BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5449

Length=918
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084036.1|  PREDICTED: uncharacterized protein LOC105166393    218   3e-61   Sesamum indicum [beniseed]
ref|XP_009595430.1|  PREDICTED: uncharacterized protein LOC104091732    218   4e-61   Nicotiana tomentosiformis
ref|XP_009769069.1|  PREDICTED: uncharacterized protein LOC104219993    217   1e-60   Nicotiana sylvestris
emb|CDP10517.1|  unnamed protein product                                207   2e-57   Coffea canephora [robusta coffee]
ref|XP_010323258.1|  PREDICTED: uncharacterized protein LOC101249097    200   2e-54   Solanum lycopersicum
ref|XP_006359539.1|  PREDICTED: uncharacterized protein LOC102594159    184   5e-49   Solanum tuberosum [potatoes]
ref|XP_003549703.1|  PREDICTED: uncharacterized protein LOC100781443    175   6e-46   Glycine max [soybeans]
ref|XP_003542623.1|  PREDICTED: uncharacterized protein LOC100802615    169   8e-44   Glycine max [soybeans]
ref|XP_010542083.1|  PREDICTED: uncharacterized protein LOC104815398    166   1e-42   Tarenaya hassleriana [spider flower]
gb|EEC83275.1|  hypothetical protein OsI_28629                          162   5e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_007013705.1|  Zinc finger protein, putative isoform 2            163   8e-42   
ref|XP_006660014.1|  PREDICTED: uncharacterized protein LOC102712285    162   1e-41   Oryza brachyantha
ref|XP_007013704.1|  Zinc finger protein, putative isoform 1            163   1e-41   
gb|EEE68404.1|  hypothetical protein OsJ_26758                          162   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061456.1|  Os08g0288500                                       162   4e-41   
dbj|BAJ84968.1|  predicted protein                                      153   7e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009358504.1|  PREDICTED: uncharacterized protein LOC103949129    159   2e-40   
ref|XP_011017950.1|  PREDICTED: uncharacterized protein LOC105121122    158   8e-40   Populus euphratica
gb|KJB64581.1|  hypothetical protein B456_010G054900                    158   9e-40   Gossypium raimondii
ref|XP_009338424.1|  PREDICTED: uncharacterized protein LOC103930775    157   2e-39   
gb|KEH32162.1|  D111/G-patch domain protein                             157   3e-39   Medicago truncatula
ref|XP_002325162.2|  D111/G-patch domain-containing family protein      156   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_004973180.1|  PREDICTED: uncharacterized protein LOC101758421    156   5e-39   Setaria italica
gb|EMT16376.1|  Tuftelin-interacting protein 11                         155   8e-39   
ref|XP_008801999.1|  PREDICTED: uncharacterized protein LOC103715...    155   9e-39   
ref|XP_008801998.1|  PREDICTED: uncharacterized protein LOC103715...    155   1e-38   Phoenix dactylifera
gb|EYU25294.1|  hypothetical protein MIMGU_mgv1a003157mg                153   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_006381899.1|  hypothetical protein POPTR_0006s20370g             146   6e-38   
ref|XP_011033482.1|  PREDICTED: uncharacterized protein LOC105131955    152   1e-37   Populus euphratica
ref|XP_002523543.1|  zinc finger protein, putative                      152   1e-37   Ricinus communis
ref|XP_003573663.1|  PREDICTED: uncharacterized protein LOC100845409    151   2e-37   Brachypodium distachyon [annual false brome]
gb|AES91716.2|  D111/G-patch domain protein                             151   4e-37   Medicago truncatula
ref|XP_010687767.1|  PREDICTED: uncharacterized protein LOC104901840    150   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003609519.1|  Zinc finger CCCH-type with G patch domain-co...    150   6e-37   
ref|XP_010913385.1|  PREDICTED: uncharacterized protein LOC105039...    149   2e-36   Elaeis guineensis
ref|XP_010913384.1|  PREDICTED: uncharacterized protein LOC105039...    148   2e-36   Elaeis guineensis
ref|XP_010042746.1|  PREDICTED: septin and tuftelin-interacting p...    142   2e-36   
ref|XP_009387542.1|  PREDICTED: uncharacterized protein LOC103974...    145   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387541.1|  PREDICTED: uncharacterized protein LOC103974...    146   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004508396.1|  PREDICTED: uncharacterized protein LOC101505169    146   2e-35   
ref|XP_010109666.1|  Zinc finger CCCH-type with G patch domain-co...    146   2e-35   
ref|NP_001152479.1|  LOC100286119                                       144   7e-35   Zea mays [maize]
ref|XP_006453696.1|  hypothetical protein CICLE_v10007567mg             144   9e-35   Citrus clementina [clementine]
gb|KCW82693.1|  hypothetical protein EUGRSUZ_C04073                     138   1e-34   Eucalyptus grandis [rose gum]
gb|KCW44417.1|  hypothetical protein EUGRSUZ_L02096                     138   2e-34   Eucalyptus grandis [rose gum]
ref|XP_009366281.1|  PREDICTED: uncharacterized protein LOC103956064    142   2e-34   
ref|XP_009341849.1|  PREDICTED: uncharacterized protein LOC103933875    142   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_009341804.1|  PREDICTED: uncharacterized protein LOC103933838    142   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_007155121.1|  hypothetical protein PHAVU_003G175300g             142   4e-34   Phaseolus vulgaris [French bean]
ref|XP_006407631.1|  hypothetical protein EUTSA_v10020109mg             140   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_012071430.1|  PREDICTED: uncharacterized protein LOC105633456    140   3e-33   Jatropha curcas
ref|XP_008336930.1|  PREDICTED: uncharacterized protein LOC103400027    139   4e-33   
gb|KFK38375.1|  hypothetical protein AALP_AA3G105800                    139   5e-33   Arabis alpina [alpine rockcress]
ref|XP_007203786.1|  hypothetical protein PRUPE_ppa001771mg             137   1e-32   Prunus persica
ref|XP_010265699.1|  PREDICTED: uncharacterized protein LOC104603377    137   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008242893.1|  PREDICTED: uncharacterized protein LOC103341193    137   2e-32   Prunus mume [ume]
ref|XP_011655824.1|  PREDICTED: uncharacterized protein LOC101215...    135   4e-32   Cucumis sativus [cucumbers]
ref|XP_004146703.1|  PREDICTED: uncharacterized protein LOC101215...    135   1e-31   Cucumis sativus [cucumbers]
gb|KGN65218.1|  hypothetical protein Csa_1G266150                       135   1e-31   Cucumis sativus [cucumbers]
ref|XP_011655819.1|  PREDICTED: uncharacterized protein LOC101215...    135   1e-31   Cucumis sativus [cucumbers]
emb|CDY41580.1|  BnaC05g43170D                                          133   6e-31   Brassica napus [oilseed rape]
ref|XP_008443896.1|  PREDICTED: uncharacterized protein LOC103487...    133   7e-31   Cucumis melo [Oriental melon]
ref|XP_008443898.1|  PREDICTED: uncharacterized protein LOC103487...    133   8e-31   Cucumis melo [Oriental melon]
ref|XP_010464642.1|  PREDICTED: uncharacterized protein LOC104745...    132   8e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010464640.1|  PREDICTED: uncharacterized protein LOC104745...    132   8e-31   
ref|XP_002884758.1|  hypothetical protein ARALYDRAFT_478310             132   8e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010486559.1|  PREDICTED: dentin sialophosphoprotein-like i...    131   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010486561.1|  PREDICTED: dentin sialophosphoprotein-like i...    131   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010477969.1|  PREDICTED: uncharacterized protein LOC104756959    131   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010244790.1|  PREDICTED: uncharacterized protein LOC104588524    129   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004287228.1|  PREDICTED: uncharacterized protein LOC101294206    129   1e-29   Fragaria vesca subsp. vesca
