLCAL  357



>ref|XP_012086908.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Jatropha 
curcas]
Length=526

 Score =   252 bits (643),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ISLQ VLDM ADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQHVLDMVADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLL+HVA+DVL LAK GL+RRG+KE GFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPVTGLKTPFRDGLLRHVAEDVLQLAKDGLQRRGFKEVGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ+VDPVFEELLY
Sbjct  507  ELYNGKWGQSVDPVFEELLY  526


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDFMAGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFMAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_010540831.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=524

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQSVLDMTADWT  EREMLR 
Sbjct  385  FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDEESLQSVLDMTADWTPEEREMLRK  444

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG LKHV +DVL LAK GLERRGYKETGFLNAVAEVV TG+TPAEKLL
Sbjct  445  KVPVTGLKTPFRDGRLKHVTEDVLKLAKDGLERRGYKETGFLNAVAEVVQTGITPAEKLL  504

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHG+WGQ+VDPVF+ELLY
Sbjct  505  ELYHGEWGQSVDPVFKELLY  524


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTG +FRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  346  KKYIDCTGSTFRDFVAGKLPRLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  405

Query  672  TLAAI  658
             L A+
Sbjct  406  RLCAL  410



>ref|XP_006413578.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413579.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413580.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 dbj|BAJ34068.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55031.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55032.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55033.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
Length=524

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ +LQ++LD+TADWT  EREMLRN
Sbjct  385  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDTLQAILDLTADWTPAEREMLRN  444

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAVAEVV TGVTPAE LL
Sbjct  445  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVAEVVRTGVTPAENLL  504

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  505  EMYNGEWGQSVDPVFQELLY  524


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR
Sbjct  346  KKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  405

Query  672  TLAAI  658
             L A+
Sbjct  406  RLCAL  410



>ref|XP_007209899.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
 gb|EMJ11098.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
Length=526

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+++LQ+VLD+TADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVALQNVLDITADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  447  KVPITGLKTPFRDGLLKHVAQDVVKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQIDPVFEELLY  526


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKL  IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLAGKLSCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_011463882.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLD+TADWT  ER+MLRN
Sbjct  377  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDITADWTPEERQMLRN  436

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LAK GLERRGYKE+GFLN VAEVV TGVTPAE+LL
Sbjct  437  KVPITGLKTPFRDGLLKHVAQDVVKLAKDGLERRGYKESGFLNEVAEVVRTGVTPAERLL  496

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW Q +DPVFEELLY
Sbjct  497  ELYNGKWEQQIDPVFEELLY  516


 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+ GKL  IPG+ PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  338  KKYIDCTGMTFRDFLKGKLRCIPGDLPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  397

Query  672  TLAAI  658
             L A+
Sbjct  398  RLCAL  402



>ref|XP_010448772.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=528

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ++LD+TADWT  EREMLRN
Sbjct  389  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQAILDLTADWTPAEREMLRN  448

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL  AK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  449  KVPVTGLKTPFRDGLLKHVAEDVLKHAKDGLERRGYKEAGFLNAVTEVVRTGVTPAEKLL  508

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  509  EMYNGEWGQSVDPVFEELLY  528


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR
Sbjct  350  KKYVDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  409

Query  672  TLAAI  658
             L A+
Sbjct  410  RLCAL  414



>gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum]
Length=499

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ VLDMTADWT+ EREMLRN
Sbjct  360  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQRVLDMTADWTLEEREMLRN  419

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLLKHVA++VL LAK GLERRG+KE+GFLNAVAEVV TGVTPAE+LL
Sbjct  420  KVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFKESGFLNAVAEVVRTGVTPAERLL  479

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VFEELLY
Sbjct  480  ELYHGKWEQSVDHVFEELLY  499


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  321  KKYVDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  380

Query  672  TLAAI  658
             L A+
Sbjct  381  RLCAL  385



>gb|ERN13322.1| hypothetical protein AMTR_s00041p00090940 [Amborella trichopoda]
Length=439

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+++LQ+VLDMT DWT+ ER+MLR 
Sbjct  300  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVALQTVLDMTYDWTVEERQMLRT  359

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            K+PK+GL TPFRDGLL+HVAQDV+ LAK GLERRGYKETGFLN VAEVV TGVTPAEKLL
Sbjct  360  KIPKTGLRTPFRDGLLRHVAQDVVKLAKEGLERRGYKETGFLNEVAEVVRTGVTPAEKLL  419

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LYHGKW   VDPV+EELLY
Sbjct  420  DLYHGKWENRVDPVYEELLY  439


 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYI+C+GMSFRDFMAGKLPPIPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  261  KKYINCSGMSFRDFMAGKLPPIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  320

Query  672  TLAAI  658
             L A+
Sbjct  321  RLCAL  325



>gb|AHC02699.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
 gb|AHC02700.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
Length=490

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+ LD TADWT  ER+MLRN
Sbjct  351  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDRTADWTPEERQMLRN  410

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  411  KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  470

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  471  ELYNGKWGQQMDPVFEELLY  490


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGK P IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  312  KKYIDCTGMTFRDFLAGKPPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  371

Query  672  TLAAI  658
             L A+
Sbjct  372  RLCAL  376



>gb|ADE06226.1| gamma-glutamylcysteine synthetase [Hevea brasiliensis]
Length=523

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ISLQ+V+DM ADWT  E +MLRN
Sbjct  384  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEISLQNVMDMVADWTPEETQMLRN  443

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDGLLKHVA DVL  AK GLERRG+KE GFLN VAEVV TGVTPAEKLL
Sbjct  444  KVPKTGLKTPFRDGLLKHVAVDVLKFAKDGLERRGFKEIGFLNEVAEVVRTGVTPAEKLL  503

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY GKWGQ+VDPVFEELLY
Sbjct  504  ELYDGKWGQSVDPVFEELLY  523


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFMAGKLP IPGE PTL+DWENHLTTIFP     +   + G   G WR
Sbjct  345  KKYIDCTGMSFRDFMAGKLPCIPGELPTLDDWENHLTTIFPEVRLKRYLEMRGADGGPWR  404

Query  672  TLAAI  658
             L A+
Sbjct  405  RLCAL  409



>ref|XP_010439228.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Camelina 
sativa]
Length=528

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ++LD+TADWT  EREMLRN
Sbjct  389  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEGSLQAILDLTADWTPAEREMLRN  448

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL  AK GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  449  KVPVTGLKTPFRDGLLKHVAEDVLKHAKDGLERRGYKEAGFLNAVTEVVRTGVTPAEKLL  508

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  509  EMYNGEWGQSVDPVFEELLY  528


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR
Sbjct  350  KKYVDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  409

Query  672  TLAAI  658
             L A+
Sbjct  410  RLCAL  414



>gb|KHN16824.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=510

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQSVLDMTADWT  ER+MLRN
Sbjct  371  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQSVLDMTADWTPEERQMLRN  430

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  431  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  490

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD V+EELLY
Sbjct  491  ELYHGKWEQSVDHVYEELLY  510


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDCTG +FRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  333  RYIDCTGKTFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  392

Query  669  LAAI  658
            L A+
Sbjct  393  LCAL  396



>gb|AHJ60103.1| gamma-glutamylcysteine synthetase [Pyrus betulifolia]
Length=526

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+ LD TADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNALDRTADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+KETGFLN VAEVV TGVTPAEKLL
Sbjct  447  KVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKETGFLNEVAEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQMDPVFEELLY  526


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGK P IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLAGKPPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With Mg2+ And L-glutamate
Length=449

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYD+  LQSVLD+TADWT  EREMLRN
Sbjct  310  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRN  369

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAE LL
Sbjct  370  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLL  429

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  430  EMYNGEWGQSVDPVFQELLY  449


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR 
Sbjct  272  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRR  331

Query  669  LAAI  658
            L A+
Sbjct  332  LCAL  335



>ref|XP_003525397.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Glycine max]
 ref|XP_006580590.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Glycine max]
 gb|KHN23647.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=504

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SL+SVLDMTADWT  ER+MLRN
Sbjct  365  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDELSLKSVLDMTADWTPEERQMLRN  424

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  425  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  484

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VFEELLY
Sbjct  485  ELYHGKWEQSVDHVFEELLY  504


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDCTG +FRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  327  RYIDCTGKTFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  386

Query  669  LAAI  658
            L A+
Sbjct  387  LCAL  390



>ref|XP_009402382.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=517

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDMTADWTM ER+MLR 
Sbjct  378  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMTADWTMEERQMLRR  437

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLL+HVA++VL L+K GLERRGYKE GFL  V +VV TGVTPAEKLL
Sbjct  438  KVPITGLKTPFRDGLLRHVAEEVLQLSKDGLERRGYKEAGFLKEVTDVVQTGVTPAEKLL  497

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG+NVDPVFEELLY
Sbjct  498  ELYHGKWGRNVDPVFEELLY  517


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  339  KKYIDCTGMSFRDFMQGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  398

Query  672  TLAAI  658
             L A+
Sbjct  399  RLCAL  403



>ref|XP_003630512.1| Glutamate-cysteine ligase [Medicago truncatula]
 sp|Q9ZNX6.1|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Medicago truncatula]
 gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula]
 gb|AET04988.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=508

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ VLDMTADWT+ EREMLRN
Sbjct  369  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLEEREMLRN  428

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLLKHVA++VL LAK GLERRG+KE+GFLNAVAEVV TGVTPAE+LL
Sbjct  429  KVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFKESGFLNAVAEVVRTGVTPAERLL  488

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VF+ELLY
Sbjct  489  ELYHGKWEQSVDHVFDELLY  508


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  330  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  389

Query  672  TLAAI  658
             L A+
Sbjct  390  RLCAL  394



>sp|O23736.1|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Brassica juncea]
 emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea]
 emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea]
Length=514

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYD+  LQSVLD+TADWT  EREMLRN
Sbjct  375  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRN  434

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAE LL
Sbjct  435  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLL  494

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  495  EMYNGEWGQSVDPVFQELLY  514


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR 
Sbjct  337  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRR  396

Query  669  LAAI  658
            L A+
Sbjct  397  LCAL  400



>ref|XP_008238836.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238837.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238838.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
Length=526

 Score =   249 bits (636),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+++LQ+VLD+TADWT  ER+MLR+
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVALQNVLDITADWTPEERQMLRD  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  447  KVPITGLKTPFRDGLLKHVAQDVVKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQIDPVFEELLY  526


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKL  IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLAGKLSCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_010433943.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=529

 Score =   249 bits (636),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ++LD+TADWT  EREMLRN
Sbjct  390  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQAILDLTADWTPAEREMLRN  449

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL  A+ GLERRGYKE GFLNAV EVV TGVTPAEKLL
Sbjct  450  KVPVTGLKTPFRDGLLKHVAEDVLKHAQDGLERRGYKEVGFLNAVTEVVRTGVTPAEKLL  509

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVFEELLY
Sbjct  510  EMYNGEWGQSVDPVFEELLY  529


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR
Sbjct  351  KKYVDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  410

Query  672  TLAAI  658
             L A+
Sbjct  411  RLCAL  415



>ref|XP_010695135.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695136.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695137.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYD+ SLQSVLDMT DWT+ EREMLRN
Sbjct  355  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDSLQSVLDMTYDWTVEEREMLRN  414

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK GL TPFRDG +KH+A++VL LAK GLERRG+KE GFLN VAEVV TGVTPAE+LL
Sbjct  415  KVPKLGLKTPFRDGYVKHIAEEVLKLAKDGLERRGFKEIGFLNEVAEVVRTGVTPAERLL  474

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+GKWGQNVDPVFEELLY
Sbjct  475  EMYNGKWGQNVDPVFEELLY  494


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K Y+DC+G+SFRDF+ GKLP +PGE+PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  316  KSYVDCSGLSFRDFIDGKLPVLPGEFPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWR  375

Query  672  TLAAI  658
             L A+
Sbjct  376  RLCAL  380



>gb|KCW77522.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=396

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLRN
Sbjct  257  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMVADWTPEERQMLRN  316

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDG L+H+A+ V+ LAK GLERRG+KE+GFLN V EVV TGVTPAEKLL
Sbjct  317  KVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERRGFKESGFLNEVKEVVRTGVTPAEKLL  376

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+GKWGQ+VDPVFEELLY
Sbjct  377  EMYNGKWGQSVDPVFEELLY  396


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  218  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  277

Query  672  TLAAI  658
             L A+
Sbjct  278  RLCAL  282



>gb|KGN50100.1| hypothetical protein Csa_5G153150 [Cucumis sativus]
Length=501

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRG+DGGPWRRLCALPAFWVGLLYD++SLQ+VLD+ ADWT GER+MLRN
Sbjct  362  FPEVRLKRYLEMRGSDGGPWRRLCALPAFWVGLLYDEVSLQNVLDIIADWTQGERQMLRN  421

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGL TPFRDGL+KHVAQD++ LAK GLERRG+KE+GFLN V EV  TGVTPAEKLL
Sbjct  422  KVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERRGFKESGFLNEVTEVARTGVTPAEKLL  481

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW Q VDPVFEELLY
Sbjct  482  ELYNGKWEQKVDPVFEELLY  501


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC+GMSFRDFMAGKLPP+PGE PTL DWENHLTTIFP     +   + G+  G WR
Sbjct  323  KKYIDCSGMSFRDFMAGKLPPVPGELPTLTDWENHLTTIFPEVRLKRYLEMRGSDGGPWR  382

Query  672  TLAAI  658
             L A+
Sbjct  383  RLCAL  387



>gb|ABK23872.1| unknown [Picea sitchensis]
Length=209

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQSVLD+T DWT+ E +MLRN
Sbjct  70   FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDETSLQSVLDITKDWTLEEMQMLRN  129

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK GL TPFRD LL+HVA+D+L LAK GL+RRG KE+GFLN VAEVV TG+TPAE+LL
Sbjct  130  KVPKMGLKTPFRDSLLRHVAEDILQLAKEGLQRRGCKESGFLNEVAEVVRTGITPAERLL  189

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LYHGKWG  VDPVFEELLY
Sbjct  190  DLYHGKWGNCVDPVFEELLY  209


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DC+GMSF+DFM GKLP +PGE P LNDWENHLTTIFP     +   + G   G WR
Sbjct  31   KKYVDCSGMSFKDFMKGKLPSLPGELPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  90

Query  672  TLAAI  658
             L A+
Sbjct  91   RLCAL  95



>ref|XP_006851855.2| PREDICTED: glutamate--cysteine ligase, chloroplastic [Amborella 
trichopoda]
 ref|XP_011626059.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Amborella 
trichopoda]
Length=533

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+++LQ+VLDMT DWT+ ER+MLR 
Sbjct  394  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVALQTVLDMTYDWTVEERQMLRT  453

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            K+PK+GL TPFRDGLL+HVAQDV+ LAK GLERRGYKETGFLN VAEVV TGVTPAEKLL
Sbjct  454  KIPKTGLRTPFRDGLLRHVAQDVVKLAKEGLERRGYKETGFLNEVAEVVRTGVTPAEKLL  513

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LYHGKW   VDPV+EELLY
Sbjct  514  DLYHGKWENRVDPVYEELLY  533


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYI+C+GMSFRDFMAGKLPPIPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  355  KKYINCSGMSFRDFMAGKLPPIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  414

Query  672  TLAAI  658
             L A+
Sbjct  415  RLCAL  419



>ref|XP_011654747.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
sativus]
Length=525

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRG+DGGPWRRLCALPAFWVGLLYD++SLQ+VLD+ ADWT GER+MLRN
Sbjct  386  FPEVRLKRYLEMRGSDGGPWRRLCALPAFWVGLLYDEVSLQNVLDIIADWTQGERQMLRN  445

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGL TPFRDGL+KHVAQD++ LAK GLERRG+KE+GFLN V EV  TGVTPAEKLL
Sbjct  446  KVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERRGFKESGFLNEVTEVARTGVTPAEKLL  505

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW Q VDPVFEELLY
Sbjct  506  ELYNGKWEQKVDPVFEELLY  525


 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC+GMSFRDFMAGKLPP+PGE PTL DWENHLTTIFP     +   + G+  G WR
Sbjct  347  KKYIDCSGMSFRDFMAGKLPPVPGELPTLTDWENHLTTIFPEVRLKRYLEMRGSDGGPWR  406

Query  672  TLAAI  658
             L A+
Sbjct  407  RLCAL  411



>ref|NP_001292626.1| glutamate--cysteine ligase, chloroplastic [Cucumis sativus]
 gb|ADK77882.1| gamma-glutamylcysteine synthetase [Cucumis sativus]
Length=525

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRG+DGGPWRRLCALPAFWVGLLYD++SLQ+VLD+ ADWT GER+MLRN
Sbjct  386  FPEVRLKRYLEMRGSDGGPWRRLCALPAFWVGLLYDEVSLQNVLDIIADWTQGERQMLRN  445

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP SGL TPFRDGL+KHVAQD++ LAK GLERRG+KE+GFLN V EV  TGVTPAEKLL
Sbjct  446  KVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERRGFKESGFLNEVTEVARTGVTPAEKLL  505

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW Q VDPVFEELLY
Sbjct  506  ELYNGKWEQKVDPVFEELLY  525


 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC+GMSFRDFMAGKLPP+PGE PTL DWENHLTTIFP     +   + G+  G WR
Sbjct  347  KKYIDCSGMSFRDFMAGKLPPVPGELPTLTDWENHLTTIFPEVRLKRYLEMRGSDGGPWR  406

Query  672  TLAAI  658
             L A+
Sbjct  407  RLCAL  411



>ref|XP_009364899.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364900.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364901.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364902.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364956.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=526

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SLQ+VLD+TADWT  ER++LRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQNVLDLTADWTPEERQLLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LAK GLERRG+KETGFLN V E+V  GVTPAEKLL
Sbjct  447  KVPLTGLKTPFRDGLLKHVAQDVVTLAKDGLERRGFKETGFLNEVVELVRAGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQIDPVFEELLY  526


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCAGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>emb|CAC27145.1| glutamate-cysteine ligase [Picea abies]
Length=230

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQSVLD+T DWT+ E +MLRN
Sbjct  91   FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDETSLQSVLDITKDWTLEEMQMLRN  150

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK GL TPFRD LL+HVA+D+L LAK GL+RRG KE+GFLN VAEVV TG+TPAE+LL
Sbjct  151  KVPKMGLKTPFRDSLLRHVAEDILQLAKEGLQRRGCKESGFLNEVAEVVRTGITPAERLL  210

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LYHGKWG  VDPVFEELLY
Sbjct  211  DLYHGKWGNCVDPVFEELLY  230


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DC+GMSF+DFM GKLP +PGE+P LNDWENHLTTIFP     +   + G   G WR
Sbjct  52   KKYVDCSGMSFKDFMKGKLPSLPGEFPNLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  111

Query  672  TLAAI  658
             L A+
Sbjct  112  RLCAL  116



>ref|XP_010920822.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010920823.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDMTADWT  ER+MLR 
Sbjct  384  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMTADWTEEERQMLRE  443

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLL+HVA+DVL LAK GLERR YKE GFLN V EVV TGVTPAEKLL
Sbjct  444  KVPVTGLRTPFRDGLLRHVAEDVLKLAKDGLERRSYKEAGFLNEVTEVVRTGVTPAEKLL  503

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG +VDPVF+ELLY
Sbjct  504  ELYHGKWGCSVDPVFKELLY  523


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  345  KKYIDCTGMSFRDFMVGKLPSIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  404

Query  672  TLAAI  658
             L A+
Sbjct  405  RLCAL  409



>ref|XP_009137315.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=515

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+  LQ+VLD+ ADWT  EREMLRN
Sbjct  376  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADWTPAEREMLRN  435

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GL+RRGYKE GFLNAVAEVV TGVTPAE LL
Sbjct  436  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRRGYKEAGFLNAVAEVVRTGVTPAENLL  495

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  496  EMYNGEWGQSVDPVFQELLY  515


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR
Sbjct  337  KKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  396

Query  672  TLAAI  658
             L A+
Sbjct  397  RLCAL  401



>emb|CAD91714.1| glutamate-cysteine ligase [Brassica juncea]
Length=515

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+  LQ+VLD+ ADWT  EREMLRN
Sbjct  376  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADWTPAEREMLRN  435

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GL+RRGYKE GFLNAVAEVV TGVTPAE LL
Sbjct  436  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRRGYKEAGFLNAVAEVVRTGVTPAENLL  495

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  496  EMYNGEWGQSVDPVFQELLY  515


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR
Sbjct  337  KKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  396

Query  672  TLAAI  658
             L A+
Sbjct  397  RLCAL  401



>ref|XP_010053262.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Eucalyptus grandis]
 gb|KCW77521.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=526