ref|XP_006299668.1|  hypothetical protein CARUB_v10015856mg             129   2e-29   Capsella rubella
emb|CDY54616.1|  BnaA05g28700D                                          128   3e-29   Brassica napus [oilseed rape]
ref|XP_010041360.1|  PREDICTED: zinc finger CCCH-type with G patc...    122   7e-29   
ref|XP_009146893.1|  PREDICTED: uncharacterized protein LOC103870513    126   1e-28   Brassica rapa
ref|NP_566359.1|  D111/G-patch domain-containing protein                125   4e-28   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA46961.1|  TPA: hypothetical protein ZEAMMB73_831663              115   1e-27   
ref|XP_010040586.1|  PREDICTED: probable LRR receptor-like serine...    118   1e-25   
gb|KCW82695.1|  hypothetical protein EUGRSUZ_C04076                     103   2e-23   Eucalyptus grandis [rose gum]
emb|CBI25601.3|  unnamed protein product                                105   1e-21   Vitis vinifera
ref|XP_002265219.2|  PREDICTED: uncharacterized protein LOC100260114    105   1e-21   Vitis vinifera
gb|EPS60366.1|  hypothetical protein M569_14436                       82.0    2e-16   Genlisea aurea
gb|KDO59352.1|  hypothetical protein CISIN_1g043289mg                 81.3    1e-13   Citrus sinensis [apfelsine]
ref|XP_001776479.1|  predicted protein                                79.7    4e-13   
ref|XP_001418877.1|  predicted protein                                68.9    3e-11   Ostreococcus lucimarinus CCE9901
ref|XP_003080235.1|  Tuftelin-interacting protein TIP39, contains...  70.5    6e-11   
emb|CEF98642.1|  G-patch domain                                       70.9    2e-10   Ostreococcus tauri
ref|XP_005645320.1|  hypothetical protein COCSUDRAFT_57335            70.9    3e-10   Coccomyxa subellipsoidea C-169
emb|CDQ06825.1|  Protein Bm9097, isoform a                            69.3    8e-10   
ref|XP_006679437.1|  hypothetical protein BATDEDRAFT_25372            69.3    1e-09   Batrachochytrium dendrobatidis JAM81
ref|XP_002163283.2|  PREDICTED: tuftelin-interacting protein 11-like  68.2    3e-09   
ref|XP_011650047.1|  PREDICTED: septin and tuftelin-interacting p...  68.2    3e-09   Cucumis sativus [cucumbers]
ref|XP_008462814.1|  PREDICTED: tuftelin-interacting protein 11       68.2    3e-09   Cucumis melo [Oriental melon]
ref|XP_010094613.1|  Tuftelin-interacting protein 11                  68.2    3e-09   
ref|XP_010906679.1|  PREDICTED: septin and tuftelin-interacting p...  67.8    4e-09   Elaeis guineensis
emb|CBI26422.3|  unnamed protein product                              67.4    4e-09   Vitis vinifera
ref|XP_002501462.1|  predicted protein                                67.8    4e-09   Micromonas commoda
ref|XP_004300043.1|  PREDICTED: septin and tuftelin-interacting p...  67.4    5e-09   Fragaria vesca subsp. vesca
ref|XP_010553814.1|  PREDICTED: septin and tuftelin-interacting p...  66.2    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_003080850.1|  Tuftelin-interacting protein TIP39, contains...  64.7    2e-08   Ostreococcus tauri
gb|EHB00444.1|  G patch domain-containing protein 2                   65.1    2e-08   Heterocephalus glaber [naked mole rat]
ref|XP_004880608.1|  PREDICTED: G patch domain-containing protein...  65.1    2e-08   
ref|XP_010065638.1|  PREDICTED: septin and tuftelin-interacting p...  65.1    3e-08   Eucalyptus grandis [rose gum]
ref|XP_005850261.1|  hypothetical protein CHLNCDRAFT_50559            65.1    3e-08   Chlorella variabilis
ref|XP_008804692.1|  PREDICTED: septin and tuftelin-interacting p...  65.1    3e-08   Phoenix dactylifera
gb|KII63443.1|  Tuftelin-interacting protein 11                       64.7    3e-08   Thelohanellus kitauei
gb|EMP37184.1|  Tuftelin-interacting protein 11                       64.7    4e-08   Chelonia mydas [green seaturtle]
gb|KJB73095.1|  hypothetical protein B456_011G214400                  64.3    4e-08   Gossypium raimondii
ref|XP_012070277.1|  PREDICTED: septin and tuftelin-interacting p...  64.7    4e-08   Jatropha curcas
gb|KHG03685.1|  Tuftelin-interacting 11                               64.3    4e-08   Gossypium arboreum [tree cotton]
gb|ELK08915.1|  G patch domain-containing protein 2                   60.1    5e-08   Pteropus alecto
gb|KJB44347.1|  hypothetical protein B456_007G247300                  64.3    5e-08   Gossypium raimondii
ref|NP_001090845.1|  tuftelin-interacting protein 11                  64.3    5e-08   Xenopus tropicalis [western clawed frog]
sp|Q0IIX9.2|TFP11_XENTR  RecName: Full=Tuftelin-interacting prote...  64.3    5e-08   Xenopus tropicalis [western clawed frog]
ref|XP_010459271.1|  PREDICTED: septin and tuftelin-interacting p...  63.9    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_005649692.1|  TFP11-domain-containing protein                  63.9    6e-08   Coccomyxa subellipsoidea C-169
ref|XP_011399724.1|  hypothetical protein F751_0708                   63.5    8e-08   Auxenochlorella protothecoides
ref|XP_011098023.1|  PREDICTED: septin and tuftelin-interacting p...  63.5    9e-08   Sesamum indicum [beniseed]
ref|XP_001702893.1|  predicted protein                                63.5    9e-08   Chlamydomonas reinhardtii
emb|CDP06007.1|  unnamed protein product                              63.5    9e-08   Coffea canephora [robusta coffee]
ref|XP_009397719.1|  PREDICTED: septin and tuftelin-interacting p...  63.5    1e-07   
ref|XP_010256250.1|  PREDICTED: septin and tuftelin-interacting p...  63.2    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008339239.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.2    1e-07   
ref|XP_001773432.1|  predicted protein                                63.2    1e-07   
ref|XP_002506795.1|  hypothetical protein MICPUN_113307               63.2    1e-07   Micromonas commoda
gb|ABC69949.1|  STIP                                                  63.2    1e-07   Chlamydomonas reinhardtii
ref|XP_010670678.1|  PREDICTED: septin and tuftelin-interacting p...  63.2    1e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|KIZ04951.1|  Tuftelin-interacting protein 11                       63.2    1e-07   Monoraphidium neglectum
ref|XP_004751526.1|  PREDICTED: G patch domain-containing protein 2   62.8    1e-07   Mustela putorius furo [black ferret]
ref|XP_010597714.1|  PREDICTED: G patch domain-containing protein...  62.8    1e-07   Loxodonta africana [African bush elephant]
ref|XP_006890634.1|  PREDICTED: G patch domain-containing protein...  62.8    1e-07   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002325453.2|  D111/G-patch domain-containing family protein    62.8    2e-07   
ref|XP_008608077.1|  hypothetical protein SDRG_04193                  62.8    2e-07   Saprolegnia diclina VS20
ref|XP_009399051.1|  PREDICTED: septin and tuftelin-interacting p...  62.8    2e-07   
ref|XP_009861899.1|  PREDICTED: sip1/TFIP11 interacting protein i...  62.8    2e-07   Ciona intestinalis [sea vase]
ref|NP_001091088.1|  Sip1/TFIP11 interacting protein                  62.4    2e-07   Ciona intestinalis [sea vase]
emb|CBK20550.2|  unnamed protein product                              58.5    2e-07   Blastocystis hominis
ref|XP_002524028.1|  tuftelin interacting protein, putative           62.4    2e-07   Ricinus communis
gb|EHH50537.1|  hypothetical protein EGM_01387                        62.0    2e-07   Macaca fascicularis [crab eating macaque]
gb|EHH15544.1|  hypothetical protein EGK_01651                        62.0    2e-07   Macaca mulatta [rhesus macaque]
ref|XP_006848800.1|  PREDICTED: uncharacterized protein LOC18438554   62.4    2e-07   Amborella trichopoda
ref|XP_005540923.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Macaca fascicularis [crab eating macaque]
ref|XP_009117727.1|  PREDICTED: septin and tuftelin-interacting p...  62.4    2e-07   Brassica rapa
ref|XP_006761403.1|  PREDICTED: G patch domain-containing protein 2   62.0    2e-07   Myotis davidii
gb|ELK32169.1|  G patch domain-containing protein 2                   62.0    2e-07   Myotis davidii
gb|EPQ16193.1|  G patch domain-containing protein 2                   62.0    2e-07   Myotis brandtii
ref|XP_004415667.1|  PREDICTED: G patch domain-containing protein 2   62.0    2e-07   Odobenus rosmarus divergens
ref|XP_005879952.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Myotis brandtii
ref|XP_007986612.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Chlorocebus sabaeus
gb|ETE71201.1|  Tuftelin-interacting protein 11                       62.0    2e-07   Ophiophagus hannah
ref|XP_007986613.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Chlorocebus sabaeus
ref|XP_003893154.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Papio anubis [baboon]
ref|XP_001781004.1|  predicted protein                                62.0    2e-07   
ref|XP_010361517.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Rhinopithecus roxellana
ref|XP_005540922.1|  PREDICTED: G patch domain-containing protein...  62.0    2e-07   Macaca fascicularis [crab eating macaque]
ref|XP_005540921.1|  PREDICTED: G patch domain-containing protein...  62.0    3e-07   Macaca fascicularis [crab eating macaque]
ref|XP_010662048.1|  PREDICTED: septin and tuftelin-interacting p...  62.0    3e-07   Vitis vinifera
ref|XP_008683891.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   Ursus maritimus [white bear]
ref|XP_004685296.1|  PREDICTED: G patch domain-containing protein 2   62.0    3e-07   
ref|XP_011232417.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   
ref|XP_005540924.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   Macaca fascicularis [crab eating macaque]
ref|XP_007443812.1|  PREDICTED: tuftelin-interacting protein 11       62.0    3e-07   Python bivittatus
emb|CDY21767.1|  BnaA09g45180D                                        62.0    3e-07   Brassica napus [oilseed rape]
ref|XP_007029764.1|  GC-rich sequence DNA-binding factor-like pro...  62.0    3e-07   
ref|XP_002926699.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   Ailuropoda melanoleuca
ref|XP_006203714.1|  PREDICTED: G patch domain-containing protein 2   61.6    3e-07   
ref|XP_006188221.1|  PREDICTED: G patch domain-containing protein 2   61.6    3e-07   
ref|XP_008683889.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   Ursus maritimus [white bear]
ref|XP_007058458.1|  PREDICTED: tuftelin-interacting protein 11       62.0    3e-07   Chelonia mydas [green seaturtle]
ref|XP_005298544.1|  PREDICTED: tuftelin-interacting protein 11       62.0    3e-07   Chrysemys picta bellii
ref|XP_010972318.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   Camelus bactrianus [camel]
ref|XP_008148048.1|  PREDICTED: G patch domain-containing protein 2   61.6    3e-07   Eptesicus fuscus
ref|XP_006137534.1|  PREDICTED: tuftelin-interacting protein 11       62.0    3e-07   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_002089187.1|  Sip1-TFIP11 interacting protein                  62.0    3e-07   Drosophila yakuba
gb|KDO27238.1|  hypothetical protein SPRG_07487                       62.0    3e-07   Saprolegnia parasitica CBS 223.65
ref|XP_011507993.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   Homo sapiens [man]
ref|XP_002078265.1|  GD23359                                          61.6    3e-07   
ref|XP_008965018.1|  PREDICTED: G patch domain-containing protein...  61.6    3e-07   
ref|XP_002955122.1|  hypothetical protein VOLCADRAFT_65509            61.6    3e-07   Volvox carteri f. nagariensis
ref|XP_010498050.1|  PREDICTED: septin and tuftelin-interacting p...  61.6    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009616302.1|  PREDICTED: septin and tuftelin-interacting p...  61.6    4e-07   Nicotiana tomentosiformis
ref|XP_001172096.1|  PREDICTED: G patch domain-containing protein...  61.2    4e-07   Pan troglodytes
ref|XP_009616253.1|  PREDICTED: septin and tuftelin-interacting p...  61.6    4e-07   Nicotiana tomentosiformis
ref|XP_009801630.1|  PREDICTED: septin and tuftelin-interacting p...  61.6    4e-07   Nicotiana sylvestris
ref|XP_002037985.1|  Sip1-TFIP11 interacting protein                  61.6    4e-07   Drosophila sechellia
ref|XP_009603610.1|  PREDICTED: septin and tuftelin-interacting p...  61.6    4e-07   Nicotiana tomentosiformis
ref|XP_005959627.1|  PREDICTED: tuftelin-interacting protein 11-l...  60.5    4e-07   Pantholops hodgsonii [Tibetan antelope]
ref|XP_009439775.1|  PREDICTED: G patch domain-containing protein...  61.2    4e-07   
ref|NP_060510.1|  G patch domain-containing protein 2 isoform 1       61.2    4e-07   Homo sapiens [man]
ref|XP_011507991.1|  PREDICTED: G patch domain-containing protein...  61.2    4e-07   Homo sapiens [man]
gb|ELW55478.1|  G patch domain-containing protein 2                   57.4    4e-07   Tupaia chinensis
ref|XP_003265143.1|  PREDICTED: G patch domain-containing protein 2   61.2    4e-07   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006943032.1|  PREDICTED: G patch domain-containing protein...  61.2    4e-07   Felis catus [cat]
gb|ABC69931.1|  STIP                                                  61.2    4e-07   Ciona savignyi [transparent tunicate]
ref|XP_001968838.1|  GG25092                                          61.2    5e-07   Drosophila erecta
ref|XP_006836389.1|  PREDICTED: septin and tuftelin-interacting p...  61.2    5e-07   Amborella trichopoda
ref|XP_006015340.1|  PREDICTED: tuftelin-interacting protein 11       61.2    5e-07   
ref|XP_006261823.1|  PREDICTED: tuftelin-interacting protein 11       61.2    5e-07   Alligator mississippiensis
ref|XP_011507992.1|  PREDICTED: G patch domain-containing protein...  60.8    5e-07   Homo sapiens [man]
ref|XP_011237225.1|  PREDICTED: G patch domain-containing protein...  60.1    5e-07   Mus musculus [mouse]
gb|KFK43898.1|  hypothetical protein AALP_AA1G188300                  61.2    5e-07   Arabis alpina [alpine rockcress]
ref|XP_010528677.1|  PREDICTED: septin and tuftelin-interacting p...  61.2    5e-07   Tarenaya hassleriana [spider flower]
dbj|BAC38928.1|  unnamed protein product                              60.1    5e-07   Mus musculus [mouse]
ref|XP_003930395.1|  PREDICTED: G patch domain-containing protein...  60.8    5e-07   Saimiri boliviensis boliviensis
ref|NP_001087642.1|  tuftelin-interacting protein 11                  61.2    5e-07   
ref|XP_006916287.1|  PREDICTED: G patch domain-containing protein...  60.8    6e-07   Pteropus alecto
ref|XP_001419174.1|  predicted protein                                59.7    6e-07   Ostreococcus lucimarinus CCE9901
ref|XP_006352537.1|  PREDICTED: tuftelin-interacting protein 11-like  60.8    6e-07   Solanum tuberosum [potatoes]
ref|XP_007471923.1|  PREDICTED: G patch domain-containing protein 2   60.8    6e-07   Lipotes vexillifer [baiji]
gb|AAF26743.1|AF221101_1  septin interacting protein                  60.8    6e-07   Drosophila melanogaster
ref|NP_524725.2|  septin interacting protein 1, isoform A             60.8    6e-07   Drosophila melanogaster
gb|ELW66488.1|  Tuftelin-interacting protein 11                       60.5    7e-07   Tupaia chinensis
ref|XP_004248294.1|  PREDICTED: septin and tuftelin-interacting p...  60.8    7e-07   Solanum lycopersicum
ref|XP_006094376.1|  PREDICTED: G patch domain-containing protein 2   57.8    7e-07   Myotis lucifugus
ref|XP_010692950.1|  PREDICTED: zinc finger CCCH domain-containin...  60.5    7e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011784827.1|  PREDICTED: G patch domain-containing protein...  60.5    7e-07   Colobus angolensis palliatus
dbj|BAC26744.1|  unnamed protein product                              60.5    7e-07   Mus musculus [mouse]