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMVADWTPEERQMLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFRDG L+H+A+ V+ LAK GLERRG+KE+GFLN V EVV TGVTPAEKLL
Sbjct  447  KVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERRGFKESGFLNEVKEVVRTGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+GKWGQ+VDPVFEELLY
Sbjct  507  EMYNGKWGQSVDPVFEELLY  526


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|ADX30738.2| truncated gamma-glutamyl-cysteine synthetase, partial [Populus 
x canadensis]
Length=415

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQSVLDMTADWT  ER+MLR 
Sbjct  276  FPEVRLKRYLEMRGADGGPWRRLCALPASWVGLLYDEDSLQSVLDMTADWTSEERQMLRI  335

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK+GL TPFR GLL+HVA++VL LAK GLERRG+KE GFLNAV++VV+TGVTPAEKLL
Sbjct  336  KVPKTGLKTPFRGGLLRHVAEEVLKLAKDGLERRGFKEVGFLNAVSDVVSTGVTPAEKLL  395

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG+++DPVFEELLY
Sbjct  396  ELYHGKWGRSIDPVFEELLY  415


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  237  KKYIDCTGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  296

Query  672  TLAAI  658
             L A+
Sbjct  297  RLCAL  301



>emb|CDY10914.1| BnaA03g45730D [Brassica napus]
Length=517

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+  LQ+VLD+ ADWT  EREMLRN
Sbjct  378  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADWTPAEREMLRN  437

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GL+RRGYKE GFLNAVAEVV TGVTPAE LL
Sbjct  438  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRRGYKEAGFLNAVAEVVRTGVTPAENLL  497

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  498  EMYNGEWGQSVDPVFQELLY  517


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR
Sbjct  339  KKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  398

Query  672  TLAAI  658
             L A+
Sbjct  399  RLCAL  403



>ref|XP_010937863.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010937864.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
Length=522

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDMT+DWT  ER+MLR 
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMTSDWTEQERQMLRR  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLL+HVA++VL LAK GLERRGYKE GFL  V EVV+TGVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLRHVAEEVLKLAKDGLERRGYKEAGFLKEVTEVVSTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG +VDPVFEELLY
Sbjct  503  ELYHGKWGCSVDPVFEELLY  522


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  344  KKYIDCTGMSFRDFMEGKLPSIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  403

Query  672  TLAAI  658
             L A+
Sbjct  404  RLCAL  408



>ref|XP_009364919.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364920.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364921.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364922.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=526

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ SLQ+VLD+TADWT  ER++LRN
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEASLQNVLDLTADWTPEERQLLRN  446

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVAQDV+ LAK GLERRG+KETGFLN V E+V  GVTPAEKLL
Sbjct  447  KVPLTGLKTPFRDGLLKHVAQDVVTLAKDGLERRGFKETGFLNEVVELVRAGVTPAEKLL  506

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWGQ +DPVFEELLY
Sbjct  507  ELYNGKWGQQIDPVFEELLY  526


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCAGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_008789126.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDMTADWT  EREMLR 
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMTADWTEQEREMLRR  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLL++VA++VL LAK GLERRGYKE GFL  V EVV+TGVTPAEKLL
Sbjct  443  KVPVTGLKTPFRDGLLRYVAEEVLKLAKDGLERRGYKEAGFLKEVTEVVSTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG +VDPVFEELLY
Sbjct  503  ELYHGKWGCSVDPVFEELLY  522


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  344  KKYIDCMGMSFRDFMVGKLPSIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  403

Query  672  TLAAI  658
             L A+
Sbjct  404  RLCAL  408



>gb|AEA77156.1| chloroplast gamma glutamyl cysteine synthetase [Vigna radiata]
Length=508

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYDD SLQSVLD+TADWT  ER MLRN
Sbjct  369  FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDDASLQSVLDLTADWTPEERLMLRN  428

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRG+KE+GFLN VAEVV TGVTP EKLL
Sbjct  429  KVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERRGFKESGFLNEVAEVVRTGVTPXEKLL  488

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VFEELLY
Sbjct  489  ELYHGKWEQSVDHVFEELLY  508


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDCTG +FRDF+ G+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  331  RYIDCTGKTFRDFLDGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  390

Query  669  LAAI  658
            L A+
Sbjct  391  LCAL  394



>ref|XP_009136711.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136719.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136726.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea]
Length=511

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGL YD+  LQ+ LD+TADWT  EREMLRN
Sbjct  372  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRN  431

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAE LL
Sbjct  432  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVTEVVRTGVTPAENLL  491

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  492  EMYNGEWGQSVDPVFQELLY  511


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR 
Sbjct  334  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRR  393

Query  669  LAAI  658
            L A+
Sbjct  394  LCAL  397



>emb|CAA06613.1| gamma-glutamylcysteine synthetase [Brassica juncea]
Length=436

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGL YD+  LQ+ LD+TADWT  EREMLRN
Sbjct  297  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRN  356

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAE LL
Sbjct  357  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVTEVVRTGVTPAENLL  416

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  417  EMYNGEWGQSVDPVFQELLY  436


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR 
Sbjct  259  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRR  318

Query  669  LAAI  658
            L A+
Sbjct  319  LCAL  322



>ref|XP_007160058.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
 gb|ESW32052.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
Length=508

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQS+LD+TADWT  ER+MLRN
Sbjct  369  FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDEASLQSLLDLTADWTPEERQMLRN  428

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  429  KVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  488

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VFEELLY
Sbjct  489  ELYHGKWEQSVDHVFEELLY  508


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDCTG +FRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  331  RYIDCTGKTFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  390

Query  669  LAAI  658
            L A+
Sbjct  391  LCAL  394



>gb|AAF22136.1|AF128454_1 gamma-glutamylcysteine synthetase precursor [Phaseolus vulgaris]
Length=508

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQS+LD+TADWT  ER+MLRN
Sbjct  369  FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDEASLQSLLDLTADWTPEERQMLRN  428

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  429  KVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  488

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKW Q+VD VFEELLY
Sbjct  489  ELYHGKWEQSVDHVFEELLY  508


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDCTG +FRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  331  RYIDCTGKTFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  390

Query  669  LAAI  658
            L A+
Sbjct  391  LCAL  394



>ref|XP_004503722.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=504

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD+ISLQSVLD+T DWT+ ER+MLRN
Sbjct  365  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEISLQSVLDLTEDWTLEERQMLRN  424

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLLKHVA++VL LAK GLERRG+KE+GFLNAVAEVV TGVTPAE+LL
Sbjct  425  KVTVTGLRTPFRDGLLKHVAEEVLKLAKDGLERRGFKESGFLNAVAEVVRTGVTPAERLL  484

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW Q+VD VFEELLY
Sbjct  485  ELYNGKWEQSVDHVFEELLY  504


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  326  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  385

Query  672  TLAAI  658
             L A+
Sbjct  386  RLCAL  390



>emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus]
 emb|CDY53137.1| BnaC01g41470D [Brassica napus]
Length=514

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYD+  LQ+ LD+TADWT  EREMLRN
Sbjct  375  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAALDLTADWTPAEREMLRN  434

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNA+ EVV TGVTPAE LL
Sbjct  435  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNALTEVVRTGVTPAENLL  494

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  495  EMYNGEWGQSVDPVFQELLY  514


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR 
Sbjct  337  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRR  396

Query  669  LAAI  658
            L A+
Sbjct  397  LCAL  400



>ref|XP_007210716.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
 gb|EMJ11915.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
Length=463

 Score =   231 bits (590),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLKRYLEMRGADGGPW RL ALPAFWVGLLYD++SLQ+V+DM ADWT  ER+MLR+
Sbjct  324  YPEVRLKRYLEMRGADGGPWSRLRALPAFWVGLLYDEVSLQNVIDMIADWTAEERQMLRD  383

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VPK+GL TPFR  LLKHVAQDV+  AK GLERRG+ ETGFLN + EV  TGVTPAEKLL
Sbjct  384  QVPKTGLKTPFRGRLLKHVAQDVVRFAKAGLERRGFNETGFLNELEEVARTGVTPAEKLL  443

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+ KWGQN+DPVFEELLY
Sbjct  444  ELYYRKWGQNIDPVFEELLY  463


 Score = 71.2 bits (173),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K++ DCTGM+FRDFMAGKL  IPGE PT+NDWE HL TI+P
Sbjct  285  KRHFDCTGMTFRDFMAGKLRCIPGELPTMNDWEMHLGTIYP  325



>emb|CAR82640.1| putative glutamyl cysteine ligase [Brassica napus]
 emb|CDX94161.1| BnaC07g37950D [Brassica napus]
Length=503

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+  LQ+VLD+ AD T  EREMLRN
Sbjct  364  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDVLQAVLDLIADLTPAEREMLRN  423

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAVAEVV TGVTPAE LL
Sbjct  424  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVAEVVRTGVTPAENLL  483

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  484  EMYNGEWGQSVDPVFQELLY  503


 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR
Sbjct  325  KKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  384

Query  672  TLAAI  658
             L A+
Sbjct  385  RLCAL  389



>ref|XP_008792987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792991.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792999.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008793008.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=522

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLR 
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMIADWTEEERQMLRE  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLL+HVA+DVL LAK GLERR YKE GFLN V EVV TGVTPAEKLL
Sbjct  443  KVTITGLKTPFRDGLLRHVAEDVLKLAKDGLERRCYKEAGFLNEVTEVVRTGVTPAEKLL  502

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG +VDPVFEELLY
Sbjct  503  ELYHGKWGCSVDPVFEELLY  522


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  344  KKYIDCTGMSFRDFMVGKLPSIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  403

Query  672  TLAAI  658
             L A+
Sbjct  404  RLCAL  408



>emb|CDY41369.1| BnaC03g65140D [Brassica napus]
Length=460

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWR LCALPAFWVGLLYD+  LQ++LD+TADWT  EREMLRN
Sbjct  321  FPEVRLKRYLEMRGADGGPWRGLCALPAFWVGLLYDEDVLQAILDLTADWTHAEREMLRN  380

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG LKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAE LL
Sbjct  381  KVPVTGLKTPFRDGFLKHVAEDVLKLAKDGLERRGYKEVGFLNAVGEVVRTGVTPAENLL  440

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ++Y+G+WGQ+VDPVF+ELLY
Sbjct  441  DMYNGEWGQSVDPVFQELLY  460


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = -1

Query  807  DFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTLAAI  658
             F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR L A+
Sbjct  294  QFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRGLCAL  346



>emb|CDY41249.1| BnaA01g12900D [Brassica napus]
Length=511

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGL YD+  LQ+ LD+TADWT  EREMLRN
Sbjct  372  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRN  431

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LA  GLERRGYKE GFLNA+ EVV TGVTPAE LL
Sbjct  432  KVPVTGLKTPFRDGLLKHVAEDVLKLATDGLERRGYKEAGFLNALTEVVRTGVTPAENLL  491

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  492  EMYNGEWGQSVDPVFQELLY  511


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIFP     +   + G   G WR 
Sbjct  334  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRR  393

Query  669  LAAI  658
            L A+
Sbjct  394  LCAL  397



>pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|B Chain B, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|C Chain C, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|D Chain D, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|E Chain E, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|F Chain F, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|G Chain G, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|H Chain H, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
Length=449

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY E RGADGGPWRRLCALPAFWVGLLYD+  LQSVLD+TADWT  ERE LRN
Sbjct  310  FPEVRLKRYXEXRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREXLRN  369

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EVV TGVTPAE LL
Sbjct  370  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLL  429

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E Y+G+WGQ+VDPVF+ELLY
Sbjct  430  EXYNGEWGQSVDPVFQELLY  449


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*KVP---GNARGRWRT  670
            KY+DCTG +FR F+AGKLP +PGE PT NDWENHLTTIFP     +     G   G WR 
Sbjct  272  KYVDCTGXTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYXEXRGADGGPWRR  331

Query  669  LAAI  658
            L A+
Sbjct  332  LCAL  335



>gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
 gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
Length=495

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQ VLD+TADWT  ER+MLRN
Sbjct  356  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQGVLDLTADWTQQERQMLRN  415

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  SGL TPFRDGLLKHVA+DVL LAK GLE+RG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  416  KVTVSGLKTPFRDGLLKHVAEDVLKLAKDGLEKRGFKESGFLNEVAEVVRTGVTPAERLL  475

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY GKW Q+VD VFEELLY
Sbjct  476  ELYDGKWNQSVDHVFEELLY  495


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  318  KYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  377

Query  669  LAAI  658
            L A+
Sbjct  378  LCAL  381



>ref|XP_008341054.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=547

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 131/161 (81%), Gaps = 21/161 (13%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWV---------------------GLLYDDIS  609
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWV                     G+LYD++S
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVTLLTTNSQQHKLIVICLKLQVGILYDEVS  446

Query  608  LQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKET  429
            LQ+VLD+TADWT  ER+MLRNKVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+KET
Sbjct  447  LQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGFKET  506

Query  428  GFLNAVAEVVNTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
            GFLN VAEVV TGVTPAEKLLELY+GKWGQ +DPVFEELLY
Sbjct  507  GFLNEVAEVVRTGVTPAEKLLELYNGKWGQQIDPVFEELLY  547


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+ GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLVGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_008792975.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=582

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLR 
Sbjct  443  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMIADWTEEERQMLRE  502

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLL+HVA+DVL LAK GLERR YKE GFLN V EVV TGVTPAEKLL
Sbjct  503  KVTITGLKTPFRDGLLRHVAEDVLKLAKDGLERRCYKEAGFLNEVTEVVRTGVTPAEKLL  562

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG +VDPVFEELLY
Sbjct  563  ELYHGKWGCSVDPVFEELLY  582


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  404  KKYIDCTGMSFRDFMVGKLPSIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  463

Query  672  TLAAI  658
             L A+
Sbjct  464  RLCAL  468



>ref|XP_008792981.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=575

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+VLDM ADWT  ER+MLR 
Sbjct  436  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVLDMIADWTEEERQMLRE  495

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KV  +GL TPFRDGLL+HVA+DVL LAK GLERR YKE GFLN V EVV TGVTPAEKLL
Sbjct  496  KVTITGLKTPFRDGLLRHVAEDVLKLAKDGLERRCYKEAGFLNEVTEVVRTGVTPAEKLL  555

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG +VDPVFEELLY
Sbjct  556  ELYHGKWGCSVDPVFEELLY  575


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  397  KKYIDCTGMSFRDFMVGKLPSIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  456

Query  672  TLAAI  658
             L A+
Sbjct  457  RLCAL  461



>ref|XP_010089108.1| Glutamate--cysteine ligase [Morus notabilis]
 gb|EXB37355.1| Glutamate--cysteine ligase [Morus notabilis]
Length=582

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 3/139 (2%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFW---VGLLYDDISLQSVLDMTADWTMGEREM  555
            FPEVRLKRYLEMRGADGGPWRRLCALPAFW   VGLLYD++SLQ+VLDMTADWT  ER+M
Sbjct  392  FPEVRLKRYLEMRGADGGPWRRLCALPAFWNDQVGLLYDEVSLQNVLDMTADWTPEERQM  451

Query  554  LRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAE  375
            LRNKVPK+GL TPFRDG L+HVA+DVLHLAK GLERRG+KE+GFLNAVAEVV TGVTPAE
Sbjct  452  LRNKVPKTGLKTPFRDGYLRHVAEDVLHLAKDGLERRGFKESGFLNAVAEVVRTGVTPAE  511

Query  374  KLLELYHGKWGQNVDPVFE  318
            KLLELY+G+WGQ+VDPV E
Sbjct  512  KLLELYNGEWGQSVDPVKE  530


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  353  KKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  412

Query  672  TLAAI  658
             L A+
Sbjct  413  RLCAL  417



>ref|XP_008341053.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=550

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 131/164 (80%), Gaps = 24/164 (15%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFW------------------------VGLLYD  618
            FPEVRLKRYLEMRGADGGPWRRLCALPAFW                        VG+LYD
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWLLQVTLLTTNSQQHKLIVICLKLQVGILYD  446

Query  617  DISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGY  438
            ++SLQ+VLD+TADWT  ER+MLRNKVP +GL TPFRDGLLKHVAQDV+ LA+ GLERRG+
Sbjct  447  EVSLQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERRGF  506

Query  437  KETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
            KETGFLN VAEVV TGVTPAEKLLELY+GKWGQ +DPVFEELLY
Sbjct  507  KETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQIDPVFEELLY  550


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM+FRDF+ GKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCTGMTFRDFLVGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>ref|XP_009364953.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364954.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=537

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 11/151 (7%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISL-----------QSVLDMTAD  579
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYD++SL           Q+VLD+TAD
Sbjct  387  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLXXXXXXXXXXLQNVLDLTAD  446

Query  578  WTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVV  399
            WT  ER++LRNKVP +GL TPFRDGLLKHVAQDV+ LAK GLERRG+KETGFLN V E+V
Sbjct  447  WTPEERQLLRNKVPLTGLKTPFRDGLLKHVAQDVVTLAKDGLERRGFKETGFLNEVVELV  506

Query  398  NTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
              GVTPAEKLLELY+GKWGQ +DPVFEELLY
Sbjct  507  RAGVTPAEKLLELYNGKWGQQIDPVFEELLY  537


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDC GMSFRDF+AGKLP IPGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  348  KKYIDCAGMSFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  407

Query  672  TLAAI  658
             L A+
Sbjct  408  RLCAL  412



>gb|ACX70134.1| gamma-glutamylcysteine synthetase [Brassica rapa subsp. chinensis]
Length=511

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            F EVRLKRY+EMRGADGGPWRRLCALPAFWVGL YD+  LQ+ LD+TADWT  EREMLRN
Sbjct  372  FLEVRLKRYMEMRGADGGPWRRLCALPAFWVGLFYDEDVLQAALDLTADWTPAEREMLRN  431

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LA  GLERRGYKE GFLNA+ EVV TGVTPAE LL
Sbjct  432  KVPVTGLKTPFRDGLLKHVAEDVLKLATDGLERRGYKEAGFLNALTEVVRTGVTPAENLL  491

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+G+WGQ+VDPVF+ELLY
Sbjct  492  EMYNGEWGQSVDPVFQELLY  511


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KY+DCTGM+FR F+AGKLP +PGE PT NDWENHLTTIF      +   + G   G WR 
Sbjct  334  KYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFLEVRLKRYMEMRGADGGPWRR  393

Query  669  LAAI  658
            L A+
Sbjct  394  LCAL  397



>ref|XP_006586325.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Glycine 
max]
Length=507

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQSVLDMTADWT  ER+MLRN
Sbjct  371  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQSVLDMTADWTPEERQMLRN  430

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRG+KE+GFLN VAEVV TGVTPAE+LL
Sbjct  431  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGVTPAERLL  490

Query  365  ELYHGKWGQNV  333
            ELYHGKW Q+V
Sbjct  491  ELYHGKWEQSV  501


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDCTG +FRDF+AG+LP IPGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  333  RYIDCTGKTFRDFLAGRLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  392

Query  669  LAAI  658
            L A+
Sbjct  393  LCAL  396



>gb|AAW58147.1| gamma-glutamylcysteine synthetase [Triticum aestivum]
Length=374

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYDD SLQS++DMTADWT  EREMLR 
Sbjct  235  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDDESLQSIIDMTADWTKEEREMLRR  294

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+DVL LAK GLERRGYKE GFL  V EVV TGVTPAEKLL
Sbjct  295  KVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLL  354

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVFEELLY
Sbjct  355  NLYEMKWQRSVDPVFEELLY  374


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K YIDCTGMSFRDFMAGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  196  KTYIDCTGMSFRDFMAGKLPXVPGELPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWR  255

Query  672  TLAAI  658
             L A+
Sbjct  256  RLCAL  260



>dbj|BAJ84988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWR+LCALPAFWVGLLYDD SLQS++DMT+DWT  EREMLR 
Sbjct  235  FPEVRLKRYMEMRGADGGPWRKLCALPAFWVGLLYDDESLQSIIDMTSDWTKEEREMLRR  294

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+DVL LAK GLERRGYKE GFL  V EVV TGVTPAEKLL
Sbjct  295  KVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLL  354

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVFEELLY
Sbjct  355  NLYETKWQRSVDPVFEELLY  374


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K YIDCTGMSFRDFMAGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  196  KNYIDCTGMSFRDFMAGKLPQVPGELPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWR  255

Query  672  TLAAI  658
             L A+
Sbjct  256  KLCAL  260



>ref|NP_001168108.1| uncharacterized protein LOC100381846 [Zea mays]
 gb|ACN27107.1| unknown [Zea mays]
Length=186