ref|XP_004615574.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Sorex araneus [Eurasian shrew]
ref|XP_004613109.1|  PREDICTED: G patch domain-containing protein 2   60.8    7e-07   
ref|XP_010580348.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Haliaeetus leucocephalus
ref|XP_007082564.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.8    7e-07   
ref|XP_008140712.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Eptesicus fuscus
ref|XP_006497258.1|  PREDICTED: G patch domain-containing protein...  60.5    7e-07   Mus musculus [mouse]
ref|XP_006762106.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Myotis davidii
ref|XP_009927441.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Haliaeetus albicilla
gb|EDL13047.1|  G patch domain containing 2, isoform CRA_c            60.5    7e-07   Mus musculus [mouse]
ref|XP_006938603.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.8    7e-07   
ref|XP_006938601.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.8    7e-07   
ref|XP_009490572.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Pelecanus crispus
gb|KFR00697.1|  Tuftelin-interacting protein 11                       60.8    7e-07   Nipponia nippon
ref|XP_010294372.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Phaethon lepturus
ref|XP_005869775.1|  PREDICTED: tuftelin-interacting protein 11       60.8    7e-07   Myotis brandtii
gb|KFP23981.1|  Tuftelin-interacting protein 11                       60.5    7e-07   Colius striatus
gb|KFO95848.1|  Tuftelin-interacting protein 11                       60.8    8e-07   Calypte anna
gb|KFQ43028.1|  Tuftelin-interacting protein 11                       60.8    8e-07   Nestor notabilis
gb|KFM09886.1|  Tuftelin-interacting protein 11                       60.8    8e-07   Aptenodytes forsteri
gb|KFW83342.1|  Tuftelin-interacting protein 11                       60.8    8e-07   Manacus vitellinus
ref|XP_006102063.1|  PREDICTED: tuftelin-interacting protein 11       60.8    8e-07   Myotis lucifugus
ref|NP_594091.1|  RNA-binding splicing factor (predicted)             60.8    8e-07   Schizosaccharomyces pombe
ref|XP_008492988.1|  PREDICTED: tuftelin-interacting protein 11       60.8    8e-07   Calypte anna
ref|XP_010208491.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Colius striatus
ref|XP_009908031.1|  PREDICTED: tuftelin-interacting protein 11       60.8    8e-07   Picoides pubescens
ref|XP_010016065.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Nestor notabilis
ref|XP_011588379.1|  PREDICTED: tuftelin-interacting protein 11       60.8    8e-07   Aquila chrysaetos canadensis
ref|XP_005498249.1|  PREDICTED: tuftelin-interacting protein 11       60.8    8e-07   
ref|XP_006497260.1|  PREDICTED: G patch domain-containing protein...  60.5    8e-07   
ref|XP_009983332.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Tauraco erythrolophus
ref|XP_008220637.1|  PREDICTED: zinc finger CCCH domain-containin...  60.5    8e-07   Prunus mume [ume]
ref|XP_002197903.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Taeniopygia guttata
ref|XP_005230545.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_009957952.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.5    8e-07   Leptosomus discolor
gb|KFV77367.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Picoides pubescens
ref|XP_010176320.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Antrostomus carolinensis
gb|KFP95623.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Haliaeetus albicilla
ref|XP_009707726.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Cariama cristata
ref|XP_008925041.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_007227462.1|  hypothetical protein PRUPE_ppa004892mg           60.5    8e-07   
ref|XP_009511274.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Phalacrocorax carbo [common cormorant]
ref|XP_009466848.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Nipponia nippon
gb|AAH54810.1|  G patch domain containing 2                           60.5    8e-07   Mus musculus [mouse]
gb|KFP35899.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Chlamydotis macqueenii
ref|NP_080643.4|  G patch domain-containing protein 2                 60.5    8e-07   Mus musculus [mouse]
gb|KFQ35436.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Merops nubicus
gb|KFW62564.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Pygoscelis adeliae
ref|XP_009571985.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Fulmarus glacialis
gb|KFU89033.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Chaetura pelagica
dbj|BAE28260.1|  unnamed protein product                              60.5    8e-07   Mus musculus [mouse]
ref|XP_009558777.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Cuculus canorus
gb|KFQ48373.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Pelecanus crispus
gb|KFP12550.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Egretta garzetta
ref|XP_008944614.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Merops nubicus
ref|XP_006055630.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    8e-07   Bubalus bubalis [domestic water buffalo]
ref|XP_007082567.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    8e-07   Panthera tigris altaica
ref|XP_009082323.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Acanthisitta chloris
ref|XP_005055056.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Ficedula albicollis
ref|XP_010117527.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   Chlamydotis macqueenii
ref|XP_010396785.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
gb|KFV72048.1|  Tuftelin-interacting protein 11                       60.5    8e-07   Struthio camelus australis
ref|XP_007082566.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    8e-07   Panthera tigris altaica
dbj|BAC35520.1|  unnamed protein product                              60.5    8e-07   
ref|XP_009809419.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
gb|KFV01223.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
ref|XP_010306276.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|NP_001008292.1|  tuftelin-interacting protein 11                  60.5    8e-07   
ref|XP_004387681.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|NP_001039495.2|  tuftelin-interacting protein 11                  60.5    8e-07   
ref|XP_008576508.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_002949572.1|  hypothetical protein VOLCADRAFT_89953            60.8    8e-07   
ref|XP_010131846.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
gb|KGL96598.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
gb|KFZ55957.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
ref|XP_003994807.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    8e-07   
ref|XP_007525292.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
gb|KFO59493.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
gb|ELK18625.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
gb|KFR13925.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
ref|XP_009936877.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
sp|Q29RR5.2|TFP11_BOVIN  RecName: Full=Tuftelin-interacting prote...  60.5    8e-07   
ref|XP_006738156.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_003789889.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|NP_061253.2|  tuftelin-interacting protein 11                     60.5    8e-07   
gb|AAH17682.1|  Tuftelin interacting protein 11                       60.5    8e-07   
gb|KFO88150.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
gb|KFQ79462.1|  Tuftelin-interacting protein 11                       60.5    8e-07   
ref|XP_009090637.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_008632303.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_005524389.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_005421487.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_009633041.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_008684908.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.5    8e-07   
ref|XP_009877288.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_004766607.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    8e-07   
ref|XP_009676417.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_010081004.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_009965680.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
ref|XP_002922821.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
gb|AAI14059.1|  Tuftelin interacting protein 11                       60.5    8e-07   
ref|XP_004429903.1|  PREDICTED: tuftelin-interacting protein 11       60.5    8e-07   
gb|ABC69921.1|  STIP                                                  60.5    8e-07   
gb|EOB05036.1|  Tuftelin-interacting protein 11                       60.5    9e-07   
ref|XP_002002759.1|  GI11229                                          60.5    9e-07   
ref|XP_009281103.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_005489007.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_008847245.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_010188640.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_002051429.1|  GJ12292                                          60.5    9e-07   
ref|XP_009887465.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
gb|KGL84782.1|  Tuftelin-interacting protein 11                       60.5    9e-07   
ref|XP_001499556.2|  PREDICTED: tuftelin-interacting protein 11-like  60.5    9e-07   
ref|XP_007946133.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004690914.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004479136.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
gb|KFQ39573.1|  Tuftelin-interacting protein 11                       60.5    9e-07   
ref|XP_008272828.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_008050251.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_003506733.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004592001.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004283827.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|NP_001070682.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|XP_006904928.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_006185809.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004715371.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004330837.1|  PREDICTED: tuftelin-interacting protein 11-like  60.5    9e-07   
ref|XP_006147932.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.5    9e-07   
ref|XP_010223913.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004893177.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_011967924.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_009006562.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_006984175.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_006890530.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_007627359.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004412506.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
sp|A1XD95.1|TFP11_MACFA  RecName: Full=Tuftelin-interacting prote...  60.5    9e-07   
ref|NP_001073577.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|XP_007461197.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_005344283.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_004893175.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_007181010.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_010827007.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.5    9e-07   
ref|NP_001025836.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|XP_009332696.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_005889904.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.5    9e-07   
ref|XP_006213616.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_005078969.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|NP_001093435.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|NP_001073621.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|NP_001073589.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|XP_007101983.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_005014621.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_004291980.1|  PREDICTED: zinc finger CCCH domain-containin...  60.1    9e-07   
ref|XP_003277776.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.5    9e-07   
gb|AAH33080.1|  Tuftelin interacting protein 11                       60.5    9e-07   
ref|XP_006869252.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_010373885.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|NP_001126744.1|  tuftelin-interacting protein 11                  60.5    9e-07   
ref|XP_010347495.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_003478401.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|NP_036275.1|  tuftelin-interacting protein 11                     60.5    9e-07   
emb|CAL37965.1|  hypothetical protein                                 60.5    9e-07   
ref|XP_004628080.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_005336129.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_010602003.1|  PREDICTED: tuftelin-interacting protein 11       60.5    9e-07   
ref|XP_001499886.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    9e-07   
ref|XP_010718697.1|  PREDICTED: tuftelin-interacting protein 11       60.5    1e-06   
ref|XP_009995165.1|  PREDICTED: tuftelin-interacting protein 11       60.5    1e-06   
emb|CDX81801.1|  BnaC08g38000D                                        60.5    1e-06   
ref|XP_003761206.1|  PREDICTED: tuftelin-interacting protein 11       60.5    1e-06   
ref|XP_005396205.1|  PREDICTED: tuftelin-interacting protein 11       60.5    1e-06   
gb|ELR60645.1|  Tuftelin-interacting protein 11                       60.5    1e-06   
ref|NP_001091078.1|  tuftelin-interacting protein 11                  60.5    1e-06   
ref|XP_005691760.1|  PREDICTED: tuftelin-interacting protein 11       60.1    1e-06   
ref|XP_005374769.1|  PREDICTED: G patch domain-containing protein...  60.1    1e-06   
ref|XP_004017498.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.1    1e-06   
emb|CEP17389.1|  hypothetical protein                                 60.5    1e-06   
ref|XP_005144938.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  60.1    1e-06   
ref|XP_005374768.1|  PREDICTED: G patch domain-containing protein...  60.1    1e-06   
ref|XP_001757427.1|  predicted protein                                60.1    1e-06   
ref|XP_007442990.1|  PREDICTED: zinc finger CCCH-type with G patc...  58.5    1e-06   
ref|XP_006306528.1|  hypothetical protein CARUB_v10012542mg           60.1    1e-06   
gb|ACR37118.1|  unknown                                               55.1    1e-06   
ref|XP_011014808.1|  PREDICTED: septin and tuftelin-interacting p...  60.1    1e-06   
gb|KFH45698.1|  G-patch domain-containing protein -like protein       60.1    1e-06   
ref|XP_011044415.1|  PREDICTED: septin and tuftelin-interacting p...  60.1    1e-06   
ref|XP_002319771.1|  D111/G-patch domain-containing family protein    60.1    1e-06   
ref|XP_009359150.1|  PREDICTED: zinc finger CCCH domain-containin...  59.7    1e-06   
ref|XP_002065393.1|  GK15423                                          59.7    1e-06   
ref|XP_001952828.1|  PREDICTED: zinc finger CCCH-type with G patc...  59.7    1e-06   
ref|XP_011364423.1|  PREDICTED: G patch domain-containing protein...  59.7    1e-06   
ref|NP_173150.1|  GC-rich sequence DNA-binding factor-like protei...  59.7    1e-06   
gb|EPS61679.1|  hypothetical protein M569_13115                       59.7    1e-06   