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMT DWT  EREMLR+
Sbjct  47   FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTQEEREMLRH  106

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A++VL LAK GLERRGYKE GFL  V EVV TGVTPAE+LL
Sbjct  107  KVPLTGLKTPFRDGYVRDLAEEVLKLAKNGLERRGYKEVGFLREVDEVVRTGVTPAERLL  166

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW +NVD VFE LLY
Sbjct  167  HLYETKWQRNVDHVFEHLLY  186


 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGMSFRDFM GKL   PGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  9    KYIDCTGMSFRDFMQGKLRQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  68

Query  669  LAAI  658
            L A+
Sbjct  69   LCAL  72



>ref|XP_003569058.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic [Brachypodium 
distachyon]
Length=497

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMTADWT  EREMLR 
Sbjct  358  FPEVRLKRYIEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTADWTNAEREMLRR  417

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+DVL LAK GLERRGYKE GFL  V EVV TGVTPAEKLL
Sbjct  418  KVPVTGLKTPFRDGYVRDLAEDVLKLAKSGLERRGYKEVGFLREVDEVVRTGVTPAEKLL  477

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  478  NLYETKWQRSVDPVFQELLY  497


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K+YIDCTGMSFRDFM GKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  319  KQYIDCTGMSFRDFMVGKLPQVPGELPTLNDWENHLTTIFPEVRLKRYIEMRGADGGPWR  378

Query  672  TLAAI  658
             L A+
Sbjct  379  RLCAL  383



>ref|XP_009380693.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=524

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+V +M +DWT  EREMLR 
Sbjct  385  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVSEMISDWTREEREMLRK  444

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFR GLL+HVA+DVL LAK GLERRGYKE GFL  V E V TGVTPAEKLL
Sbjct  445  KVPVTGLKTPFRGGLLRHVAEDVLKLAKDGLERRGYKEAGFLKEVTETVQTGVTPAEKLL  504

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWG  V PVF+ELLY
Sbjct  505  ELYNGKWGGRVGPVFQELLY  524


 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            + YIDCTGMSFRDFM GKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  346  RTYIDCTGMSFRDFMRGKLPSLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  405

Query  672  TLAAI  658
             L A+
Sbjct  406  RLCAL  410



>ref|XP_009380691.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009380692.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD++SLQ+V +M +DWT  EREMLR 
Sbjct  400  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEVSLQNVSEMISDWTREEREMLRK  459

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFR GLL+HVA+DVL LAK GLERRGYKE GFL  V E V TGVTPAEKLL
Sbjct  460  KVPVTGLKTPFRGGLLRHVAEDVLKLAKDGLERRGYKEAGFLKEVTETVQTGVTPAEKLL  519

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKWG  V PVF+ELLY
Sbjct  520  ELYNGKWGGRVGPVFQELLY  539


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            + YIDCTGMSFRDFM GKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  361  RTYIDCTGMSFRDFMRGKLPSLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  420

Query  672  TLAAI  658
             L A+
Sbjct  421  RLCAL  425



>ref|XP_001757520.1| predicted protein [Physcomitrella patens]
 gb|EDQ77577.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFW GLLYD+ SLQ  LD+  DWT  ER MLR+
Sbjct  322  FPEVRLKRYLEMRGADGGPWRRLCALPAFWTGLLYDEESLQGALDIINDWTERERAMLRS  381

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK GLN PFRDGLLKHVAQDV  LAK GL RRG  ETGFL  + E V TG TPAE +L
Sbjct  382  KVPKLGLNVPFRDGLLKHVAQDVFKLAKDGLTRRGLNETGFLKDIEETVRTGKTPAEHIL  441

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYHGKWG+NVDPVFE+LLY
Sbjct  442  ELYHGKWGENVDPVFEKLLY  461


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YIDC+GMSF+DF+ GKL  +PGE PT+NDWENHLTTIFP     +   + G   G WR 
Sbjct  284  RYIDCSGMSFKDFLEGKLSALPGEKPTMNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  343

Query  669  LAAI  658
            L A+
Sbjct  344  LCAL  347



>gb|ACK38262.1| gamma-glutamylcysteine synthetase [Phragmites australis]
Length=374

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMT DWT  EREMLR 
Sbjct  235  FPEVRLKRYIEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRR  294

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+DVL LAK GLERRGYKE GFL  V EVV TGVTP+E+LL
Sbjct  295  KVPLTGLKTPFRDGYVRDLAEDVLKLAKSGLERRGYKEVGFLREVDEVVRTGVTPSERLL  354

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVFE LLY
Sbjct  355  NLYETKWQRSVDPVFEHLLY  374


 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGM FRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  196  KKYIDCTGMPFRDFMEGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYIEMRGADGGPWR  255

Query  672  TLAAI  658
             L A+
Sbjct  256  RLCAL  260



>ref|XP_002965328.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
 gb|EFJ34166.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
Length=464

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPW+RLCALPAFWVG+LYD+ +L+S   M   WT GER MLR+
Sbjct  325  FPEVRLKRYLEMRGADGGPWKRLCALPAFWVGILYDEEALESASKMVEGWTEGERAMLRS  384

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP+ GL+TPFRDG LKHVAQDV  LA+ GL+RRGYKE GFLN +AE+V TGVTPAEKLL
Sbjct  385  KVPRLGLSTPFRDGQLKHVAQDVFKLARDGLQRRGYKEAGFLNDIAEIVRTGVTPAEKLL  444

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY GKW ++VDPVF+ELLY
Sbjct  445  SLYEGKWNKSVDPVFQELLY  464


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K+Y+DCTG SF+DF+AG+L  +PGE PTLNDWENHLTTIFP     +   + G   G W+
Sbjct  286  KRYVDCTGQSFKDFLAGRLSNLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWK  345

Query  672  TLAAI  658
             L A+
Sbjct  346  RLCAL  350



>ref|XP_002977172.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
 gb|EFJ21781.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
Length=438

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPW+RLCALPAFWVG+LYD+ +L+S   M   WT GER MLR+
Sbjct  299  FPEVRLKRYLEMRGADGGPWKRLCALPAFWVGILYDEEALESASKMVEGWTEGERAMLRS  358

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP+ GL+TPFRDG LKHVAQ+V  LA+ GL+RRGYKE GFLN +AE+V TGVTPAEKLL
Sbjct  359  KVPRLGLSTPFRDGQLKHVAQEVFKLARDGLQRRGYKEAGFLNDIAEIVRTGVTPAEKLL  418

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY GKW ++VDPVF+ELLY
Sbjct  419  SLYEGKWNKSVDPVFQELLY  438


 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K+Y+DCTG SF+DF+AG+L  +PGE PTLNDWENHLTTIFP     +   + G   G W+
Sbjct  260  KRYVDCTGQSFKDFLAGRLSNLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWK  319

Query  672  TLAAI  658
             L A+
Sbjct  320  RLCAL  324



>ref|NP_001059579.2| Os07g0462000 [Oryza sativa Japonica Group]
 dbj|BAF21493.2| Os07g0462000, partial [Oryza sativa Japonica Group]
Length=137

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  716  VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVP  537
            VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR KVP
Sbjct  1    VRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVP  60

Query  536  KSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLELY  357
             +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL LY
Sbjct  61   VTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLLNLY  120

Query  356  HGKWGQNVDPVFEELLY  306
              KW ++VDPVF+ELLY
Sbjct  121  ETKWQRSVDPVFQELLY  137



>dbj|BAJ21770.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
Length=502

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK++LEMRGADGGPWR+LCALPAFWVGLLYD+ SL+  L++  DWT  ER MLR 
Sbjct  363  FPEVRLKKFLEMRGADGGPWRKLCALPAFWVGLLYDETSLEGALEIIKDWTQEERLMLRR  422

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP  GL TPFRDGLL+HVAQDV+ LAK GL+RRGYKE GFL+ + EVVNTG+TPAEKLL
Sbjct  423  KVPSLGLKTPFRDGLLRHVAQDVMKLAKEGLQRRGYKEAGFLSEIVEVVNTGITPAEKLL  482

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E Y G W +NVDPV+EELLY
Sbjct  483  EKYKGDWKENVDPVYEELLY  502


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKY+DC+GMSFRDFM GKLP +PG+  T+NDWENHLTTIFP     K   + G   G WR
Sbjct  324  KKYVDCSGMSFRDFMVGKLPNLPGDKATINDWENHLTTIFPEVRLKKFLEMRGADGGPWR  383

Query  672  TLAAI  658
             L A+
Sbjct  384  KLCAL  388



>ref|XP_001785532.1| predicted protein [Physcomitrella patens]
 gb|EDQ49666.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFW GLLYDD SLQ   D+  DWT  ER MLRN
Sbjct  345  FPEVRLKRYLEMRGADGGPWRRLCALPAFWTGLLYDDESLQGAFDIINDWTEKERAMLRN  404

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVPK GLN PFRDGLLKHVAQD+  LAK GL RRG  E GFL  + E+V TG TPAE+LL
Sbjct  405  KVPKEGLNVPFRDGLLKHVAQDIFKLAKDGLTRRGLNEAGFLKDIEEIVQTGKTPAERLL  464

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LYH KW +NVD VFEELLY
Sbjct  465  DLYHEKWNRNVDTVFEELLY  484


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +Y+DC+G+SF+DF+ GKL  +PGE PTL+DWENHLTTIFP     +   + G   G WR 
Sbjct  307  RYVDCSGLSFKDFLEGKLSVLPGERPTLSDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  366

Query  669  LAAI  658
            L A+
Sbjct  367  LCAL  370



>ref|XP_009362009.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=262

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -2

Query  788  CLLFLENIPHLMTGRTI*QQYFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDIS  609
            C +  E IP +   +      +PEVRL++YLEMRGA  GPW+  C LPAFW GLLYD++S
Sbjct  102  CCIPGEVIPTISDWKMHLGTIYPEVRLRKYLEMRGAGSGPWKTFCGLPAFWTGLLYDEVS  161

Query  608  LQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKET  429
            LQ+VLDM ADWT  ER+ LR+KVPK+GL TPFR GLL+HVA++V+  AK GLERRG  E+
Sbjct  162  LQNVLDMIADWTTEERQTLRDKVPKTGLKTPFRGGLLQHVAENVVKFAKDGLERRGVNES  221

Query  428  GFLNAVAEVVNTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
            GFL+ V EV  TGV PAEKLL+LY+G+WGQN+DPVFEEL Y
Sbjct  222  GFLDGVVEVARTGVAPAEKLLQLYYGEWGQNIDPVFEELRY  262


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEY-PTLNDWENHLTTIFPRGET*K---VPGNARGRW  676
            K Y DCT M+FR+FMAGK   IPGE  PT++DW+ HL TI+P     K   + G   G W
Sbjct  83   KNYFDCTDMTFREFMAGKRCCIPGEVIPTISDWKMHLGTIYPEVRLRKYLEMRGAGSGPW  142

Query  675  RTLAAI  658
            +T   +
Sbjct  143  KTFCGL  148



>ref|XP_008655177.1| PREDICTED: uncharacterized protein LOC100381846 isoform X1 [Zea 
mays]
 gb|AFW82737.1| hypothetical protein ZEAMMB73_015174 [Zea mays]
Length=500

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMT DWT  EREMLR+
Sbjct  361  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTQEEREMLRH  420

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A++VL LAK GLERRGYKE GFL  V EVV TGVTPAE+LL
Sbjct  421  KVPLTGLKTPFRDGYVRDLAEEVLKLAKNGLERRGYKEVGFLREVDEVVRTGVTPAERLL  480

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW +NVD VFE LLY
Sbjct  481  HLYETKWQRNVDHVFEHLLY  500


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGMSFRDFM GKL   PGE PTLNDWENHLTTIFP     +   + G   G WR 
Sbjct  323  KYIDCTGMSFRDFMQGKLRQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  382

Query  669  LAAI  658
            L A+
Sbjct  383  LCAL  386



>ref|XP_002867731.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43990.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   214 bits (546),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLKRYLEMRGADGGP   LCALPAFWVGLLYD+ SLQ+VLDM  DWT  EREMLR 
Sbjct  351  YPEVRLKRYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQAVLDMIYDWTPEEREMLRT  410

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VP +GL T FRD  L+HVA+D+L LAK GLERRGY ETGFLNAV EVV TGVTPAEKLL
Sbjct  411  QVPITGLKTMFRDIPLRHVAEDLLKLAKDGLERRGYNETGFLNAVTEVVKTGVTPAEKLL  470

Query  365  ELYHGKWGQNVDPVFEELLY  306
            +LY+G+WGQN+D VF+ L Y
Sbjct  471  KLYNGEWGQNIDHVFQGLRY  490


 Score = 61.6 bits (148),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + Y+DC GM+FRDFM+GK+  +  E PT+NDWE HL TI+P
Sbjct  312  ESYLDCKGMTFRDFMSGKISHLSDEQPTINDWEIHLGTIYP  352



>ref|XP_008648285.1| PREDICTED: gamma-glutamylcysteine synthetase1 isoform X1 [Zea 
mays]
 gb|AFW74704.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=503

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMT DWT  EREMLR 
Sbjct  364  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRR  423

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A++VL LAK GLERRGYKE GFL  V EVV TGVTPAE+LL
Sbjct  424  KVPSTGLKTPFRDGYVRDLAEEVLKLAKNGLERRGYKEVGFLREVDEVVRTGVTPAERLL  483

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW +NVD VFE LLY
Sbjct  484  NLYETKWQRNVDHVFEHLLY  503


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  325  KKYIDCTGMSFRDFMQGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  384

Query  672  TLAAI  658
             L A+
Sbjct  385  RLCAL  389



>ref|XP_004960382.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=498

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMT DWT  EREMLR 
Sbjct  359  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRR  418

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +G  TPFRDG ++H+A++VL LAK GLERRGYKE GFL  V +VV+TGVTPAE+LL
Sbjct  419  KVPVTGFKTPFRDGYVRHLAEEVLTLAKNGLERRGYKEVGFLREVEQVVSTGVTPAERLL  478

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW +NVD VF+ LLY
Sbjct  479  NLYETKWQRNVDHVFQHLLY  498


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  320  KKYIDCTGMSFRDFMQGKLPQVPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  379

Query  672  TLAAI  658
             L A+
Sbjct  380  RLCAL  384



>ref|XP_009137312.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
 ref|XP_009137313.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=491

 Score =   215 bits (547),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKRYLEMRGADGG    LCALPAFWVGLLYD+  LQ+VLDM ADWT  EREMLR +
Sbjct  353  PEVRLKRYLEMRGADGGSREMLCALPAFWVGLLYDEECLQAVLDMIADWTTEEREMLRTQ  412

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP + L T FRDG LKHVA+DVL LAK GLERR YKETGFL+AVAEV  TGVTPAEKLL+
Sbjct  413  VPVTALKTMFRDGPLKHVAEDVLKLAKDGLERRNYKETGFLDAVAEVAITGVTPAEKLLK  472

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQ+VDP+F E+ Y
Sbjct  473  LYNGDWGQSVDPLFHEMQY  491


 Score = 60.5 bits (145),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDF++GK   +  E PT+NDWENH+ TI+P
Sbjct  313  KSYLNCRGMTFRDFLSGKTSHLSHEQPTINDWENHIGTIWP  353



>ref|XP_010435330.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010435331.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=492

 Score =   216 bits (550),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLK++LEMRGADGGPW  LCALPAFWVGLLYD+ SLQ+VLDM  DW + EREMLR  
Sbjct  354  PEVRLKKFLEMRGADGGPWPMLCALPAFWVGLLYDEKSLQTVLDMIVDWNLEEREMLRTH  413

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FR G LKHVA+DVL LA  GLERRGY ETGFLN +AEVV TGVTPA KLL+
Sbjct  414  VPIAGLKTMFRGGPLKHVAEDVLKLAMDGLERRGYNETGFLNPIAEVVRTGVTPAHKLLD  473

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G+WGQN+D VFEEL Y
Sbjct  474  LYNGEWGQNIDHVFEELRY  492


 Score = 58.9 bits (141),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            K Y++C GM+FRDF++GK+  +  E PT+NDWE HL TI+P 
Sbjct  314  KSYLNCRGMTFRDFLSGKISHLSNEQPTINDWEIHLGTIWPE  355



>gb|KFK30813.1| hypothetical protein AALP_AA6G029500 [Arabis alpina]
Length=479

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLK++LEMRGADGGPW+ LCALPAFWVGLLYD+ SLQ+VLDMT+DWT  EREMLR +
Sbjct  341  PEVRLKKFLEMRGADGGPWKMLCALPAFWVGLLYDEESLQTVLDMTSDWTAEEREMLRRQ  400

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FR GLLKHVA+DV+ LA  GLERRGYKETGFL  VAEV  TG+TPAEKLLE
Sbjct  401  VPITGLKTVFRGGLLKHVAEDVVKLANDGLERRGYKETGFLKGVAEVAKTGITPAEKLLE  460

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQ++D V+EEL Y
Sbjct  461  LYNGVWGQSIDHVYEELQY  479


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +Y+DC GM+FRDF++GK+  +  E PT+NDWENH+ TI+P     K   + G   G W+ 
Sbjct  302  RYLDCRGMTFRDFLSGKISHLSNEQPTINDWENHMGTIWPEVRLKKFLEMRGADGGPWKM  361

Query  669  LAAI  658
            L A+
Sbjct  362  LCAL  365



>emb|CDX94156.1| BnaC07g37900D [Brassica napus]
Length=491

 Score =   214 bits (545),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKRYLEMRGADGG    LCALPAFWVGLLYDD SLQ+VLDM ADWT  EREMLR +
Sbjct  353  PEVRLKRYLEMRGADGGSREILCALPAFWVGLLYDDESLQTVLDMIADWTTEEREMLRTQ  412

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRDG LKHVA+DVL  AK GLERR YKETGFL+ V EV  TGVTPAEKLL+
Sbjct  413  VPVTGLKTMFRDGPLKHVAEDVLKQAKDGLERRNYKETGFLDVVTEVAITGVTPAEKLLK  472

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQ+VDP+F E+ Y
Sbjct  473  LYNGDWGQSVDPLFHEMQY  491


 Score = 60.5 bits (145),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDF++GK   +  E PT+NDWENH+ TI+P
Sbjct  313  KSYLNCRGMTFRDFLSGKTSHLSHEQPTINDWENHIGTIWP  353



>ref|XP_006654002.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Oryza 
brachyantha]
Length=438

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  299  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRQ  358

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A++VL L+K GLERRGYKE GFL  V  VV++GVTPAE+LL
Sbjct  359  KVPVTGLKTPFRDGYVRDLAEEVLQLSKNGLERRGYKEVGFLREVDAVVSSGVTPAERLL  418

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW  +VDPVF+ELLY
Sbjct  419  NLYETKWQHSVDPVFQELLY  438


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  260  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  319

Query  672  TLAAI  658
             L A+
Sbjct  320  RLCAL  324



>ref|XP_002439220.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
 gb|EES17650.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
Length=501

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS++DMT DWT  EREMLR 
Sbjct  362  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSIIDMTFDWTKEEREMLRR  421

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A++VL LAK GLERRGYKE GFL  V EVV TGVTPAE+LL
Sbjct  422  KVPVTGLKTPFRDGYVRDLAEEVLKLAKSGLERRGYKEVGFLREVDEVVRTGVTPAERLL  481

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW +NVD VFE LLY
Sbjct  482  NLYETKWQRNVDHVFEHLLY  501


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  323  KKYIDCTGMSFRDFMQGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  382

Query  672  TLAAI  658
             L A+
Sbjct  383  RLCAL  387



>ref|NP_001105142.1| gamma-glutamylcysteine synthetase1 [Zea mays]
 emb|CAC83005.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=438

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+LDMT DWT  EREMLR 
Sbjct  299  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSILDMTFDWTKEEREMLRR  358

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A++VL LAK GLERRGYKE GFL  V EVV TGVTPAE+LL
Sbjct  359  KVPSTGLKTPFRDGYVRDLAEEVLKLAKNGLERRGYKEVGFLREVDEVVRTGVTPAERLL  418

Query  365  ELYHGKWGQNVDPVFEELLY  306
              Y  KW +NVD VFE LLY
Sbjct  419  SPYETKWQRNVDHVFEHLLY  438


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 45/65 (69%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTL DWENHLTTIFP     +   + G   G WR
Sbjct  260  KKYIDCTGMSFRDFMQGKLPQAPGELPTLTDWENHLTTIFPEVRLKRYLEMRGADGGPWR  319