ref|XP_007126186.1|  PREDICTED: G patch domain-containing protein...  59.7    1e-06   
ref|XP_002890202.1|  D111/G-patch domain-containing protein           59.7    1e-06   
ref|XP_009359084.1|  PREDICTED: zinc finger CCCH domain-containin...  59.7    1e-06   
dbj|BAE37777.1|  unnamed protein product                              57.4    1e-06   
ref|XP_011364424.1|  PREDICTED: G patch domain-containing protein...  59.7    1e-06   
ref|XP_007950687.1|  PREDICTED: G patch domain-containing protein 2   59.7    1e-06   
ref|XP_007173585.1|  PREDICTED: G patch domain-containing protein 2   59.7    2e-06   
ref|XP_001356074.2|  STIP                                             59.7    2e-06   
ref|XP_011364422.1|  PREDICTED: G patch domain-containing protein...  59.7    2e-06   
ref|XP_001962686.1|  GF14307                                          59.7    2e-06   
ref|XP_002021678.1|  Sip1-TFIP11 interacting protein                  59.7    2e-06   
ref|XP_007126185.1|  PREDICTED: G patch domain-containing protein...  59.3    2e-06   
ref|XP_008218613.1|  PREDICTED: tuftelin-interacting protein 11-like  59.7    2e-06   
ref|XP_004671000.1|  PREDICTED: tuftelin-interacting protein 11       59.7    2e-06   
ref|XP_009350135.1|  PREDICTED: septin and tuftelin-interacting p...  59.7    2e-06   
ref|XP_009350134.1|  PREDICTED: septin and tuftelin-interacting p...  59.7    2e-06   
ref|XP_004271079.1|  PREDICTED: G patch domain-containing protein 2   59.3    2e-06   
ref|XP_007641342.1|  PREDICTED: G patch domain-containing protein...  59.3    2e-06   
ref|XP_009355402.1|  PREDICTED: septin and tuftelin-interacting p...  59.7    2e-06   
gb|ERE73020.1|  G patch domain-containing protein 2                   59.3    2e-06   
gb|EGV92551.1|  G patch domain-containing protein 2                   59.3    2e-06   
ref|XP_008378967.1|  PREDICTED: tuftelin-interacting protein 11-like  59.7    2e-06   
ref|XP_007514715.1|  predicted protein                                59.7    2e-06   
ref|XP_008377483.1|  PREDICTED: zinc finger CCCH domain-containin...  59.3    2e-06   
emb|CBN76810.1|  conserved unknown protein                            58.5    2e-06   
ref|XP_004314146.1|  PREDICTED: G patch domain-containing protein 2   58.9    2e-06   
emb|CDS30657.1|  tuftelin interacting protein 11                      59.3    2e-06   
ref|XP_010476842.1|  PREDICTED: septin and tuftelin-interacting p...  59.3    2e-06   
ref|XP_004510195.1|  PREDICTED: tuftelin-interacting protein 11-like  59.3    2e-06   
ref|XP_007151865.1|  hypothetical protein PHAVU_004G082100g           59.3    2e-06   
ref|XP_003623392.1|  Tuftelin-interacting-like protein                58.9    2e-06   
ref|XP_002760563.3|  PREDICTED: G patch domain-containing protein 2   58.9    2e-06   
ref|XP_006155908.1|  PREDICTED: G patch domain-containing protein...  58.9    2e-06   
ref|XP_003366553.1|  tuftelin-interacting protein 11                  58.5    2e-06   
ref|XP_006155910.1|  PREDICTED: G patch domain-containing protein...  58.9    2e-06   
ref|XP_003800194.1|  PREDICTED: G patch domain-containing protein 2   58.9    2e-06   
gb|EFB16756.1|  hypothetical protein PANDA_016389                     55.5    3e-06   
ref|XP_006675569.1|  hypothetical protein BATDEDRAFT_22440            58.9    3e-06   
ref|XP_006416746.1|  hypothetical protein EUTSA_v10006789mg           58.9    3e-06   
gb|EPB85923.1|  hypothetical protein HMPREF1544_07255                 58.9    3e-06   
ref|XP_007225316.1|  hypothetical protein PRUPE_ppa001171mg           58.9    3e-06   
ref|XP_001988208.1|  GH10693                                          58.9    3e-06   
dbj|GAN05273.1|  TFP11-domain-containing protein                      58.9    3e-06   
ref|XP_008117816.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  58.5    3e-06   
gb|EPQ19912.1|  Tuftelin-interacting protein 11                       58.5    3e-06   
ref|XP_008516973.1|  PREDICTED: tuftelin-interacting protein 11 i...  58.9    3e-06   
ref|XP_005348906.1|  PREDICTED: G patch domain-containing protein...  58.5    3e-06   
ref|XP_011449175.1|  PREDICTED: tuftelin-interacting protein 11-like  58.9    3e-06   
ref|XP_004626994.1|  PREDICTED: G patch domain-containing protein 2   58.5    3e-06   
ref|XP_005335017.1|  PREDICTED: G patch domain-containing protein 2   58.5    3e-06   
ref|XP_005216843.1|  PREDICTED: G patch domain-containing protein...  58.5    3e-06   
ref|XP_011506183.1|  PREDICTED: zinc finger CCCH-type with G patc...  58.5    4e-06   
ref|XP_004670181.1|  PREDICTED: G patch domain-containing protein...  58.5    4e-06   
ref|XP_008583093.1|  PREDICTED: G patch domain-containing protein...  58.5    4e-06   
ref|XP_005885804.1|  PREDICTED: tuftelin-interacting protein 11-like  58.5    4e-06   
ref|XP_001963018.1|  GF15731                                          58.2    4e-06   
ref|XP_005704687.1|  hypothetical protein Gasu_43330                  58.5    4e-06   
gb|EKC18985.1|  Tuftelin-interacting protein 11                       58.5    4e-06   
ref|XP_009825943.1|  hypothetical protein H257_03510                  58.5    4e-06   
ref|XP_005874655.1|  PREDICTED: tuftelin-interacting protein 11-like  58.5    4e-06   
ref|XP_008768060.1|  PREDICTED: G patch domain-containing protein...  58.2    4e-06   
ref|XP_008768061.1|  PREDICTED: G patch domain-containing protein...  58.2    4e-06   
gb|EDL94941.1|  rCG20314, isoform CRA_c                               58.2    4e-06   
ref|XP_003380487.1|  tuftelin-interacting protein 11                  58.5    4e-06   
ref|XP_010270966.1|  PREDICTED: septin and tuftelin-interacting p...  58.5    4e-06   
ref|XP_006250497.1|  PREDICTED: G patch domain-containing protein...  58.2    4e-06   
ref|XP_008768064.1|  PREDICTED: G patch domain-containing protein...  58.2    4e-06   
gb|AES79611.2|  tuftelin interacting protein amino-terminal protein   57.8    5e-06   
ref|XP_004375989.1|  PREDICTED: G patch domain-containing protein 2   58.2    5e-06   
ref|XP_007211094.1|  hypothetical protein PRUPE_ppa001175mg           58.2    5e-06   
ref|XP_006250501.1|  PREDICTED: G patch domain-containing protein...  58.2    5e-06   
ref|XP_008833037.1|  PREDICTED: G patch domain-containing protein...  58.2    5e-06   
ref|XP_003474282.1|  PREDICTED: G patch domain-containing protein 2   57.8    5e-06   
ref|XP_005082501.1|  PREDICTED: G patch domain-containing protein 2   57.8    5e-06   
ref|XP_003623393.1|  Tuftelin-interacting protein                     57.8    5e-06   
ref|XP_003577528.1|  PREDICTED: septin and tuftelin-interacting p...  58.2    5e-06   
ref|XP_002880634.1|  zinc finger (CCCH-type) family protein           57.8    5e-06   
ref|XP_002405638.1|  tuftelin interacting protein, putative           57.4    5e-06   
ref|XP_008833036.1|  PREDICTED: G patch domain-containing protein...  57.8    6e-06   
ref|XP_004578971.1|  PREDICTED: G patch domain-containing protein 2   57.8    6e-06   
ref|XP_004524156.1|  PREDICTED: zinc finger CCCH-type with G patc...  57.8    6e-06   
ref|XP_006076253.1|  PREDICTED: G patch domain-containing protein...  57.8    6e-06   
ref|XP_005910114.1|  PREDICTED: G patch domain-containing protein...  57.8    6e-06   
ref|XP_006405048.1|  hypothetical protein EUTSA_v10000137mg           57.8    6e-06   
ref|XP_010851581.1|  PREDICTED: G patch domain-containing protein...  57.8    6e-06   
ref|XP_006076254.1|  PREDICTED: G patch domain-containing protein...  57.8    6e-06   
gb|KEH18055.1|  tuftelin-interacting protein                          57.8    6e-06   
ref|XP_012042434.1|  PREDICTED: G patch domain-containing protein...  57.8    6e-06   
ref|XP_009658212.1|  hypothetical protein VDAG_10214                  57.8    6e-06   
gb|ESA16281.1|  hypothetical protein GLOINDRAFT_22971                 57.8    6e-06   