Query  672  TLAAI  658
             L A+
Sbjct  320  RLCAL  324



>ref|XP_002875199.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51458.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   218 bits (555),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLKRYLEMRGADGGP   LCALPAFWVGLLYD+ SLQ+VLDM  DWT  EREMLR 
Sbjct  309  YPEVRLKRYLEMRGADGGPLDMLCALPAFWVGLLYDEDSLQTVLDMIDDWTTEEREMLRT  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VP +GL T FRD  LKHVA+DVL LAK GLERRGY ETGFL A+AEVV TGVTPAEKLL
Sbjct  369  QVPITGLKTMFRDRPLKHVAEDVLKLAKDGLERRGYNETGFLKALAEVVRTGVTPAEKLL  428

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+G WGQN+D VF+ L Y
Sbjct  429  ELYNGDWGQNIDSVFQGLRY  448


 Score = 55.8 bits (133),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + Y+DC GM+FRDFM+GK+  +  E P + DWE HL  I+P
Sbjct  270  ESYLDCGGMTFRDFMSGKISHLSNEQPNIKDWELHLGAIYP  310



>emb|CAD48598.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=438

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  299  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  358

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  359  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  418

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  419  NLYETKWQRSVDPVFQELLY  438


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  260  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  319

Query  672  TLAAI  658
             L A+
Sbjct  320  RLCAL  324



>emb|CDY63259.1| BnaA03g58670D [Brassica napus]
Length=491

 Score =   212 bits (540),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKRYLEMRGADGG    LCALPAFWVGLLYDD SL++VLDM ADWT  EREML  +
Sbjct  353  PEVRLKRYLEMRGADGGSREMLCALPAFWVGLLYDDESLRTVLDMIADWTTEEREMLMTQ  412

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+DVL LAK GLERR YKETGFL+AV EV  TGVTPAEKLL+
Sbjct  413  VPVTGLKTMFRDVTLKHVAEDVLKLAKDGLERRNYKETGFLDAVTEVAITGVTPAEKLLK  472

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQ+VDP+F E+ Y
Sbjct  473  LYNGDWGQSVDPLFHEMQY  491


 Score = 60.5 bits (145),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDF++GK   +  E PT+NDWENH+ TI+P
Sbjct  313  KSYLNCRGMTFRDFLSGKTSHLSHEQPTINDWENHIGTIWP  353



>sp|Q6Z3A3.1|GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAC84166.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=496

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  357  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  416

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  417  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  476

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  477  NLYETKWQRSVDPVFQELLY  496


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  318  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  377

Query  672  TLAAI  658
             L A+
Sbjct  378  RLCAL  382



>emb|CAD48599.3| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=492

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  353  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  412

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  413  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  472

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  473  NLYETKWQRSVDPVFQELLY  492


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  314  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  373

Query  672  TLAAI  658
             L A+
Sbjct  374  RLCAL  378



>sp|Q8GU95.2|GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EEC78447.1| hypothetical protein OsI_18304 [Oryza sativa Indica Group]
Length=492

 Score =   219 bits (558),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  353  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  412

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  413  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  472

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  473  NLYETKWQRSVDPVFQELLY  492


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  314  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  373

Query  672  TLAAI  658
             L A+
Sbjct  374  RLCAL  378



>ref|XP_010440632.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010440634.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=492

 Score =   212 bits (540),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKR+LEMRGADGGPW  LCALPAFWVGLLYD+ SLQ+VLDM  DW + EREMLR +
Sbjct  354  PEVRLKRFLEMRGADGGPWPMLCALPAFWVGLLYDEKSLQTVLDMIVDWNLEEREMLRIQ  413

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FR G LK VA+DVL LA  GLERRGY ETGFLN + EVV TGVTPA KLL+
Sbjct  414  VPITGLKTMFRGGPLKDVAEDVLKLAMDGLERRGYNETGFLNPIVEVVKTGVTPANKLLD  473

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G+WGQN+D VFEEL Y
Sbjct  474  LYNGEWGQNIDHVFEELRY  492


 Score = 59.3 bits (142),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            K Y++C GM+FRDF++GK+  +  E PT+NDWE HL TI+P 
Sbjct  314  KSYLNCRGMTFRDFLSGKISHLSNEQPTINDWEIHLGTIWPE  355



>gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
Length=1281

 Score =   228 bits (580),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725   FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
             FPEVRLKRYLEMRGADGGPWRRLCALP FWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  1142  FPEVRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  1201

Query  545   KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
             KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  1202  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  1261

Query  365   ELYHGKWGQNVDPVFEELLY  306
              LY  KW ++VDPVF+ELLY
Sbjct  1262  NLYETKWQRSVDPVFQELLY  1281


 Score = 91.3 bits (225),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843   KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
             KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  1103  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  1162

Query  672   TLAAI  658
              L A+
Sbjct  1163  RLCAL  1167



>gb|EMS60294.1| Glutamate--cysteine ligase B, chloroplastic [Triticum urartu]
Length=426

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 121/164 (74%), Gaps = 24/164 (15%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWV------------------------GLLYD  618
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWV                        GLLYD
Sbjct  263  FPEVRLKRYMEMRGADGGPWRRLCALPAFWVCLLTLPAFVMYIYRVSFTAQTWAVGLLYD  322

Query  617  DISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGY  438
            D SLQS++DMT+DWT  EREMLR KVP +GL TPFRDG ++ +A+DVL LAK GLERRGY
Sbjct  323  DESLQSIIDMTSDWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGY  382

Query  437  KETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
            KE GFL  V EVV TGVTPAEKLL LY  KW ++VDPVFEELLY
Sbjct  383  KEVGFLREVDEVVRTGVTPAEKLLNLYETKWQRSVDPVFEELLY  426


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K YIDCTGMSFRDFMAGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  224  KTYIDCTGMSFRDFMAGKLPQVPGELPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWR  283

Query  672  TLAAI  658
             L A+
Sbjct  284  RLCAL  288



>gb|ACV71026.1| gamma-glutamylcysteine synthetase [Agropyron cristatum]
Length=215

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYDD SLQS++DMTADWT  EREMLR 
Sbjct  88   FPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDDESLQSIIDMTADWTKEEREMLRR  147

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+DVL LAK GLERRGYKE GFL  V EVV TGVTPAEKLL
Sbjct  148  KVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERRGYKEVGFLREVDEVVRTGVTPAEKLL  207

Query  365  ELYHGKW  345
             LY  KW
Sbjct  208  NLYEMKW  214


 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K YIDCTGMSFRDFMAGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  49   KNYIDCTGMSFRDFMAGKLPQVPGELPTLNDWENHLTTIFPEVRLKRYMEMRGADGGPWR  108

Query  672  TLAAI  658
             L A+
Sbjct  109  RLCAL  113



>gb|EEE67118.1| hypothetical protein OsJ_24143 [Oryza sativa Japonica Group]
Length=579

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  440  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  499

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  500  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  559

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  560  NLYETKWQRSVDPVFQELLY  579


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  401  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  460

Query  672  TLAAI  658
             L A+
Sbjct  461  RLCAL  465



>ref|NP_001054541.1| Os05g0129000 [Oryza sativa Japonica Group]
 sp|Q688Q9.1|GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAU10747.1| putative gamma-glutamylcysteine synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF16455.1| Os05g0129000 [Oryza sativa Japonica Group]
 dbj|BAG96011.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALP FWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  353  FPEVRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  412

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE GFL  V  V+++GVTPAE+LL
Sbjct  413  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLL  472

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  473  NLYETKWQRSVDPVFQELLY  492


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  314  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  373

Query  672  TLAAI  658
             L A+
Sbjct  374  RLCAL  378



>sp|A2YL07.2|GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Indica Group]
Length=496

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  357  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  416

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE  FL  V  V+++GVTPAE+LL
Sbjct  417  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVSFLREVDAVISSGVTPAERLL  476

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  477  NLYETKWQRSVDPVFQELLY  496


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  318  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  377

Query  672  TLAAI  658
             L A+
Sbjct  378  RLCAL  382



>ref|XP_003611086.1| Glutamate-cysteine ligase [Medicago truncatula]
 gb|AES94044.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=512

 Score =   194 bits (492),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+Y+EMRGADGGP   LCALPAFWVGLLYD++SL +VLDM ADWT  +++ LRN
Sbjct  373  FPEVRLKKYMEMRGADGGPLNMLCALPAFWVGLLYDEVSLHNVLDMIADWTDEDKQYLRN  432

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VP +GL TPF+  LL+HVA+DVL  AK GL+RR   E+ FL+ + EVV TG+TPAEKLL
Sbjct  433  QVPFTGLKTPFQGRLLQHVAEDVLKWAKDGLDRRCLNESIFLDPLIEVVGTGMTPAEKLL  492

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+ KWG N+D VF E  Y
Sbjct  493  EMYNNKWGSNIDSVFRECCY  512


 Score = 73.6 bits (179),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYI C GMSFRDFMAGKLP I G+ PT++DWENHLTTIFP
Sbjct  335  KYIPCGGMSFRDFMAGKLPAIRGQVPTISDWENHLTTIFP  374



>ref|XP_003516702.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006573776.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN25701.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=506

 Score =   187 bits (474),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGAD GP   LCALPAFWVGLLYD++SLQ+VLDM ADWT  + + LRN
Sbjct  367  FPEVRLKRYMEMRGADDGPLEMLCALPAFWVGLLYDEVSLQNVLDMIADWTPEDIQNLRN  426

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TP +  LL+H+A+D L  AK GL+RR   E+ FL+ + EVV TG+T A+KLL
Sbjct  427  KVPITGLTTPVQGRLLQHIAEDTLKWAKDGLDRRCLNESVFLDPLKEVVGTGLTQADKLL  486

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+ KWG N+DPVF E  Y
Sbjct  487  EMYNNKWGNNIDPVFRERCY  506


 Score = 80.1 bits (196),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYIDC GMSFRDFMAGKLP IPG+ PTL DWENHLTTIFP
Sbjct  329  KYIDCRGMSFRDFMAGKLPVIPGQVPTLGDWENHLTTIFP  368



>ref|XP_008375303.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=488

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = -2

Query  788  CLLFLENIPHLMTGRTI*QQYFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDIS  609
            C +  E IP +          +PEVRL++YLEMRGA  GPW+  C LPAFW GLLYD++S
Sbjct  328  CCIPGEVIPTISDWEMHLGTIYPEVRLRKYLEMRGAGSGPWKTFCGLPAFWTGLLYDEVS  387

Query  608  LQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKET  429
            LQ+VLDM ADWT  ER+MLR+KVPK+GL TPFR  LL+HVA++V+  AK GLERRG  E+
Sbjct  388  LQNVLDMIADWTXEERQMLRDKVPKTGLKTPFRGELLQHVAENVVKFAKDGLERRGLNES  447

Query  428  GFLNAVAEVVNTGVTPAEKLLELYHGKWGQNVDPVFEELLY  306
            GFL+ V EV  TGV PAEKLL+LY+G+WGQN+DPVFEEL Y
Sbjct  448  GFLDGVVEVARTGVAPAEKLLQLYYGEWGQNIDPVFEELRY  488


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEY-PTLNDWENHLTTIFPRGET*K---VPGNARGRW  676
            K Y DCT M+FR+FMAGK   IPGE  PT++DWE HL TI+P     K   + G   G W
Sbjct  309  KNYFDCTDMTFREFMAGKRCCIPGEVIPTISDWEMHLGTIYPEVRLRKYLEMRGAGSGPW  368

Query  675  RTLAAI  658
            +T   +
Sbjct  369  KTFCGL  374



>gb|EEC81979.1| hypothetical protein OsI_25896 [Oryza sativa Indica Group]
Length=670

 Score =   218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+ SLQS+ DMT+DWT  EREMLR 
Sbjct  531  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRR  590

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL TPFRDG ++ +A+++L L+K GLERRGYKE  FL  V  V+++GVTPAE+LL
Sbjct  591  KVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVSFLREVDAVISSGVTPAERLL  650

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW ++VDPVF+ELLY
Sbjct  651  NLYETKWQRSVDPVFQELLY  670


 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTGMSFRDFM GKLP  PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  492  KKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  551

Query  672  TLAAI  658
             L A+
Sbjct  552  RLCAL  556



>ref|XP_010448777.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   206 bits (525),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            P+VRLK+YLEMRGADGGP   LCALPAFWVGLLYD+ SLQ+ L+M  DWT  E EMLR +
Sbjct  310  PDVRLKKYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQTTLNMIDDWTPEEIEMLRTQ  369

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+D+L LAK GL+RRGY ETGFLNAVAEVV TGVTPAEKLLE
Sbjct  370  VPITGLKTMFRDMPLKHVAEDILKLAKDGLDRRGYNETGFLNAVAEVVRTGVTPAEKLLE  429

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQN+D VF  L Y
Sbjct  430  LYNGDWGQNIDHVFRGLQY  448


 Score = 58.2 bits (139),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDFM+GK+  +  E PT++DWE H+ TI+P
Sbjct  270  KTYLNCRGMTFRDFMSGKISHLSKEQPTIDDWETHIGTIWP  310



>ref|XP_010439229.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010439230.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 132/196 (67%), Gaps = 17/196 (9%)
 Frame = -2

Query  842  RSILIVLECPSGILWRGNCLL---------FLE-NIPHLMTGRTI*QQY-------FPEV  714
            R +   L+CP   L R N  L         FL   I HL   +     +       +PEV
Sbjct  254  RYVEYALDCPMLFLIRNNNYLNCRGMTFRDFLSGKISHLSNEKPTIDDWETHIGSIWPEV  313

Query  713  RLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPK  534
            RLK+YLEMRGADGGP   LCALPAFWVGLLYD+ SLQ+ L+M  DWT  E EMLR +VP 
Sbjct  314  RLKKYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQTTLNMIDDWTPEELEMLRTQVPI  373

Query  533  SGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLELYH  354
            +GL T FRD  LKHVA+DVL LAK GLERRGY ET FLNAVAEVV TGVTPAEKLLELY+
Sbjct  374  TGLRTIFRDKPLKHVAEDVLKLAKDGLERRGYNETDFLNAVAEVVRTGVTPAEKLLELYN  433

Query  353  GKWGQNVDPVFEELLY  306
            G WGQNVD VF EL Y
Sbjct  434  GDWGQNVDHVFRELRY  449



>ref|XP_010448773.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010448774.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   208 bits (530),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLK+YLEMRGAD GP   LCALPAFWVGLLYD+ SLQ+ L+M  DWT  E EMLR +
Sbjct  311  PEVRLKKYLEMRGADVGPLGMLCALPAFWVGLLYDEDSLQTTLNMIDDWTPEELEMLRTQ  370

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA++VL LAK GLERRGY ETGFLNAVAEVV TGVTPAEKLLE
Sbjct  371  VPITGLKTMFRDKPLKHVAEEVLKLAKDGLERRGYNETGFLNAVAEVVRTGVTPAEKLLE  430

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQNVD VF EL Y
Sbjct  431  LYNGDWGQNVDHVFRELRY  449


 Score = 55.5 bits (132),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDF+ GK+  +  E PT++DWE H+ +I+P
Sbjct  271  KTYLNCKGMTFRDFLTGKISHLSNEKPTIDDWETHIGSIWP  311



>ref|XP_004511574.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=511

 Score =   190 bits (482),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGG    LCALPAFWVGLLYD++SL +VLDM  DW+  +R+ LRN
Sbjct  372  FPEVRLKRYMEMRGADGGSLNMLCALPAFWVGLLYDEVSLHNVLDMIGDWSTEDRQYLRN  431

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VP +GL TPF+  LL+HVA+DVL  AK GL+RR   E+ FL+ + EVV TG+TPA+KL+
Sbjct  432  QVPFTGLRTPFQGRLLQHVAEDVLKWAKDGLDRRCLNESVFLDPLMEVVETGMTPADKLV  491

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+ KWG N+D VF E  Y
Sbjct  492  EMYYSKWGNNIDHVFRECCY  511


 Score = 73.6 bits (179),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYI CTGMSFRDFMAGK+  I G+ PTL+DWENHLTTIFP
Sbjct  334  KYIACTGMSFRDFMAGKVSVIRGQMPTLSDWENHLTTIFP  373



>ref|XP_007158499.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
 gb|ESW30493.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
Length=493

 Score =   183 bits (464),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGAD GP   +CA+PAFWVGLLYD++SLQ+VLDM ADWT  + + LRN
Sbjct  354  FPEVRLKRYMEMRGADNGPLHMICAVPAFWVGLLYDEVSLQNVLDMIADWTTEDLQNLRN  413

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
             VP +GL T  +  LL+H+A+DVL  AK GL+RRG  E+ FL+ + EVV TG T A+KLL
Sbjct  414  MVPITGLRTSIQGRLLRHIAEDVLKWAKEGLDRRGLNESVFLDPLKEVVFTGFTQADKLL  473

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELYH  WG+N+D VF E  Y
Sbjct  474  ELYHSNWGKNIDHVFRECCY  493


 Score = 77.8 bits (190),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYIDC  MSFRDFMAGKLP IPG+ PTL DWENHLTTIFP
Sbjct  316  KYIDCRDMSFRDFMAGKLPAIPGQVPTLADWENHLTTIFP  355



>ref|XP_010439234.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=448

 Score =   204 bits (519),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            P+VRLK+YLEMRGADGGP   LCALPAFWVGLLYD+ SLQ+ L+M  DWT  E EMLR +
Sbjct  310  PDVRLKKYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQTTLNMIDDWTPEEIEMLRRQ  369

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+D+L LAK GL+RRGY ETGFLNAVA VV TGVTPAEKLLE
Sbjct  370  VPITGLKTMFRDMPLKHVAEDILKLAKDGLDRRGYNETGFLNAVAAVVRTGVTPAEKLLE  429

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G+WGQN+D VF  L Y
Sbjct  430  LYNGEWGQNIDHVFRGLQY  448


 Score = 56.2 bits (134),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDF++GK+  +  E PT++DWE H+ TI+P
Sbjct  270  KIYLNCGGMTFRDFLSGKISHLSNEQPTIDDWETHIGTIWP  310



>ref|XP_010439231.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439232.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439233.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=448

 Score =   202 bits (513),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            P+VRLK+YLEMRGADGGP   LCALPAFWVGLLYD+ SLQ+ L+M  DWT  E EMLR +
Sbjct  310  PDVRLKKYLEMRGADGGPLGMLCALPAFWVGLLYDEDSLQTTLNMIDDWTPEEIEMLRRQ  369

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+D+L LAK GL+RRGY ETGFLNAVA VV TGVTPAEKLLE
Sbjct  370  VPITGLKTMFRDMPLKHVAEDILKLAKDGLDRRGYNETGFLNAVAAVVRTGVTPAEKLLE  429

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WG+N+D VF  L Y
Sbjct  430  LYNGDWGKNIDHVFRGLQY  448


 Score = 56.2 bits (134),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K Y++C GM+FRDF++GK+  +  E PT++DWE H+ TI+P
Sbjct  270  KIYLNCGGMTFRDFLSGKISHLSNEQPTIDDWETHIGTIWP  310



>ref|XP_010433942.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=447

 Score =   206 bits (523),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKRYLEMRGAD GP   L ALPAFWVGLLYD+ SLQ+ L+M  DWT+ E EMLR +
Sbjct  309  PEVRLKRYLEMRGADVGPLGMLYALPAFWVGLLYDENSLQTTLNMIDDWTLEELEMLRTQ  368

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+DVL LAK GLERRGY ETG+L+AVAEVV TGVTPAEKLLE
Sbjct  369  VPITGLKTMFRDKPLKHVAEDVLKLAKDGLERRGYNETGYLDAVAEVVRTGVTPAEKLLE  428

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G+WGQNVD VF EL Y
Sbjct  429  LYNGEWGQNVDHVFRELQY  447


 Score = 52.8 bits (125),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            K Y++C GM+FR+F++GK   +  E PT++DWE H+ TI+P 
Sbjct  269  KIYLNCGGMTFREFLSGKNSHLSNEQPTIDDWETHIGTIWPE  310



>ref|XP_004971557.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=489

 Score =   188 bits (477),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLKR++EMRGADGGP   LCALPAFWVGLLYD+ SL+ + DM ADWT  ER+MLR 
Sbjct  350  YPEVRLKRFIEMRGADGGPLCTLCALPAFWVGLLYDEESLRCITDMIADWTNEERDMLRI  409

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            KVP +GL T FR G ++ +A++++ LAK GL+RRG+ E GFLN V E+V TGVT AEKL 
Sbjct  410  KVPITGLKTQFRGGYVRDLAENIVKLAKDGLQRRGHMEVGFLNEVDEIVGTGVTQAEKLA  469

Query  365  ELYHGKWGQNVDPVFEELLY  306
             LY  KW  NVDPVF E +Y
Sbjct  470  NLYMAKWQHNVDPVFREFIY  489


 Score = 70.1 bits (170),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  834  IDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +DCTGMSFRDFMAGKLP +PGE PTL DWE HL +I+P
Sbjct  314  VDCTGMSFRDFMAGKLPQLPGERPTLKDWEIHLGSIYP  351



>ref|XP_006283598.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
 gb|EOA16496.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
Length=495

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKR+LEMRGAD G W  LCALPAFWVGLLYD+ SLQ+VLDM ADW + EREMLR +
Sbjct  357  PEVRLKRFLEMRGADTGSWPMLCALPAFWVGLLYDENSLQTVLDMIADWNLEEREMLRTQ  416

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FR G L+HVA+DVL LA  GLERRGY ET FLN VAEVV TG T A KLLE
Sbjct  417  VPVTGLQTMFRGGSLQHVAEDVLKLAVDGLERRGYNETSFLNPVAEVVRTGTTQAHKLLE  476

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQN+D VF+EL Y
Sbjct  477  LYNGDWGQNIDHVFKELRY  495


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            K Y++C G++FRDF++GK+  +  E PT++DWE H+ TI+P     +   + G   G W 
Sbjct  317  KGYVNCRGITFRDFLSGKMSHLSNEQPTISDWEIHIGTIWPEVRLKRFLEMRGADTGSWP  376

Query  672  TLAAI  658
             L A+
Sbjct  377  MLCAL  381



>ref|XP_010439235.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=448

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKRYLEMRGADGGP   L ALPAFWVGLLYD+ SLQ+ L+M  DWT+ E EMLR +
Sbjct  310  PEVRLKRYLEMRGADGGPLGMLYALPAFWVGLLYDEDSLQTTLNMIDDWTLEELEMLRTQ  369

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+DVL LAK GLERRGY ETG+L+AVAEVV TGVTPAEKLLE
Sbjct  370  VPITGLKTMFRDKPLKHVAEDVLKLAKDGLERRGYNETGYLDAVAEVVRTGVTPAEKLLE  429

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G+WGQN+D VF  L Y
Sbjct  430  LYNGEWGQNIDHVFRGLQY  448



>ref|XP_010448775.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKRYLEMRGADGGP   L ALPAFWVGLLYD+ SLQ+ L+M  DWT+ E EMLR +
Sbjct  310  PEVRLKRYLEMRGADGGPLGMLNALPAFWVGLLYDEDSLQTTLNMIDDWTLEELEMLRTQ  369

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRD  LKHVA+DVL LAK GL+RRGY ET +L+AVAEVV TGVTPAEKLLE
Sbjct  370  VPITGLKTMFRDKPLKHVAEDVLKLAKDGLKRRGYNETSYLDAVAEVVRTGVTPAEKLLE  429

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQN+D VF EL Y
Sbjct  430  LYNGDWGQNIDHVFRELQY  448



>ref|XP_003611085.1| Glutamate-cysteine ligase [Medicago truncatula]
Length=207

 Score =   184 bits (466),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRL+RY+EMRGAD  P   LCA PAFWVGLLYD++SL +VLDM ADWT  +R+ LRN
Sbjct  68   YPEVRLRRYMEMRGADVVPQSMLCAPPAFWVGLLYDEVSLHNVLDMIADWTTEDRQYLRN  127

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VP +GL T F+  LL+HVA+DVL  AK GLERR   E+ FL+ + EVV TG+TPA+KLL
Sbjct  128  QVPFTGLKTLFQGRLLQHVAEDVLKWAKAGLERRCLNESIFLDPLIEVVGTGMTPADKLL  187

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E+Y+ KWG N+DPVF E  Y
Sbjct  188  EMYNKKWGSNIDPVFRECCY  207


 Score = 69.7 bits (169),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YI C GMSFRDFMAGKLP   G+ PTL DWENHL+TI+P
Sbjct  30   RYIACGGMSFRDFMAGKLPAFQGQLPTLRDWENHLSTIYP  69



>gb|KFK30815.1| hypothetical protein AALP_AA6G029800 [Arabis alpina]
Length=349

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  722  PEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNK  543
            PEVRLKR LEMRGAD GP + L ALPA WV LLYD+ SLQ++LDM +DWT  EREMLR  
Sbjct  211  PEVRLKRCLEMRGADAGPLKMLSALPALWVDLLYDEGSLQTILDMISDWTTEEREMLRTH  270

Query  542  VPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            VP +GL T FRDG LKHVA+DV+ LAK G ERRGY+E GFL  + EVV  GVTPAEKLLE
Sbjct  271  VPVTGLKTMFRDGPLKHVAEDVIKLAKDGFERRGYREIGFLEPLVEVVRIGVTPAEKLLE  330

Query  362  LYHGKWGQNVDPVFEELLY  306
            LY+G WGQ++DP+F++L Y
Sbjct  331  LYNGDWGQSIDPLFQKLKY  349



>ref|XP_010540840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=508

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPA WVGLLYD+ SLQSVLDMTADWT  EREMLR 
Sbjct  385  FPEVRLKRYLEMRGADGGPWRRLCALPALWVGLLYDEESLQSVLDMTADWTPEEREMLRK  444

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTG  390
            KVP +GL TPFRDG LKHV +DVL LAK GLERRGYKETGFLNAVAEVV TG
Sbjct  445  KVPVTGLKTPFRDGRLKHVTEDVLKLAKDGLERRGYKETGFLNAVAEVVQTG  496


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWR  673
            KKYIDCTG +FRDF+AGKLP +PGE PTLNDWENHLTTIFP     +   + G   G WR
Sbjct  346  KKYIDCTGSTFRDFVAGKLPRLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWR  405

Query  672  TLAAI  658
             L A+
Sbjct  406  RLCAL  410



>emb|CAA82626.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=533

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDD SLQ++LD+TADWT  EREMLRN
Sbjct  383  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRN  442

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEV  402
            KVP +GL TPFRDGLLKHVA+DVL LAK GLERRGYKE GFLNAV EV
Sbjct  443  KVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEV  490


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            KYIDCTGM+FR F+AGKLP +PGE P+ NDWENHLTTIFP     +   + G   G WR 
Sbjct  345  KYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRR  404

Query  669  LAAI  658
            L A+
Sbjct  405  LCAL  408



>gb|ADR66071.1| gamma-glutamylcysteine synthetase, partial [Aster amellus]
Length=103

 Score =   184 bits (467),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDDI+LQSVLDMTADWT  EREMLRNKVP SGL TPFRDGLLKHVA++VL  
Sbjct  1    PAFWVGILYDDIALQSVLDMTADWTQAEREMLRNKVPVSGLKTPFRDGLLKHVAEEVLTF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQ  339
            AK GLERRGYKETGFLN VAEVV TG+TPAEKLL+LYHGKWGQ
Sbjct  61   AKDGLERRGYKETGFLNEVAEVVRTGLTPAEKLLDLYHGKWGQ  103



>ref|XP_002974231.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
 gb|EFJ24453.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
Length=455

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLK+YLEMRGAD GPW+RLCALPA WVGLLYD+ +L+S   +  DW+  ER MLR 
Sbjct  316  YPEVRLKKYLEMRGADEGPWKRLCALPALWVGLLYDEEALESAYQLIEDWSRAERAMLRR  375

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            + PK GL T FR+G LK VAQ+VL LAK GLERRGY E  FL  VAE+V TGVTPAE+LL
Sbjct  376  EAPKLGLKTRFRNGTLKDVAQEVLELAKEGLERRGYNEVKFLEGVAEIVETGVTPAERLL  435

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW + VDP+F  L Y
Sbjct  436  ELYNGKWNKCVDPMFHALEY  455


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            K++DCTG SF+DF+ G+LP +PGE PTL+DWENH+ TI+P     K   + G   G W+ 
Sbjct  278  KHVDCTGRSFKDFLLGRLPELPGELPTLSDWENHINTIYPEVRLKKYLEMRGADEGPWKR  337

Query  669  LAAI  658
            L A+
Sbjct  338  LCAL  341



>ref|XP_002985600.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
 gb|EFJ13178.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
Length=455

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLK+YLEMRGAD GPW+RLCALPA WVGLLYD+ +L+S   +  DW+  ER MLR 
Sbjct  316  YPEVRLKKYLEMRGADEGPWKRLCALPALWVGLLYDEEALESAYQLIKDWSRAERAMLRR  375

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            + PK GL T FR+G LK VAQ+VL LAK GLERRGY E  FL  VAE+V TGVTPAE+LL
Sbjct  376  EAPKLGLKTRFRNGTLKDVAQEVLKLAKEGLERRGYNEVKFLEGVAEIVETGVTPAERLL  435

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY+GKW + VDP+F  L Y
Sbjct  436  ELYNGKWDKCVDPMFHVLEY  455


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            K++DCTG SF+DF+ G+LP +PGE PTL+DWENH+ TI+P     K   + G   G W+ 
Sbjct  278  KHVDCTGRSFKDFLLGRLPELPGELPTLSDWENHINTIYPEVRLKKYLEMRGADEGPWKR  337

Query  669  LAAI  658
            L A+
Sbjct  338  LCAL  341



>gb|ADR66074.1| gamma-glutamylcysteine synthetase, partial [Zinnia violacea]
Length=105

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDDISLQ+VLDMTADWT  ER+MLRNKVP +GL TPFRDGLLKHVA++VL  
Sbjct  1    PAFWVGILYDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQNV  333
            AK GLERRGYKETGFLN VAEVV TG+TPAEK+L+LYH KWGQ V
Sbjct  61   AKDGLERRGYKETGFLNEVAEVVRTGLTPAEKILDLYHEKWGQTV  105



>gb|AES94043.2| gamma glutamyl cysteine synthetase [Medicago truncatula]
Length=139

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  719  EVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKV  540
            +VRL+RY+EMRGAD  P   LCA PAFWVGLLYD++SL +VLDM ADWT  +R+ LRN+V
Sbjct  2    QVRLRRYMEMRGADVVPQSMLCAPPAFWVGLLYDEVSLHNVLDMIADWTTEDRQYLRNQV  61

Query  539  PKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLEL  360
            P +GL T F+  LL+HVA+DVL  AK GLERR   E+ FL+ + EVV TG+TPA+KLLE+
Sbjct  62   PFTGLKTLFQGRLLQHVAEDVLKWAKAGLERRCLNESIFLDPLIEVVGTGMTPADKLLEM  121

Query  359  YHGKWGQNVDPVFEELLY  306
            Y+ KWG N+DPVF E  Y
Sbjct  122  YNKKWGSNIDPVFRECCY  139



>ref|WP_039718559.1| glutamate--cysteine ligase [Scytonema millei]
 gb|KIF12647.1| glutamate--cysteine ligase [Scytonema millei VB511283]
Length=457

 Score =   162 bits (411),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW RLCALPAFWVGLLYDD +L    ++  DWT  ER  LR 
Sbjct  312  FPEVRLKTFLEMRGADGGPWNRLCALPAFWVGLLYDDAALDEAWELVKDWTAEERSALRE  371

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYK------ETGFLNAVAEVVNTGVT  384
             V K+ L TPFR+  ++ +A+D L +++ GL  RG +      ET FL+ + E+  TG T
Sbjct  372  GVTKTALKTPFRNTTVQQIARDALAISRKGLRARGKQNMHGEYETLFLDDLNEMAATGKT  431

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             A+ LLE YHG+WG +V+P FEE  Y
Sbjct  432  AADDLLERYHGRWGGSVEPAFEECAY  457


 Score = 70.1 bits (170),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            K+ID +G SFRDFMAGKLP +PGE P ++DWE+HL+TIFP 
Sbjct  274  KFIDASGQSFRDFMAGKLPALPGERPVMSDWEDHLSTIFPE  314



>gb|ADR66069.1| gamma-glutamylcysteine synthetase, partial [Cichorium intybus]
Length=101

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -2

Query  635  VGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGG  456
            VG+LYDD+SLQ+VLDMTADWT  EREMLRNKVP +GL TPFRDGLLKHVAQ+V+++AK G
Sbjct  1    VGILYDDVSLQNVLDMTADWTAEEREMLRNKVPVTGLKTPFRDGLLKHVAQEVVNMAKDG  60

Query  455  LERRGYKETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQNV  333
            LERRGYKETGFLN V EVV TG+TPAEKLLELYHGKWGQNV
Sbjct  61   LERRGYKETGFLNEVTEVVRTGLTPAEKLLELYHGKWGQNV  101



>ref|WP_011995572.1| glutamate--cysteine ligase [Parvibaculum lavamentivorans]
 gb|ABS62281.1| glutamate--cysteine ligase [Parvibaculum lavamentivorans DS-1]
Length=456

 Score =   163 bits (413),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPE R+K Y+EMRGADGGPW R+CALPAFWVGL+YD  SL +  D+  DWT  ER+ LR+
Sbjct  311  FPEARIKNYMEMRGADGGPWARICALPAFWVGLMYDQSSLDAAWDLVKDWTAEERQGLRD  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGVT  384
             V K GL+TPFR G L  VA+  + +++ GL+ RG        E   L+AV  +V  G +
Sbjct  371  GVAKHGLHTPFRGGTLLDVARRAVEISRAGLDARGNGDGVGGTEAIHLSAVEAIVAKGKS  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLELYHG+W  +VDPVFEE  +
Sbjct  431  PAEELLELYHGRWNGSVDPVFEEFAF  456


 Score = 68.6 bits (166),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID TG SFRDF+ GKLP +PGE PT  DW NHLTTIFP 
Sbjct  273  KYIDATGQSFRDFLNGKLPALPGETPTRGDWNNHLTTIFPE  313



>gb|ADR66068.1| gamma-glutamylcysteine synthetase, partial [Cichorium intybus]
Length=101

 Score =   174 bits (441),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -2

Query  635  VGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGG  456
            VG+LYDD+SLQ+VLDMTADWT  EREMLRNKVP +GL TPFRDGLLKHVAQ+V++ AK G
Sbjct  1    VGILYDDVSLQNVLDMTADWTAEEREMLRNKVPVTGLKTPFRDGLLKHVAQEVVNFAKDG  60

Query  455  LERRGYKETGFLNAVAEVVNTGVTPAEKLLELYHGKWGQNV  333
            LERRGYKETGFLN V EVV TG+TPAEKLL+LYHGKWGQNV
Sbjct  61   LERRGYKETGFLNEVTEVVRTGLTPAEKLLDLYHGKWGQNV  101



>ref|WP_009803181.1| glutamate--cysteine ligase [Oceanicaulis sp. HTCC2633]
 gb|EAP90814.1| glutamate-cysteine ligase precursor [Oceanicaulis alexandrii 
HTCC2633]
Length=457

 Score =   165 bits (417),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LE RGADGGPW RLCALPAFWVGLLYD  +L +  D+  DWT  ER+ +R 
Sbjct  312  FPEVRLKTFLEQRGADGGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDWTAEERDAMRA  371

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
               K+ L TPFR+  L+ +AQ  L +++ GL+ R      G  E  FL+ + E+  TG++
Sbjct  372  GAAKTALKTPFRNTTLQEIAQQALAISRSGLKARQRLNAHGENEALFLDDLDEIAKTGIS  431

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLE YHG W ++V+P+FEE  Y
Sbjct  432  PAERLLERYHGAWNESVEPIFEEAAY  457


 Score = 62.4 bits (150),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + D TG+SFRDF+ G+LP +PGE P L+DWE+HL+T+FP
Sbjct  275  FQDATGLSFRDFLKGELPLLPGELPVLSDWEDHLSTLFP  313



>ref|XP_004971558.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase A, 
chloroplastic-like [Setaria italica]
Length=445

 Score =   153 bits (386),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 97/137 (71%), Gaps = 6/137 (4%)
 Frame = -2

Query  713  RLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPK  534
            RLKRYLEMRGADGGP      LPAFWVG+LYD+ SLQ++ DM ADWT  ER +LR +VP 
Sbjct  314  RLKRYLEMRGADGGP-----GLPAFWVGILYDEESLQNITDMIADWTNNERNILRREVPV  368

Query  533  SGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLELYH  354
            SGL TPF+ G ++ +A+ V+ LAK GL+RRG+ E  FLN V EV   G+T AE+L  LY 
Sbjct  369  SGLKTPFQGGYVRDLAEYVVKLAKEGLQRRGHNEVDFLNEVDEVARIGMTLAERLTNLYK  428

Query  353  GKWGQ-NVDPVFEELLY  306
             KW   NVD VF EL Y
Sbjct  429  TKWQHINVDMVFYELAY  445


 Score = 73.9 bits (180),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET  709
            KK+IDCTGMSFRDFM GKLP +P E PTLNDWENHL TI+   +T
Sbjct  268  KKHIDCTGMSFRDFMDGKLPHVPWERPTLNDWENHLGTIYSEVDT  312



>ref|WP_011628951.1| glutamate--cysteine ligase [Alkalilimnicola ehrlichii]
 gb|ABI56556.1| glutamate--cysteine ligase [Alkalilimnicola ehrlichii MLHE-1]
Length=455

 Score =   158 bits (399),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVR+KR++EMRGADGGPW RLCALPAFWVGLLY D +L   L + ADW++ E   LR 
Sbjct  310  FPEVRMKRFIEMRGADGGPWGRLCALPAFWVGLLYSDRALDEALQLIADWSVEEISALRE  369

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGG------LERRGYKETGFLNAVAEVVNTGVT  384
            +VP+ GL T FR G L+ VA +VL +++ G      L+RRG  E  FL+ +  +  +G T
Sbjct  370  QVPREGLATRFRGGTLREVALEVLAISRRGLADRAWLDRRGRDEAHFLDLLDGIAQSGRT  429

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLE + G+W Q+V PVF E  Y
Sbjct  430  PAEELLEAWAGRWQQDVAPVFREFAY  455


 Score = 68.6 bits (166),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G SFRDFM G+LP +PGEYP ++DWE+HL+T+FP
Sbjct  272  RYIDVAGQSFRDFMCGRLPGLPGEYPRMSDWEDHLSTLFP  311



>ref|XP_002507857.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69115.1| predicted protein [Micromonas sp. RCC299]
Length=489

 Score =   160 bits (405),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPW  +CALPA WVGLLYD+ +L +   + ADWT  ERE LR 
Sbjct  350  FPEVRLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALANAEALVADWTPEEREYLRV  409

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
             V K GL T FRDG ++ +A +++ ++K GL RRG  E  F++ + E+  +G T A+KLL
Sbjct  410  AVTKDGLQTKFRDGTVQDIAVEMVRISKEGLTRRGCNEENFVDGLMEMATSGQTQADKLL  469

Query  365  ELYHGKWGQNVDPVFEELLY  306
            + Y  KWG ++D V+ EL Y
Sbjct  470  DAYVNKWGMDIDRVYNELSY  489


 Score = 65.1 bits (157),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            Y D TG SFR FM G+LP  PGEYPTL+DWE HLTT FP 
Sbjct  313  YHDVTGESFRAFMRGELPQFPGEYPTLDDWEQHLTTCFPE  352



>dbj|GAN45514.1| glutamate--cysteine ligase [Mizugakiibacter sediminis]
Length=454

 Score =   164 bits (416),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPW RLCALPAFWVGLLYD  +L +  D+  D+T  ER  LR+
Sbjct  309  FPEVRLKRYLEMRGADGGPWNRLCALPAFWVGLLYDATALDAAWDLAKDFTPAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L  PFR G ++ +AQ+ L +A  GL+RR      G  E+ F+  + E      T
Sbjct  369  GVPKHALKLPFRGGSVRDLAQEALKIAAHGLKRRARLSPGGADESHFIEPLIEYAEADQT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ LELYHG+W  +VDPVF E  Y
Sbjct  429  PAERKLELYHGRWNGSVDPVFREFAY  454


 Score = 59.7 bits (143),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +Y+D  G SFRDF+AGKL  +PG  PTL DW +H+TT FP
Sbjct  271  RYVDLAGRSFRDFLAGKLDALPGTLPTLRDWSDHMTTAFP  310



>ref|WP_019959805.1| glutamate--cysteine ligase [Woodsholea maritima]
Length=458

 Score =   160 bits (405),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LE RGADGGPW RLCALPAFWVGLLYD  +L +  D+  DWT  ER+ LR 
Sbjct  313  FPEVRLKTFLEQRGADGGPWSRLCALPAFWVGLLYDQAALDAAWDLVKDWTQDERDSLRI  372