>ref|XP_011084036.1| PREDICTED: uncharacterized protein LOC105166393 [Sesamum indicum]
Length=762

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 137/189 (72%), Gaps = 10/189 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            +SF+SSGIM +E +EL+ TES E+ D+CHE K VS S  Y AFE+HTTGFGSKMM KMG+
Sbjct  581  LSFVSSGIMDTETIELRTTESNETKDTCHESKLVSHSIEYKAFEIHTTGFGSKMMAKMGY  640

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQG+A+PI+VSQRPK+LGLGA+VPE S  +      P S G         R
Sbjct  641  IEGTGLGKDGQGMAQPIEVSQRPKSLGLGAEVPEASGKSSITQSRPNSTG---------R  691

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
             +   G+  + A+  +  FGSFE HTKGFGSKMMAKMGFVEG GLGKDSQGI  P+LA R
Sbjct  692  SAKSSGTNVKSAKSDNHKFGSFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLLAVR  751

Query  380  RPKSQGLGA  354
            RPKS GLGA
Sbjct  752  RPKSMGLGA  760


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            + +FE HT GFGSKMMAKMG++EGTGLGKD QG+  PI  ++RPKS GLGA+
Sbjct  620  YKAFEIHTTGFGSKMMAKMGYIEGTGLGKDGQGMAQPIEVSQRPKSLGLGAE  671



>ref|XP_009595430.1| PREDICTED: uncharacterized protein LOC104091732 [Nicotiana tomentosiformis]
Length=786

 Score =   218 bits (556),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 143/190 (75%), Gaps = 9/190 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFISSG+M SE VE K  E+TE+++S HE K V++S  YGAFE+HTTGFGSKMM KMG+
Sbjct  603  VSFISSGMMCSETVEEKSIETTEATNSFHETKVVTNSIEYGAFEMHTTGFGSKMMAKMGY  662

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQGI+EPI+  QRPKALGLGA++PETS+ +  K   PKS     ++ +RS 
Sbjct  663  QEGRGLGKDGQGISEPIEARQRPKALGLGAEIPETSSGSAKKDFLPKSAVRSAEVVSRSG  722

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
            KS +K S          GF  FE HTKGFGSKMMAKMGFVEGTGLGK+SQGI  P++A R
Sbjct  723  KSSRKESSI--------GFAGFEMHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVR  774

Query  380  RPKSQGLGAK  351
            RPKSQGLGAK
Sbjct  775  RPKSQGLGAK  784


 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV  645
            SS  +  FE+HT GFGSKMM KMGF  G GLGK+ QGI  P+   +RPK+ GLGA V
Sbjct  729  SSIGFAGFEMHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAKV  785