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
               K+ L TP R   L+ VA+ VL +++ GL+ R      G  E  FL+ + E+ ++GVT
Sbjct  373  AAAKTALKTPLRHTTLQEVAKQVLAISRQGLKARAKLNGHGENEAHFLDDLDEIASSGVT  432

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLE YH +WG  +DP+FE   Y
Sbjct  433  PAERLLERYHTEWGGQIDPIFEASAY  458


 Score = 63.2 bits (152),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            K+++ TG+SFRDF+ G+LP +PG+ PT+ DWE+HL+T+FP
Sbjct  275  KFLNATGLSFRDFLKGQLPILPGQLPTVTDWEDHLSTLFP  314



>ref|WP_017463721.1| glutamate--cysteine ligase [Dyella ginsengisoli]
Length=455

 Score =   167 bits (423),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPA WVGLLYDD +L +  D+  D+++ ER  LR+
Sbjct  310  FPEVRLKQYLEMRGADGGPWGRLCALPALWVGLLYDDEALSAAWDLVKDFSLAERHALRD  369

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP++ L  PFR+G ++ +A++ L +A  GL+RR      G  E  FL  + E+V +G T
Sbjct  370  GVPRNALKLPFRNGTVRDLARETLKIAAHGLKRRARLNAGGADERTFLEPLLEIVESGQT  429

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ LEL+HG WG +VDPVF E  Y
Sbjct  430  PAERKLELFHGAWGGSVDPVFREFAY  455


 Score = 55.5 bits (132),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G  F+ FMAG+LP +PG   T+ DW +HLTT FP
Sbjct  272  RYIDLAGQDFKRFMAGELPAVPGTRATMKDWADHLTTAFP  311



>ref|WP_014416028.1| glutamate--cysteine ligase [Rhodospirillum photometricum]
 emb|CCG09398.1| Glutamate--cysteine ligase [Rhodospirillum photometricum DSM 
122]
Length=453

 Score =   158 bits (399),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPW RLCALPA WVGLLYD  SL +  D+  DWT  E  +LR+
Sbjct  308  FPEVRLKRYLEMRGADGGPWNRLCALPALWVGLLYDSNSLDAAWDLVRDWTPEEHALLRD  367

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
            +VP+  L TP+R G L+ +A  +L +A+ GL  R      G  ETGFL+A+  +  +G T
Sbjct  368  QVPRLALKTPWRGGTLQTLALRILEIAEAGLRARARLNSKGRDETGFLDALWIIAESGRT  427

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE LLE +H +W  ++DPVF E  Y
Sbjct  428  QAEDLLESWHSRWNGDIDPVFVECAY  453


 Score = 65.1 bits (157),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G SFRDF+ G+LP +PGE PTL+DW +HLTT FP
Sbjct  270  RYIDAAGQSFRDFLEGRLPALPGEMPTLDDWADHLTTAFP  309



>ref|WP_036515476.1| glutamate--cysteine ligase [Oceanicaulis sp. HL-87]
Length=457

 Score =   159 bits (401),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LE RGADGGPW  LCALPA WVGLLYDD +L + LD+  DWT  ER  LR 
Sbjct  312  FPEVRLKTFLEQRGADGGPWNNLCALPALWVGLLYDDKALAAALDLVKDWTAEERVALRL  371

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
                 GL TPFR+  ++ +A++VL +A+ GL+ R      G  E  FL+ + E+ ++GVT
Sbjct  372  GAAHCGLKTPFRNTTMQDLAKEVLAIARSGLKARARLNHHGEHEAVFLDDLDEIASSGVT  431

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLELY+G WG +V+P+F++  Y
Sbjct  432  PAERLLELYNGPWGGSVEPIFKQAAY  457


 Score = 63.9 bits (154),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +++D +G SFRDF+ GKLP +PGE P + DWE+HL+T+FP
Sbjct  274  RFLDASGQSFRDFLKGKLPALPGELPVMGDWEDHLSTLFP  313



>ref|XP_003062187.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=488

 Score =   164 bits (414),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRY+EMRGADGGPW  +CALPA WVGLLYD+ +L     + ADWT  E+E LR+
Sbjct  349  FPEVRLKRYMEMRGADGGPWGNICALPAVWVGLLYDETALSDAEKLVADWTPEEKEYLRH  408

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
             V K  L TPFRDG ++ VA +++ +AK GL RRG  E  F++ + E+  TG T ++ LL
Sbjct  409  AVTKDALQTPFRDGTVQDVAIEMVKIAKEGLRRRGANEENFVDGLMEIATTGKTSSDLLL  468

Query  365  ELYHGKWGQNVDPVFEELLY  306
            E Y  +WG+++D VF++L Y
Sbjct  469  EAYENEWGEDIDKVFKKLSY  488


 Score = 58.5 bits (140),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            Y D TG SF DFM GKLP  PG + TL+DWE HL+T FP
Sbjct  312  YHDVTGESFVDFMEGKLPQFPGVHATLDDWEQHLSTCFP  350



>ref|WP_022701642.1| glutamate--cysteine ligase [Oceanicaulis alexandrii]
Length=457

 Score =   160 bits (406),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LE RGADGGPW RLCALPAFWVGLLYD  +L +  D+  DWT  ER+ +R 
Sbjct  312  FPEVRLKTFLEQRGADGGPWNRLCALPAFWVGLLYDQSALDAAWDLVKDWTADERDAMRL  371

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
               K+ L TPFR+  L+ +A+  L +++ GL+ R      G  E  FL+ + E+  TGV+
Sbjct  372  GAAKTALKTPFRNTTLQEIAKQALAISRAGLKARQRLNAHGENEALFLDDLDEIAKTGVS  431

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLE YH  WG++V+P+F+E  Y
Sbjct  432  PAERLLERYHTAWGESVEPIFDEAAY  457


 Score = 61.6 bits (148),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            Y D +G+SFRDF+ G+LP +PGE P ++DWE+HL+T+FP
Sbjct  275  YQDASGLSFRDFLKGELPILPGELPVISDWEDHLSTLFP  313



>ref|WP_028098740.1| glutamate--cysteine ligase [Dongia sp. URHE0060]
Length=454

 Score =   157 bits (397),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK++LEMRGADGGPW RLCALPA WVGLLYD  +L +  D+  DWT  +R  L+ 
Sbjct  309  FPEVRLKKFLEMRGADGGPWDRLCALPALWVGLLYDQTALDAAWDLVKDWTAEDRANLKA  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L   F  G ++ +A D + +A+ GL  R      G  E+GFLN +  + ++G  
Sbjct  369  AVPKQALKAKFGKGTVRDLALDTVKIARLGLNNRKSGDLAGTDESGFLNVLQTIADSGEC  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L+LY GKWG++VDPVF E  Y
Sbjct  429  PAEEKLKLYEGKWGRSVDPVFTEFAY  454


 Score = 64.3 bits (155),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            +YID +G SFRDFM GKLP +PGE PT  DW NH  T+FP 
Sbjct  271  RYIDASGQSFRDFMQGKLPALPGEIPTTADWVNHAATVFPE  311



>gb|KIQ97509.1| Glutamate--cysteine ligase [Lysobacter sp. A03]
Length=461

 Score =   161 bits (408),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW R+CALPAFW GLLYDD +L +  D+  D+++ E   LRN
Sbjct  316  FPEVRLKKYLEMRGADTGPWNRICALPAFWTGLLYDDSALDAAWDLVKDYSLEELHALRN  375

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+     PFR G +  VA+  L ++  GL RR      G  ET FL+ + E+V  G T
Sbjct  376  GVPRQAFKLPFRKGTVLDVARQALQISAHGLARRARLNDVGSDETIFLSPLMELVEAGET  435

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L LYHG WG NVDPVF E  Y
Sbjct  436  PAERKLALYHGVWGGNVDPVFREFAY  461


 Score = 59.3 bits (142),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            YI+  G SFRD+MAGKLP  PG  PTL DW +H TT FP
Sbjct  279  YINAAGQSFRDYMAGKLPAHPGHLPTLQDWADHTTTAFP  317



>ref|WP_037519317.1| glutamate--cysteine ligase [Sphingobium yanoikuyae]
 gb|KEZ19277.1| Glutamate-cysteine ligase [Sphingobium yanoikuyae]
Length=457

 Score =   158 bits (399),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M ER++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWSMEERQVLRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  VL +A+ GL  R      G  ETG+L+A+ EV+ TG 
Sbjct  371  SVPKLGLDAPASSGRTLRDIAPQVLDIARSGLAARQRFNAAGDNETGYLSALDEVIATGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            TPAE+LL+ YHG+WG +V  V+ E
Sbjct  431  TPAERLLDRYHGEWGGDVSRVYAE  454


 Score = 62.4 bits (150),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID  G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDAAGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_010337529.1| glutamate--cysteine ligase [Sphingobium yanoikuyae]
 ref|XP_005977680.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pantholops 
hodgsonii]
Length=457

 Score =   158 bits (399),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M ER++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWSMEERQILRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  VL +A+ GL  R      G  ETG+L+A+ EV+ TG 
Sbjct  371  SVPKLGLDAPVSGGRTLRDIAPQVLDIARSGLAARQRFNAAGDNETGYLSALDEVIATGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            TPAE+LL+ YHG+WG +V  V+ E
Sbjct  431  TPAERLLDRYHGEWGGDVSRVYAE  454


 Score = 62.4 bits (150),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID  G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDAAGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_043958070.1| glutamate--cysteine ligase [Lysobacter sp. A03]
Length=454

 Score =   161 bits (408),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW R+CALPAFW GLLYDD +L +  D+  D+++ E   LRN
Sbjct  309  FPEVRLKKYLEMRGADTGPWNRICALPAFWTGLLYDDSALDAAWDLVKDYSLEELHALRN  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+     PFR G +  VA+  L ++  GL RR      G  ET FL+ + E+V  G T
Sbjct  369  GVPRQAFKLPFRKGTVLDVARQALQISAHGLARRARLNDVGSDETIFLSPLMELVEAGET  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L LYHG WG NVDPVF E  Y
Sbjct  429  PAERKLALYHGVWGGNVDPVFREFAY  454


 Score = 59.3 bits (142),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            YI+  G SFRD+MAGKLP  PG  PTL DW +H TT FP
Sbjct  272  YINAAGQSFRDYMAGKLPAHPGHLPTLQDWADHTTTAFP  310



>ref|WP_029003893.1| glutamate--cysteine ligase [Azorhizobium doebereinerae]
Length=456

 Score =   160 bits (405),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGAD GPW +LCALPAFWVGLLYD  SL +   +  DWT  ER+ LR+
Sbjct  311  FPEVRLKRYLEMRGADAGPWAKLCALPAFWVGLLYDRQSLDAAWQIAKDWTAQERQKLRD  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+ GL        L  VA+DVL L++ GL RR      G  ET FL+ + EVV TG T
Sbjct  371  DVPRLGLKAQIAGRSLHDVARDVLALSRAGLVRRRRLDSQGRDETRFLSPIEEVVATGRT  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PA+ LLE +HG W  +V+P FEEL Y
Sbjct  431  PADVLLERFHGAWEGSVEPAFEELAY  456


 Score = 60.5 bits (145),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            YID +G SFRD +AG+ P +PGE  TL DW NHL+TIFP
Sbjct  274  YIDVSGSSFRDLLAGRHPAVPGESATLADWINHLSTIFP  312



>ref|WP_022698585.1| glutamate--cysteine ligase [Maricaulis sp. JL2009]
Length=454

 Score =   162 bits (410),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGAD GPW RLCALPAFWVGLLYD  SL +  D+  DWT  ERE +R 
Sbjct  309  FPEVRLKTFLEMRGADSGPWCRLCALPAFWVGLLYDSASLDAAWDLVKDWTAEERETMRM  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
            +  +  L TPFR   L+ +A+  L +++ GL RR      G  E+ FL+ + E+ ++GVT
Sbjct  369  EAARIALKTPFRGRTLQDIAKQALDISRQGLSRRERLNAHGENESLFLDEIQEIADSGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE LL+ Y+ +WG++VDPVF+ L Y
Sbjct  429  PAEALLDSYYNEWGEDVDPVFKTLAY  454


 Score = 57.8 bits (138),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + I+  G SFRDF+ GKLP +PG+ P + DWE HL+T+FP
Sbjct  271  RLINAAGESFRDFLDGKLPQLPGQRPNIGDWETHLSTLFP  310



>ref|WP_004209288.1| glutamate-cysteine ligase [Sphingobium yanoikuyae]
 gb|EKU74644.1| glutamate-cysteine ligase [Sphingobium yanoikuyae ATCC 51230]
Length=457

 Score =   158 bits (399),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M ER++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWSMEERQVLRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  VL +A+ GL  R      G  ETG+L+A+ EV+ TG 
Sbjct  371  SVPKLGLDAPVSGGRTLRDIAPQVLDIARSGLAARQRFNAAGDNETGYLSALDEVIATGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            TPAE+LL+ YHG+WG +V  V+ E
Sbjct  431  TPAERLLDRYHGEWGGDVSRVYAE  454


 Score = 62.4 bits (150),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID  G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDAAGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_007705830.1| glutamate--cysteine ligase [Sphingobium sp. AP49]
 gb|EJK85812.1| glutamate--cysteine ligase, plant type [Sphingobium sp. AP49]
Length=457

 Score =   157 bits (398),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M ER++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWSMEERQVLRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  VL +A+ GL  R      G  ETG+L+A+ EV+ TG 
Sbjct  371  SVPKLGLDAPVSGGRTLRDIAPQVLDIARSGLAARQRFNAAGDNETGYLSALDEVIATGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            TPAE+LL+ YHG+WG +V  V+ E
Sbjct  431  TPAERLLDRYHGEWGGDVSRVYAE  454


 Score = 62.4 bits (150),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID  G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDAAGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_037513223.1| glutamate--cysteine ligase [Sphingobium yanoikuyae]
 gb|KFD25666.1| glutamate--cysteine ligase [Sphingobium yanoikuyae]
Length=457

 Score =   157 bits (398),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M ER++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWSMEERQVLRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  VL +A+ GL  R      G  ETG+L+A+ EV+ TG 
Sbjct  371  SVPKLGLDAPVSGGRTLRDIAPQVLDIARSGLAARQRFNAAGDNETGYLSALDEVIATGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            TPAE+LL+ YHG+WG +V  V+ E
Sbjct  431  TPAERLLDRYHGEWGGDVSRVYAE  454


 Score = 62.4 bits (150),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID  G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDAAGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_017502900.1| glutamate--cysteine ligase [alpha proteobacterium LLX12A]
Length=457

 Score =   157 bits (396),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 101/144 (70%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M ER++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWSMEERQVLRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  VL +A+ GL  R      G  ETG+L+A+ EV+ TG 
Sbjct  371  SVPKLGLDAPVSGGRTLRDIAPQVLDIARSGLAARQRFNAAGDNETGYLSALDEVIATGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            TPAE+LL+ YHG+W  NV  V+ E
Sbjct  431  TPAERLLDRYHGEWDGNVSRVYAE  454


 Score = 62.4 bits (150),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID  G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDAAGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_021244404.1| glutamate--cysteine ligase [Sphingobium baderi]
 gb|EQB02900.1| glutamate--cysteine ligase [Sphingobium baderi LL03]
Length=457

 Score =   153 bits (386),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVR+K +LEMRGADGGPW R+CALPA WVGLLYD  +L +  D+  DWTM ER++LR+
Sbjct  311  FPEVRMKSFLEMRGADGGPWNRICALPALWVGLLYDQGALDAAWDLVKDWTMEERQVLRD  370

Query  545  KVPKSGLNTPFRDGL-LKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A   L +A+ GL  RG        ETG+L+A+ E+V +G 
Sbjct  371  SVPKLGLDAPIAGGRKLRDIAGQALDIARSGLAARGRLNAAGDNETGYLSALDEIVASGR  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            T AE+LLE YHG+WG ++  ++ E
Sbjct  431  THAERLLERYHGEWGGDISRIYAE  454


 Score = 66.2 bits (160),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G SFRDF+AGKLP +PGE PT  DWE+HL+T FP
Sbjct  273  RYIDAAGQSFRDFLAGKLPALPGEKPTEKDWEDHLSTAFP  312



>ref|WP_012171491.1| glutamate--cysteine ligase [Azorhizobium caulinodans]
 dbj|BAF88965.1| glutamate-cysteine ligase [Azorhizobium caulinodans ORS 571]
Length=456

 Score =   159 bits (403),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGAD GPW +LCALPAFWVGLLYD  SL +   +  DWT  ER+ LR+
Sbjct  311  FPEVRLKRYLEMRGADAGPWAKLCALPAFWVGLLYDRQSLDAAWQLAKDWTADERQTLRD  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
            +VP+ GL        ++ +A+D+L L++ GL RR      G  ET FL  + EVV TG T
Sbjct  371  EVPRLGLKATIGGRTVQDIARDLLALSRAGLVRRRQLDSQGRDETRFLAPLEEVVATGRT  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PA+ LL  YHG W  +V+PVFEEL Y
Sbjct  431  PADDLLSRYHGAWQGSVEPVFEELAY  456


 Score = 59.7 bits (143),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            YID  G SFRD +AG+ P +PGE  TL DW NHL+TIFP
Sbjct  274  YIDVAGSSFRDLLAGRHPAVPGETATLADWINHLSTIFP  312



>ref|WP_014129677.1| glutamate--cysteine ligase [Pelagibacterium halotolerans]
 gb|AEQ50528.1| glutamate--cysteine ligase [Pelagibacterium halotolerans B2]
Length=459

 Score =   156 bits (395),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 6/143 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVR+K++LEMRGADG PW+ +CALPAFWVGLLYD+ +L +  D+  DWT  ER+ LRN
Sbjct  309  FPEVRMKQFLEMRGADGAPWQGICALPAFWVGLLYDETALDAAWDLVKDWTEEERQALRN  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+  L TPFR+G L  +A+  L +A+ GL+ R      G  ET FL  +   + TG T
Sbjct  369  DVPRLALKTPFRNGTLFDIAKQALAIARSGLKARNKLNWEGADETVFLKPLDYTIETGKT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEE  315
            PAE+LL+LYHG+W  +++ VF +
Sbjct  429  PAERLLDLYHGEWSGDLNRVFSD  451


 Score = 62.4 bits (150),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YI+C G SFR F+ GKLP +PGE PT  DWE+HL+T+FP
Sbjct  271  EYINCAGESFRAFLDGKLPQLPGELPTARDWEDHLSTLFP  310



>gb|ADR66075.1| gamma-glutamylcysteine synthetase, partial [Helianthus annuus]
Length=94

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -2

Query  635  VGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHLAKGG  456
            VG+LYDDISLQ+VLDMTADWT GER+MLRNKVP +GL TPFRDGLLKHVA++VL LAK G
Sbjct  1    VGILYDDISLQNVLDMTADWTQGERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLQLAKDG  60

Query  455  LERRGYKETGFLNAVAEVVNTGVTPAEKLLELYH  354
            LERRGYKETGFLN VAEVV TG+TPAEKLLELYH
Sbjct  61   LERRGYKETGFLNEVAEVVRTGLTPAEKLLELYH  94



>ref|WP_036195140.1| glutamate--cysteine ligase [Lysobacter concretionis]
 gb|KGM51113.1| glutamate--cysteine ligase [Lysobacter concretionis Ko07 = DSM 
16239]
Length=459

 Score =   155 bits (393),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW R+CALPAFW GLLYDD +L +  D+  D+++ E   LR+
Sbjct  314  FPEVRLKKYLEMRGADAGPWNRICALPAFWTGLLYDDTALDAAWDLVKDFSLAEIHALRD  373

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+  L  PFR G +  +A+  + ++  GL RR      G  E+ FL  + E+V  G T
Sbjct  374  GVPRQALKLPFRGGTVLDLARRAVQISAHGLARRARLNGNGSDESIFLGPLMELVEAGET  433

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG WG N+DPVF E  Y
Sbjct  434  PAERKLALFHGVWGGNIDPVFREFAY  459


 Score = 63.2 bits (152),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + YID +G SFRD+MAGKLP  PG+ PTL DW +H TT FP
Sbjct  275  QNYIDASGQSFRDYMAGKLPARPGQLPTLQDWADHTTTAFP  315



>ref|WP_012568753.1| glutamate--cysteine ligase [Rhodospirillum centenum]
 gb|ACJ00977.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
Length=455

 Score =   159 bits (401),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPW RLCALPA WVGLLYD  +L +  D+   WT  ER  LR 
Sbjct  310  FPEVRLKRYLEMRGADGGPWGRLCALPALWVGLLYDGTALDAAWDLCKGWTAQERAALRR  369

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+ GL+TPFR G L+ VA+ V+ +A+ GL  R      G  E+ FL  +AE   +G+T
Sbjct  370  DVPRLGLDTPFRGGTLQAVAKQVVEIAREGLRSRARMAGMGDDESHFLTTLAETAESGIT  429

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PA ++L  + G W  N+D V+EE  Y
Sbjct  430  PATEMLRKFEGPWAGNIDRVYEEYAY  455


 Score = 59.3 bits (142),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +Y+D +G+ FRDF+AG+L  +PGE P   DW +HLTT+FP
Sbjct  272  QYLDASGLDFRDFLAGRLSVLPGEMPLATDWNDHLTTLFP  311



>gb|ADR66079.1| gamma-glutamylcysteine synthetase, partial [Hieracium umbellatum]
Length=96

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDD+SLQ+VLDMTADWT  ER+MLRNKVP SGL TPFRDGLLKHVAQ+V+  
Sbjct  1    PAFWVGILYDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLEL  360
            AK GLERRGYKETGFLN V EVV TG+TPAEKLLEL
Sbjct  61   AKDGLERRGYKETGFLNEVTEVVRTGLTPAEKLLEL  96



>ref|WP_012116172.1| glutamate--cysteine ligase [Xanthobacter autotrophicus]
 gb|ABS69425.1| glutamate--cysteine ligase [Xanthobacter autotrophicus Py2]
Length=456

 Score =   158 bits (399),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKR+LEMRGAD GPW +LCALPA WVGLLYD  SL +  D+  DWT  +R+ LR+
Sbjct  311  FPEVRLKRFLEMRGADAGPWAKLCALPALWVGLLYDQQSLDAAWDLAKDWTAEQRQQLRD  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYK------ETGFLNAVAEVVNTGVT  384
             VP+ GL        L+ +A+DVL L++ GL+RRG+       ET FL  + E+V TG +
Sbjct  371  DVPRLGLKAEIAGRQLRDIARDVLKLSEAGLKRRGFHDRLGRDETRFLEPLEEIVLTGRS  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PA+KLL LY+G+W  +V+P F+ L Y
Sbjct  431  PADKLLALYNGEWDHSVEPAFQALAY  456


 Score = 59.7 bits (143),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  843  KKYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + Y+D +G SFRD +AG+ P +PGE  TL+DW NHL+TIFP
Sbjct  272  ESYVDVSGTSFRDLLAGRHPLLPGETATLSDWINHLSTIFP  312



>ref|WP_037338607.1| glutamate--cysteine ligase [Salinisphaera hydrothermalis]
 gb|KEZ76969.1| gamma-glutamylcysteine synthetase [Salinisphaera hydrothermalis 
C41B8]
Length=454

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKR++EMRGADGGPWRRLCALPA W GL YD ++L    ++ +D+T  ER  LR+
Sbjct  309  FPEVRLKRFMEMRGADGGPWRRLCALPALWAGLCYDSVALDEAWNLVSDFTREERNHLRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGVT  384
            + P  GL TPFR G L  +A++ + +A+GGL RR         E+ FL+ +AE+  TGVT
Sbjct  369  QAPMYGLKTPFRGGTLGDIARETIRIAQGGLRRRAQLDSTDRDESMFLDQLAEIAETGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LL LYHG+W ++VDPVFEE  Y
Sbjct  429  PAEQLLTLYHGRWNESVDPVFEEFAY  454


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YID +G SFRDF+AGKLP +PGE PT+ DW++HLTTIFP     +   + G   G WR 
Sbjct  271  RYIDASGQSFRDFLAGKLPALPGERPTMGDWDDHLTTIFPEVRLKRFMEMRGADGGPWRR  330

Query  669  LAAI  658
            L A+
Sbjct  331  LCAL  334



>ref|WP_011388328.1| glutamate--cysteine ligase [Rhodospirillum rubrum]
 ref|YP_425661.1| glutamate--cysteine ligase [Rhodospirillum rubrum ATCC 11170]
 gb|ABC21374.1| Glutamate--cysteine ligase [Rhodospirillum rubrum ATCC 11170]
 gb|AEO47054.1| glutamate--cysteine ligase [Rhodospirillum rubrum F11]
Length=456

 Score =   154 bits (389),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKRYLEMRGADGGPW RLCALPAFWVGLLY+  SL +  D+  DWT  E   LR 
Sbjct  311  FPEVRLKRYLEMRGADGGPWLRLCALPAFWVGLLYETASLDAAWDLVKDWTAEEHAQLRA  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
            +VP+  L TPFR G L+ VA   L +++ GL  R      G  ETGFL+ +  +  +G T
Sbjct  371  QVPRLALKTPFRKGTLQDVALRALEISQAGLAARGRLNSKGRDETGFLDPLWTIARSGRT  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE LLE +  +W   +DPVF E  Y
Sbjct  431  QAEDLLESFLTRWNGEIDPVFTECAY  456


 Score = 62.4 bits (150),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID TG SFRDFMAG+L  +PGE PT+ DW +H+T  FP
Sbjct  273  RYIDATGQSFRDFMAGRLAALPGERPTIADWTDHMTVAFP  312



>gb|ADR66082.1| gamma-glutamylcysteine synthetase, partial [Hieracium scabrum]
 gb|ADR66083.1| gamma-glutamylcysteine synthetase, partial [Hieracium scabrum]
Length=96

 Score =   164 bits (415),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDD+SLQ+V+DMTADWT  ER+MLRNKVP SGL TPFRDGLLKHVAQ+V+  
Sbjct  1    PAFWVGILYDDVSLQNVVDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLEL  360
            AK GLERRGYKETGFLN V EVV TG+TPAEKLLEL
Sbjct  61   AKDGLERRGYKETGFLNEVTEVVRTGLTPAEKLLEL  96



>ref|WP_039288065.1| glutamate--cysteine ligase [Novosphingobium malaysiense]
 gb|KHK89355.1| glutamate--cysteine ligase [Novosphingobium malaysiense]
Length=457

 Score =   152 bits (384),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYD  +L +  D+  DW M  RE+LR 
Sbjct  311  FPEVRLKSFLEMRGADGGPWGRICALPALWVGLLYDQTALDAAWDLVKDWDMEGRELLRA  370

Query  545  KVPKSGLNTPFR-DGLLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGV  387
             VP+ GL+ P    G L+ +A +VL +A+ GL  RG        ETG+L  +AE+V +G 
Sbjct  371  AVPRLGLDAPLPGGGSLRDIAGEVLSIARSGLAARGRLNAGGDNETGYLEPLAEIVASGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVF  321
             PAE+LL+LYHG+WG +V  V+
Sbjct  431  VPAERLLDLYHGEWGGDVSRVY  452


 Score = 63.5 bits (153),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID  G SFRDF+ G+LP +PGE P ++DWE+HL+T FP
Sbjct  273  KYIDAAGQSFRDFLKGELPALPGELPRVSDWEDHLSTAFP  312



>ref|WP_040849077.1| glutamate--cysteine ligase [Nitrospirillum amazonense]
Length=455

 Score =   159 bits (401),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 103/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKR+LEMRGADGGPW RLCALPA WVGLLYD  +L +  D+  DWT  ER  LRN
Sbjct  310  FPEVRLKRFLEMRGADGGPWARLCALPALWVGLLYDTTALDAAWDLIKDWTEEERAQLRN  369

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+ GL+TPFR G +  +A+  + +++ GL+ R      G  E+ FL+A+  +V++GV+
Sbjct  370  NVPRLGLDTPFRKGTVLDLARQTVAISRNGLDNRARLAGMGDNESHFLDALQAIVDSGVS  429

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PA +LL  ++G+WG ++D V+ E  Y
Sbjct  430  PATELLNKFNGEWGGDIDRVYAEYAY  455


 Score = 57.0 bits (136),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID +G  FR F+ G+LP +PGE P + DW +HLTT+FP
Sbjct  272  QYIDASGQDFRAFLRGELPALPGERPLITDWVDHLTTLFP  311



>gb|ADR66077.1| gamma-glutamylcysteine synthetase, partial [Hieracium porrifolium]
 gb|ADR66078.1| gamma-glutamylcysteine synthetase, partial [Hieracium porrifolium]
 gb|ADR66081.1| gamma-glutamylcysteine synthetase, partial [Hieracium cf. guatemalense 
KK-2010]
Length=96

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDD+SLQ+VLDMTADWT  ER+MLRNKVP SGL TPFRDGLLKHVAQ+V+  
Sbjct  1    PAFWVGILYDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            AK GLERRGYKETGFLN V EVV TG+TPAEKLLE
Sbjct  61   AKDGLERRGYKETGFLNEVTEVVRTGLTPAEKLLE  95



>ref|WP_028967581.1| glutamate--cysteine ligase [Sphingomonas phyllosphaerae]
Length=457

 Score =   155 bits (391),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 101/147 (69%), Gaps = 7/147 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPAFWVGLLYD ++L +  D+   WT+ ER+ LR+
Sbjct  311  FPEVRLKTFLEMRGADGGPWNRICALPAFWVGLLYDGVALDAAWDLVKHWTLDERQALRD  370

Query  545  KVPKSGLNTPFR-DGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P    G L+ +A  VL++A GGL+ R      G  ETGFL  + E+V  G 
Sbjct  371  AVPKLGLSAPIPGGGQLRDIAAAVLNIAHGGLKARARVSAAGEDETGFLEPLREIVRAGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEELLY  306
             PAE+LL+LY+G WG ++  V+ E  +
Sbjct  431  VPAERLLDLYNGAWGGDLSRVYREASF  457


 Score = 60.8 bits (146),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G+SFRDF+ G+L  +PGE PT+ DW++HL+T FP
Sbjct  273  RYIDAAGLSFRDFLRGELSVLPGEKPTITDWDDHLSTAFP  312



>ref|WP_042597021.1| glutamate--cysteine ligase [Xanthomonas campestris]
 gb|KIQ26288.1| glutamate--cysteine ligase [Xanthomonas campestris]
Length=454

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW RLCALPAFWVGLLYD  +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L  PFR+G+++ +A + +++A+ GL RR      G  ETGFL+ +AE+  TGVT
Sbjct  369  GVPKQALGLPFRNGMVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAETGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE+ L LYHG W  ++DPVF E  Y
Sbjct  429  AAERKLALYHGAWKGDIDPVFREFAY  454


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM GKLP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQGKLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADAGPWNRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|XP_001778732.1| predicted protein [Physcomitrella patens]
 gb|EDQ56430.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   159 bits (402),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            +PEVRLK+YLEMRGAD  P   L ALPAFWVGLLYD+ SL++ LD+  DW+  +R  LR 
Sbjct  363  YPEVRLKKYLEMRGADCCPKDFLNALPAFWVGLLYDEQSLKNCLDIIRDWSNDDRGFLRK  422

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +VP  G+ TPFR+G L+ VA+DVL LAK GL RRG +E  FL  + EV  TGVT AE++L
Sbjct  423  EVPNQGILTPFREGTLQDVAKDVLKLAKDGLARRGLQEGKFLAPLEEVATTGVTLAERML  482

Query  365  ELYHGKWGQNVDPVFEEL  312
            +LY  +W   VDP+F EL
Sbjct  483  KLYEEEWDGRVDPIFNEL  500


 Score = 56.2 bits (134),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            + D +G SF++FMAGKL   PGE P+LNDW NHL T++P
Sbjct  326  WRDVSGASFKNFMAGKLEAYPGEKPSLNDWMNHLGTMYP  364



>ref|WP_034157617.1| glutamate--cysteine ligase [Sphingomonas sp. ERG5]
Length=463

 Score =   153 bits (387),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW ++CALPA WVGLLYD+ +L +  D+   WT+GER+ LR+
Sbjct  317  FPEVRLKTFLEMRGADGGPWNKICALPALWVGLLYDNAALDAAWDVVKHWTIGERQALRD  376

Query  545  KVPKSGLNTPFR-DGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VP+  LN P    G L+ +A +VL +A  GL  R      G  ETGFL+ + ++V +G 
Sbjct  377  AVPRLALNAPIPGGGTLRDIAGEVLDIANAGLTARSRMDASGSNETGFLDPLRDIVRSGK  436

Query  386  TPAEKLLELYHGKWGQNVDPVFEELLY  306
             PAE LLE YHG WG +V  V++E+ +
Sbjct  437  VPAEVLLERYHGVWGGDVSKVYDEMRF  463


 Score = 61.6 bits (148),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID  G+SFRDF+ G+L  +PGE PT++DW +HL+T FP
Sbjct  279  KYIDAAGLSFRDFLKGELSVLPGELPTVDDWADHLSTAFP  318



>ref|WP_011038494.1| glutamate--cysteine ligase [Xanthomonas campestris]
 ref|NP_638742.1| glutamate--cysteine ligase [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAM42666.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv. 
campestris str. ATCC 33913]
 gb|AAY47846.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv. 
campestris str. 8004]
Length=454

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW RLCALPAFWVGLLYD  +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L  PFR+G+++ +A + +++A+ GL RR      G  ETGFL+ +AE+  TGVT
Sbjct  369  GVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAETGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE+ L LYHG W  ++DPVF E  Y
Sbjct  429  AAERKLALYHGAWKGDIDPVFREFAY  454


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM GKLP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQGKLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADAGPWNRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_010217933.1| glutamate--cysteine ligase [Sphingomonas sp. PAMC 26621]
Length=457

 Score =   153 bits (387),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYD+ +L +  D+   WT+ ER+ LR+
Sbjct  311  FPEVRLKTFLEMRGADGGPWGRICALPALWVGLLYDNQALDAAWDLVKHWTIEERQALRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A +VL +A  GL  R      G  ETGFL+ + EVV +G 
Sbjct  371  SVPKLGLDGPIAGGRTLRAIAGEVLDIAHAGLVARGRLDAGGSNETGFLDPLREVVRSGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEELLY  306
             PAE LLE YHG WG +V  V++EL +
Sbjct  431  VPAEVLLEKYHGAWGGDVSKVYDELRF  457


 Score = 61.2 bits (147),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G+SFRDF+ G+L  +PGE PTL+DW +HL+T FP
Sbjct  273  RYIDAAGLSFRDFLKGELSVLPGEKPTLDDWNDHLSTAFP  312



>gb|AEL08593.1| glutamate--cysteine ligase [Xanthomonas campestris pv. raphani 
756C]
Length=456

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW RLCALPAFWVGLLYD  +L +  D+  D+T+ ER  LR+
Sbjct  311  FPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAERHALRD  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L  PFR+G+++ +A + +++A+ GL RR      G  ETGFL+ +AE+  TGVT
Sbjct  371  GVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAETGVT  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE+ L LYHG W  ++DPVF E  Y
Sbjct  431  AAERKLALYHGAWKGDIDPVFREFAY  456


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM GKLP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  274  YHDASGQSFRDFMQGKLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADAGPWNRL  333

Query  666  AAI  658
             A+
Sbjct  334  CAL  336



>emb|CEN59071.1| Glutamate-cysteine ligase, chloroplastic [Xanthomonas campestris 
pv. campestris]
Length=454

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW RLCALPAFWVGLLYD  +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L  PFR+G+++ +A + +++A+ GL RR      G  ETGFL+ +AE+  TGVT
Sbjct  369  GVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAETGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE+ L LYHG W  ++DPVF E  Y
Sbjct  429  AAERKLALYHGAWKGDIDPVFREFAY  454


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM GKLP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQGKLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADAGPWNRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_036212296.1| glutamate--cysteine ligase [Lysobacter arseniciresistens]
Length=463

 Score =   156 bits (394),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW R+CALPA W GLLYDD +L    ++  D+++ E   LR+
Sbjct  318  FPEVRLKKYLEMRGADSGPWNRICALPALWTGLLYDDQALDEAWELVRDFSVAEIHALRD  377

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+     PFR G +  +A+  + +A GGL RR      G  ET FL  + E+V  GVT
Sbjct  378  GVPRHAFKLPFRGGTVLDLARRTVQIAAGGLARRARINENGSDETIFLGPLMELVEAGVT  437

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ LEL+HG WG +VDPVF E  Y
Sbjct  438  PAERKLELFHGPWGGSVDPVFREFAY  463


 Score = 58.5 bits (140),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G SFRDF+ G+LP  PG  PTL DW +H TT FP
Sbjct  280  RYIDAAGQSFRDFLDGRLPAYPGHTPTLQDWADHSTTAFP  319



>gb|KGM54711.1| glutamate--cysteine ligase [Lysobacter arseniciresistens ZS79]
Length=452

 Score =   155 bits (393),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW R+CALPA W GLLYDD +L    ++  D+++ E   LR+
Sbjct  307  FPEVRLKKYLEMRGADSGPWNRICALPALWTGLLYDDQALDEAWELVRDFSVAEIHALRD  366

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+     PFR G +  +A+  + +A GGL RR      G  ET FL  + E+V  GVT
Sbjct  367  GVPRHAFKLPFRGGTVLDLARRTVQIAAGGLARRARINENGSDETIFLGPLMELVEAGVT  426

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ LEL+HG WG +VDPVF E  Y
Sbjct  427  PAERKLELFHGPWGGSVDPVFREFAY  452


 Score = 58.5 bits (140),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G SFRDF+ G+LP  PG  PTL DW +H TT FP
Sbjct  269  RYIDAAGQSFRDFLDGRLPAYPGHTPTLQDWADHSTTAFP  308



>ref|WP_010160442.1| glutamate--cysteine ligase [Sphingomonas sp. PAMC 26617]
Length=457

 Score =   154 bits (388),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYD+ +L +  D+   WT+ ER+ LR+
Sbjct  311  FPEVRLKTFLEMRGADGGPWGRICALPALWVGLLYDNQALDAAWDLVKHWTIEERQALRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A +VL +A  GL  R      G  ETGFL+ + EVV +G 
Sbjct  371  SVPKLGLDAPIAGGRTLRAIAGEVLDIAHAGLVARARLDAGGSNETGFLDPLREVVRSGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEELLY  306
             PAE LLE YHG WG +V  V++EL +
Sbjct  431  VPAEVLLEKYHGVWGGDVSKVYDELRF  457


 Score = 60.8 bits (146),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G+SFRDF+ G L  +PGE PTL+DW +HL+T FP
Sbjct  273  RYIDAAGLSFRDFLKGDLSVLPGEKPTLDDWNDHLSTAFP  312



>ref|WP_006913439.1| glutamate--cysteine ligase [Salinisphaera shabanensis]
 gb|ERJ18647.1| Glutamate-cysteine ligase protein [Salinisphaera shabanensis 
E1L3A]
Length=454

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 103/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKR++EMRGADGGPWRRLCALPA W GL YD  +L +   +  D+T  ER MLR 
Sbjct  309  FPEVRLKRFMEMRGADGGPWRRLCALPALWAGLCYDSEALDAAWQLCRDFTADERNMLRR  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRG------YKETGFLNAVAEVVNTGVT  384
            + P  GL TPFRDG L+ +A+ V+ +A+GGLERR         E  +L+ +AE+  TGVT
Sbjct  369  EAPVQGLKTPFRDGTLQDIAKQVVAIARGGLERRARLDSQDRDERMYLDQLAEIAETGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE LL+LY G+W ++VDPVF E  Y
Sbjct  429  PAETLLDLYTGRWNESVDPVFTEFAY  454


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YID +G SFRDF+AGKLP +PGE PTL+DW++HLTT+FP     +   + G   G WR 
Sbjct  271  RYIDASGQSFRDFLAGKLPALPGELPTLSDWDDHLTTLFPEVRLKRFMEMRGADGGPWRR  330

Query  669  LAAI  658
            L A+
Sbjct  331  LCAL  334



>gb|ADR66076.1| gamma-glutamylcysteine synthetase, partial [Galinsoga parviflora]
Length=94

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDDISLQ+VLDMTADWT  ER+MLRNKVP +GL TPFRDGLLKHVA++VL  
Sbjct  1    PAFWVGILYDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            AK GLERRGYKETGFLN VAEVV TG+TPAEK+L
Sbjct  61   AKDGLERRGYKETGFLNEVAEVVRTGLTPAEKIL  94



>ref|WP_045665217.1| glutamate--cysteine ligase [Rhodospirillaceae bacterium BRH_c57]
 gb|KJS34195.1| glutamate--cysteine ligase [Rhodospirillaceae bacterium BRH_c57]
Length=454

 Score =   150 bits (380),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FP+VR+K+++EMRGADGGPW RLC LPAFWVGLLYDD++L + LD+  DWT  +R  LR 
Sbjct  309  FPDVRVKQFMEMRGADGGPWGRLCGLPAFWVGLLYDDVALDAALDLVKDWTPEDRAKLRA  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP+  L        ++ VA D L +A+ GL RR      G  E+GFL  + E+  TG T
Sbjct  369  DVPEKALQATVAGRSVRDVALDALSIARAGLVRRARMSAAGDTESGFLAPLQEIAETGRT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PA+ LLE +HG+W  ++  VFEE  Y
Sbjct  429  PAQDLLEAWHGRWNGDITKVFEEYGY  454


 Score = 63.5 bits (153),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YI+  G SFRDFM G+LP +PGE PT+ DW +HLTT FP
Sbjct  271  RYINAAGQSFRDFMDGRLPALPGERPTIGDWADHLTTAFP  310



>ref|WP_007013078.1| glutamate--cysteine ligase [Novosphingobium pentaromativorans]
 gb|EHJ61003.1| glutamate--cysteine ligase [Novosphingobium pentaromativorans 
US6-1]
 gb|AIT79952.1| glutamate--cysteine ligase [Novosphingobium pentaromativorans 
US6-1]
Length=462

 Score =   151 bits (381),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYD  +L +  D+  DW M  RE+LR+
Sbjct  311  FPEVRLKSFLEMRGADGGPWNRICALPALWVGLLYDQTALDAAWDLVKDWDMEGREVLRS  370

Query  545  KVPKSGLNTPF------RDGLLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEV  402
             VP+ GL+ P         G L+ +A +VL +A+ GL  RG        ETG+L  +AE+
Sbjct  371  SVPRLGLDAPLPQSAKGSGGTLRDIAGEVLDIARSGLAARGKLNAGGDNETGYLEPLAEI  430

Query  401  VNTGVTPAEKLLELYHGKWGQNVDPVFEE  315
            V++G  PA++LLE +HG+WG N+  V+++
Sbjct  431  VSSGKVPAQRLLERFHGEWGGNLCEVYKQ  459


 Score = 63.2 bits (152),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID  G SFRDF+ G+LP +PGE P ++DW++HL+T FP
Sbjct  273  KYIDAAGQSFRDFLKGELPALPGELPRMSDWQDHLSTAFP  312



>ref|WP_005419277.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|EMI48585.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia AU12-09]
Length=454

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ ++++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKHAMNLPFRNGTVRDLAREAVNISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHGDVDPVFREFAY  454


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM  +LP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQARLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_037474880.1| glutamate--cysteine ligase [Sphingobium sp. ba1]
 gb|KFL46520.1| gamma-glutamylcysteine synthetase [Sphingobium sp. ba1]
Length=457

 Score =   150 bits (380),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M +R++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWGRICALPALWVGLLYDQGALDAAWDLVKDWSMEDRQILRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A+  L +A+ GL  RG        ETG+L+ + EVV++G 
Sbjct  371  SVPKLGLDAPIGGGRTLRDIAKPALDIARSGLAARGRLNAAGDNETGYLSDLEEVVSSGT  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            T AE+LL+ YHG+WG +V  V+ E
Sbjct  431  THAERLLDRYHGEWGGDVSKVYAE  454


 Score = 63.2 bits (152),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID +G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDASGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_013831914.1| glutamate--cysteine ligase [Novosphingobium sp. PP1Y]
 emb|CCA91469.1| glutamate--cysteine ligase [Novosphingobium sp. PP1Y]
Length=462

 Score =   151 bits (381),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYD  +L +  D+  DW M  RE+LR+
Sbjct  311  FPEVRLKSFLEMRGADGGPWNRICALPALWVGLLYDQTALDAAWDLVKDWDMEGREVLRS  370

Query  545  KVPKSGLNTPFRD------GLLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEV  402
             VP+ GL+ P         G L+ +A +VL +A+ GL  RG        ETG+L  +AE+
Sbjct  371  SVPRLGLDAPLPQSAKGTGGTLRDIAGEVLDIARSGLAARGKLNAGGDNETGYLEPLAEI  430

Query  401  VNTGVTPAEKLLELYHGKWGQNVDPVFEE  315
            V++G  PA++LLE +HG+WG N+  V+++
Sbjct  431  VSSGKVPAQRLLERFHGEWGGNLCEVYKQ  459


 Score = 62.8 bits (151),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID  G SFRDF+ G+LP +PGE P ++DW++HL+T FP
Sbjct  273  KYIDAAGQSFRDFLKGELPALPGELPRMSDWQDHLSTAFP  312



>ref|WP_010480897.1| glutamate--cysteine ligase [[Pseudomonas] geniculata]
Length=454

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHDDVDPVFREFAY  454


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM G+LP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQGRLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_029558402.1| glutamate--cysteine ligase [Xanthobacter sp. 91]
Length=456

 Score =   155 bits (391),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLKR+LEMRGAD GP   LCALPAFWVGLLYD  SL +  D+  DWT  ER+ LR+
Sbjct  311  FPEVRLKRFLEMRGADAGPSINLCALPAFWVGLLYDQQSLDAAWDLVKDWTAEERQTLRD  370

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYK------ETGFLNAVAEVVNTGVT  384
             VP+  L    R   L+ VA+DVL L++ GL+RRG+       ET FL  + + + +G  
Sbjct  371  DVPRLALKAEIRGRALRDVAKDVLKLSQAGLKRRGFHDRLGRDETRFLEPLEQTLLSGRV  430

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLELYHG W  +V+P F+ L Y
Sbjct  431  PAEELLELYHGPWNGSVEPAFDALAY  456


 Score = 58.9 bits (141),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            YID  G SFRD +AG+ P +PGE  TL+DW NHL+TIFP
Sbjct  274  YIDVAGSSFRDLLAGRNPLLPGETATLSDWINHLSTIFP  312



>ref|WP_022684910.1| glutamate--cysteine ligase [Sphingomonas phyllosphaerae]
Length=457

 Score =   153 bits (386),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPAFWVGLLYD ++L +  D+   WT+ +R+ LR+
Sbjct  311  FPEVRLKTFLEMRGADGGPWNRICALPAFWVGLLYDGVALDAAWDVVKHWTLEQRQALRD  370

Query  545  KVPKSGLNTPFR-DGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P    G L+ +A  VL +A GGL+ R      G  ETGFL  + E+V  G 
Sbjct  371  AVPKLGLSAPIPGGGQLRDIAGMVLDIAHGGLKARARLSGAGEDETGFLEPLREIVRAGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVF  321
             PAE+LL+LYHG WG +V  V+
Sbjct  431  VPAERLLDLYHGAWGGDVSHVY  452


 Score = 60.5 bits (145),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G+SFRDF+ G+L  +PGE PT+ DW++HL+T FP
Sbjct  273  RYIDAAGLSFRDFLRGELSVLPGEKPTIEDWDDHLSTAFP  312



>ref|WP_010414293.1| glutamate--cysteine ligase [Citromicrobium sp. JLT1363]
Length=456

 Score =   154 bits (390),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 100/143 (70%), Gaps = 7/143 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPAFWVGLLYD  +L +  D+  DW+M ERE LRN
Sbjct  311  FPEVRLKSFLEMRGADGGPWSRICALPAFWVGLLYDQTALDAAWDVVKDWSMEEREALRN  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGV  387
             VPK GL      G  L+ + ++VL +A+ GL  RG+       ETGFL  + E+V +G 
Sbjct  371  AVPKEGLAARIPGGRTLQDLGKEVLDIARAGLTARGFLNTGGDNETGFLQTLDEIVESGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFE  318
            +PA+++L+ YHG+WG ++  V++
Sbjct  431  SPAQRMLDRYHGEWGGDISRVYK  453


 Score = 58.9 bits (141),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KY+D  G+SFRDF+ GKL  +PGE PT +DW +HL+T FP
Sbjct  273  KYLDAAGLSFRDFLEGKLSILPGEKPTQSDWWDHLSTAFP  312



>emb|CAP50142.1| glutamate-cysteine ligase [Xanthomonas campestris pv. campestris]
Length=545

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGAD GPW RLCALPAFWVGLLYD  +L +  D+  D+T+ ER  LR+
Sbjct  400  FPEVRLKKYLEMRGADAGPWNRLCALPAFWVGLLYDQTALDAAWDLVKDFTLAERHALRD  459

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  L  PFR+G+++ +A + +++A+ GL RR      G  ETGFL+ +AE+  TGVT
Sbjct  460  GVPKQALGLPFRNGVVRDLALEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAETGVT  519

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
             AE+ L LYHG W  ++DPVF E  Y
Sbjct  520  AAERKLALYHGAWKGDIDPVFREFAY  545


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM GKLP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  363  YHDASGQSFRDFMQGKLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADAGPWNRL  422

Query  666  AAI  658
             A+
Sbjct  423  CAL  425



>gb|ADR66084.1| gamma-glutamylcysteine synthetase, partial [Hieracium intybaceum]
Length=95

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDD+SLQ+VLDMTADWT  ER MLRNKVP SGL TPFRDGLLKHVAQ+V+  
Sbjct  1    PAFWVGILYDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQEVVSF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            AK GLERRGYKETGFLN V EVV TG+TPAEKLLE
Sbjct  61   AKDGLERRGYKETGFLNEVTEVVRTGLTPAEKLLE  95



>ref|WP_011413551.1| glutamate--cysteine ligase [Erythrobacter litoralis]
 gb|ABC62675.1| glutamate-cysteine ligase precursor [Erythrobacter litoralis 
HTCC2594]
Length=456

 Score =   158 bits (399),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYDD +L +  D+  DW+M ERE LRN
Sbjct  311  FPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDDSALDAAWDLVKDWSMEEREALRN  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VP+  L+ P   G  L+ +A+DVL +A+ GL  R      G  ETGFL+ + E+V TG 
Sbjct  371  AVPRLALDAPIPGGHRLQDLARDVLKIARQGLTARARLGESGDNETGFLSTLDEIVETGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFE  318
             PA++LL++YHG+WG ++  V++
Sbjct  431  VPAQRLLDMYHGEWGGDIKRVYK  453


 Score = 55.1 bits (131),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID  G SFRDF+ GKL  +PGE P  +DW +HL+T FP
Sbjct  273  KYIDAAGHSFRDFLDGKLSVLPGEKPRPSDWWDHLSTAFP  312



>ref|WP_043153593.1| glutamate--cysteine ligase [Sphingobium sp. Ant17]
 gb|EXS68864.1| glutamate--cysteine ligase [Sphingobium sp. Ant17]
Length=457

 Score =   149 bits (377),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  ++  DW M +R++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWGRICALPALWVGLLYDQGALDAAWNLVKDWNMEDRQILRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGV  387
             VP+ GL+ P   G  L+ +AQ VL +A+ GL  RG        ETG+L+ + EVV++G 
Sbjct  371  SVPRLGLDAPIGGGRTLRDIAQPVLDIARAGLVARGRLNAAGDNETGYLSGLEEVVSSGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            T AE+LL+ YHG+WG +V  V+ E
Sbjct  431  THAERLLDRYHGEWGGDVSKVYAE  454


 Score = 63.5 bits (153),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID +G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDASGLSFRDFLDGKLSALPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_032972191.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
Length=454

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHGDVDPVFREFAY  454


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM  KLP +PG  PT+ DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQAKLPVLPGALPTMRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_010187657.1| glutamate--cysteine ligase [Sphingomonas sp. PAMC 26605]
Length=462

 Score =   151 bits (381),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 99/147 (67%), Gaps = 7/147 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW ++CALPA WVGLLYD  +L +  D+  DWT+ ER+ LR+
Sbjct  316  FPEVRLKTFLEMRGADGGPWNKICALPALWVGLLYDQGALDAAWDLVKDWTIDERQALRD  375

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A  V+ ++  GL  R      G  ETGFL+ + EVV +G 
Sbjct  376  AVPKLGLDAPVAGGRTLRDIAGQVVDISSAGLTARARLDASGSNETGFLDPLREVVRSGK  435

Query  386  TPAEKLLELYHGKWGQNVDPVFEELLY  306
             PA+ LL+ YHG WG +V  V++EL +
Sbjct  436  VPAQVLLDKYHGVWGGDVSKVYDELRF  462


 Score = 62.0 bits (149),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID  G+SFRDF+ G+L  +PGE PTL+DW +HL+T FP
Sbjct  278  KYIDAAGLSFRDFLRGELSVLPGEKPTLDDWTDHLSTAFP  317



>ref|WP_006955629.1| Glutamate--cysteine ligase [Sphingobium japonicum]
 emb|CCW17705.1| Glutamate--cysteine ligase [Sphingobium japonicum BiD32]
Length=457

 Score =   150 bits (378),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 7/144 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRG+DGGPW R+CALPA WVGLLYD  +L +  D+  DW+M +R++LR+
Sbjct  311  FPEVRLKSFLEMRGSDGGPWGRICALPALWVGLLYDQGALDAAWDLVKDWSMEDRQILRD  370

Query  545  KVPKSGLNTPFRDG-LLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGV  387
             VPK GL+ P   G  L+ +A+  L +A+ GL  R      G  ETG+L+ + EVV++G 
Sbjct  371  SVPKLGLDAPIGKGRTLRDIARPALDIARSGLTARARLNAAGDNETGYLSDLEEVVSSGK  430

Query  386  TPAEKLLELYHGKWGQNVDPVFEE  315
            T AE+LL+ YHG+WG +V  V+ E
Sbjct  431  THAERLLDRYHGEWGGDVSKVYAE  454


 Score = 63.2 bits (152),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPR  718
            KYID +G+SFRDF+ GKL  +PGE PT  DWE+HL+T FP 
Sbjct  273  KYIDASGLSFRDFLDGKLSVLPGEKPTEKDWEDHLSTAFPE  313



>ref|WP_008995338.1| glutamate--cysteine ligase [Novosphingobium sp. Rr 2-17]
 gb|EIZ78863.1| glutamate--cysteine ligase [Novosphingobium sp. Rr 2-17]
Length=462

 Score =   151 bits (381),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK +LEMRGADGGPW R+CALPA WVGLLYD  +L +  D+  DW M  RE+LR+
Sbjct  316  FPEVRLKSFLEMRGADGGPWSRICALPALWVGLLYDQGALDAAWDLVKDWDMEGRELLRS  375

Query  545  KVPKSGLNTPFR-DGLLKHVAQDVLHLAKGGLERRGY------KETGFLNAVAEVVNTGV  387
             VPK GL+ P    G L+ +A +VL +++ GL  RG        ETG+L  +AE+V  G 
Sbjct  376  SVPKLGLDAPLPGGGTLRDIAGEVLDISRSGLAARGKLNASGDNETGYLEPLAEIVAAGK  435

Query  386  TPAEKLLELYHGKWGQNVDPVF  321
             PAE+LL+LY+G WGQ++  ++
Sbjct  436  VPAERLLDLYNGAWGQDLSQIY  457


 Score = 61.6 bits (148),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            +YID  G+SFRDF+ G+L  +PGE PT++DW++HL+T FP
Sbjct  278  RYIDAAGLSFRDFLKGELSVLPGELPTVSDWQDHLSTAFP  317



>ref|WP_012512090.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|ACF53097.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia R551-3]
Length=454

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHGDVDPVFREFAY  454


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM GKLP +PG  PT+ DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQGKLPILPGALPTMRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_014038468.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|AEM52750.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia JV3]
Length=454

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHGDVDPVFREFAY  454


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM  +LP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQARLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_014648396.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 emb|CCH14101.1| Glutamate--cysteine ligase [Stenotrophomonas maltophilia D457]
 gb|KDE89209.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia M30]
Length=454

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKHAMNLPFRNGTVRDLAREAVKISVEGLRRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHGDVDPVFREFAY  454


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM  +LP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQARLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>ref|WP_019336459.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
Length=454

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  309  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  369  GVPKYAMNLPFRNGTVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  429  PAERKLALFHGRWHGDVDPVFREFAY  454


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM G+LP +PG  PTL DW +H+TT FP     K   + G   G W  L
Sbjct  272  YHDASGQSFRDFMQGRLPVLPGALPTLRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  331

Query  666  AAI  658
             A+
Sbjct  332  CAL  334



>emb|CCP17893.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia RA8]
Length=473

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK+YLEMRGADGGPW RLCALPAFWVGLLYDD +L +  D+  D+T+ ER  LR+
Sbjct  328  FPEVRLKKYLEMRGADGGPWSRLCALPAFWVGLLYDDTALDAAWDLVRDFTLAERHALRD  387

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VPK  +N PFR+G ++ +A++ + ++  GL+RR      G  E+ FL+ + E+V +G+T
Sbjct  388  GVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRRAARNADGQDESKFLDVLQEIVESGLT  447

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+ L L+HG+W  +VDPVF E  Y
Sbjct  448  PAERKLALFHGRWHGDVDPVFREFAY  473


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 3/63 (5%)
 Frame = -1

Query  837  YIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRTL  667
            Y D +G SFRDFM  KLP +PG  PT+ DW +H+TT FP     K   + G   G W  L
Sbjct  291  YHDASGQSFRDFMQAKLPVLPGALPTMRDWSDHMTTAFPEVRLKKYLEMRGADGGPWSRL  350

Query  666  AAI  658
             A+
Sbjct  351  CAL  353



>gb|ADR66080.1| gamma-glutamylcysteine synthetase, partial [Hieracium umbellatum]
Length=96

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  647  PAFWVGLLYDDISLQSVLDMTADWTMGEREMLRNKVPKSGLNTPFRDGLLKHVAQDVLHL  468
            PAFWVG+LYDD+SLQ+VLDMTADWT  ER+MLRNKVP SGL TP RDGLLKHVAQ+V+  
Sbjct  1    PAFWVGILYDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPLRDGLLKHVAQEVVSF  60

Query  467  AKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLLE  363
            AK GLERRGYKETGFLN V EVV TG+TPAEKLLE
Sbjct  61   AKDGLERRGYKETGFLNEVTEVVRTGLTPAEKLLE  95



>dbj|GAN00159.1| glutamate--cysteine ligase [alpha proteobacterium U9-1i]
Length=454

 Score =   149 bits (375),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 93/146 (64%), Gaps = 6/146 (4%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK YLEMRGAD GPW RLCALPAFW G++Y D +L++   +   WT  +RE LR 
Sbjct  309  FPEVRLKTYLEMRGADSGPWSRLCALPAFWAGIMYCDAALEAAWSLVKSWTAEDREALRR  368

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERR------GYKETGFLNAVAEVVNTGVT  384
             VP  GL  P R    + +AQ  L +A+ GL+ R      G  ET FL  + ++  +GVT
Sbjct  369  AVPVLGLKAPIRGVTAQDIAQASLAIARQGLKSRAQLDSGGQDETHFLAELDDIAASGVT  428

Query  383  PAEKLLELYHGKWGQNVDPVFEELLY  306
            PAE+LLE YH +W ++V PVFE   Y
Sbjct  429  PAERLLERYHTEWKRDVRPVFEACAY  454


 Score = 63.5 bits (153),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFP  721
            KYID +G SFR FM GKL  +PGE PT  DWE+HLTTIFP
Sbjct  271  KYIDLSGRSFRKFMDGKLDELPGERPTKKDWEDHLTTIFP  310



>ref|XP_001701647.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
 gb|EDP06622.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
Length=479

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  725  FPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDISLQSVLDMTADWTMGEREMLRN  546
            FPEVRLK++LEMRGADGGPWR LCALPA WVGL+YD  + +  L +  DWT  ER+ LR 
Sbjct  340  FPEVRLKKFLEMRGADGGPWRMLCALPALWVGLIYDPEAQRQALALIEDWTPAERDYLRT  399

Query  545  KVPKSGLNTPFRDGLLKHVAQDVLHLAKGGLERRGYKETGFLNAVAEVVNTGVTPAEKLL  366
            +V + GL TPFR G ++ VA+ V+ +A GGLERRGY ET FL  +  +  TG+T A+ LL
Sbjct  400  EVTRFGLRTPFRAGTVQDVAKQVVSIAHGGLERRGYDETSFLKRLEVIAETGLTQADHLL  459

Query  365  ELYHGKWGQNVDPVFEELLY  306
            ELY  KW ++VDP+++E +Y
Sbjct  460  ELYETKWQRSVDPLYKEFMY  479


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  840  KYIDCTGMSFRDFMAGKLPPIPGEYPTLNDWENHLTTIFPRGET*K---VPGNARGRWRT  670
            +YI+  GMS++DFMAGKLP +PGEYPT+ DW NHLTTIFP     K   + G   G WR 
Sbjct  302  QYINALGMSWKDFMAGKLPALPGEYPTIADWANHLTTIFPEVRLKKFLEMRGADGGPWRM  361

Query  669  LAAI  658
            L A+
Sbjct  362  LCAL  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1826294691389