>ref|XP_009769069.1| PREDICTED: uncharacterized protein LOC104219993 [Nicotiana sylvestris]
Length=787

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 142/190 (75%), Gaps = 9/190 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFISSG+M SE VE K  E+TE+++S HE K V++S  YGAFE+HTTGFGSKMM KMG+
Sbjct  604  VSFISSGMMRSETVEEKPIETTETTNSFHEMKVVTNSIEYGAFEMHTTGFGSKMMAKMGY  663

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQGI+EPI+  QRPKALGLGA++PETS+ +  K   PKS     ++  RS 
Sbjct  664  EEGRGLGKDGQGISEPIEARQRPKALGLGAEIPETSSGSAKKDFLPKSAVRSAEVVGRSA  723

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
            KS +K S          GF  FE HTKGFGSKMMAKMGFVEGTGLGK+SQGI  P++A R
Sbjct  724  KSSRKESSI--------GFAGFEMHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVR  775

Query  380  RPKSQGLGAK  351
            RPKSQGLGAK
Sbjct  776  RPKSQGLGAK  785


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  645
            SS  +  FE+HT GFGSKMM KMGF  G GLGK+ QGI  P+   +RPK+ GLGA V
Sbjct  730  SSIGFAGFEMHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAKV  786



>emb|CDP10517.1| unnamed protein product [Coffea canephora]
Length=770

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 136/190 (72%), Gaps = 12/190 (6%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSGIM S+ VE    E++E+SD+C EKK  SSS  YGAFELHT GFGSKMM +MG+
Sbjct  589  VSFVSSGIMDSDMVEHSAIETSETSDNCEEKKHASSSIKYGAFELHTRGFGSKMMARMGY  648

Query  737  TGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLP-TRs  564
              G GLGKDGQG+AEPI+V QRPK+LGLGA++ ETS     K   P   G   +LP TR+
Sbjct  649  VEGCGLGKDGQGMAEPIEVLQRPKSLGLGAEIAETSDKLAKKECRPTVSGLSSELPGTRN  708

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
            +   K+ +Q          F SFE HTKGFGSK+MAKMGFVEG GLGKDSQG+  P++  
Sbjct  709  KLGKKESAQ----------FASFERHTKGFGSKVMAKMGFVEGMGLGKDSQGMIRPLVVA  758

Query  383  RRPKSQGLGA  354
            RRPKS+GLGA
Sbjct  759  RRPKSRGLGA  768


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            +G+FE HT+GFGSKMMA+MG+VEG GLGKD QG+  PI   +RPKS GLGA+
Sbjct  628  YGAFELHTRGFGSKMMARMGYVEGCGLGKDGQGMAEPIEVLQRPKSLGLGAE  679



>ref|XP_010323258.1| PREDICTED: uncharacterized protein LOC101249097 [Solanum lycopersicum]
Length=789

 Score =   200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 138/192 (72%), Gaps = 11/192 (6%)
 Frame = -2

Query  917  VSFISSGIMSSE-KVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMG  741
            VSF+SSGIM SE +VE K  E+T+++   HE K V++S  YGAFE+HTTG GSK+M KMG
Sbjct  605  VSFVSSGIMRSETEVEEKSIETTQTTTIVHETKVVTNSVEYGAFEMHTTGIGSKLMAKMG  664

Query  740  FT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT-PKSVGFGEDLPTR  567
            +  G GLGKDGQGI+EPI+  QRPKALGLGA++PETS  +  K  + PKS G G ++   
Sbjct  665  YQEGRGLGKDGQGISEPIEARQRPKALGLGAEIPETSIRSSGKKDSLPKSSGRGAEV---  721

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
                   GS     +  S GF  FE HTKGFGSK+MAKMGFVEG GLG+ SQGIT P++A
Sbjct  722  -----VGGSGKSIRKESSVGFAGFERHTKGFGSKIMAKMGFVEGMGLGRSSQGITNPLVA  776

Query  386  TRRPKSQGLGAK  351
             RRPKSQGLGAK
Sbjct  777  VRRPKSQGLGAK  788



>ref|XP_006359539.1| PREDICTED: uncharacterized protein LOC102594159 [Solanum tuberosum]
Length=790

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 137/192 (71%), Gaps = 11/192 (6%)
 Frame = -2

Query  917  VSFISSGIMSSE-KVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMG  741
            VSF+SSGIM SE +VE K  E+T+++   HE K V++S  YGAFE+HTTG GSK+M KMG
Sbjct  606  VSFVSSGIMRSETEVEEKSIETTQTTTIIHETKVVTNSVEYGAFEMHTTGIGSKLMAKMG  665

Query  740  FT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT-PKSVGFGEDLPTR  567
            +  G GLGKDGQGI+EPI+  QRPKALGLGA++ ETS+ +  K  + PKS   G ++   
Sbjct  666  YQEGRGLGKDGQGISEPIEARQRPKALGLGAEILETSSRSSAKKDSLPKSSVRGAEV---  722

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
                   GS     +  S GF  FE HTKGFGSKMMAKMGFVEG GLG+ SQGIT P++A
Sbjct  723  -----VGGSGKSIRKESSVGFAGFERHTKGFGSKMMAKMGFVEGMGLGRSSQGITNPLVA  777

Query  386  TRRPKSQGLGAK  351
             RRPKSQGLGAK
Sbjct  778  VRRPKSQGLGAK  789



>ref|XP_003549703.1| PREDICTED: uncharacterized protein LOC100781443 [Glycine max]
 gb|KHN18591.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=767

 Score =   175 bits (444),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 133/199 (67%), Gaps = 30/199 (15%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+++SE +++ + ++ E++     +K V+SS N G+FE HTTGFGSKMM KMG+
Sbjct  588  VSFVSSGLINSETLQVTVVDAEETN-----RKGVTSSANIGSFEEHTTGFGSKMMAKMGY  642

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA---NETKTPTPKSVGFGEDL--  576
            T G GLGK+GQG+A+PI+V QRPK+LGLG +    S     N++     KS+G G +   
Sbjct  643  TEGAGLGKNGQGMAQPIEVIQRPKSLGLGVEFYNNSAEPARNKSSRVGAKSLGLGVEFSN  702

Query  575  ----PTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQG  408
                P R++ S                 GSFE HTKGFGSKMMAKMGFVEG GLG++SQG
Sbjct  703  SPAEPARNKSSK---------------VGSFEKHTKGFGSKMMAKMGFVEGNGLGRESQG  747

Query  407  ITAPILATRRPKSQGLGAK  351
            IT P+ A R PKS+GLGAK
Sbjct  748  ITTPLSAVRLPKSRGLGAK  766



>ref|XP_003542623.1| PREDICTED: uncharacterized protein LOC100802615 [Glycine max]
 gb|KHN22105.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=762

 Score =   169 bits (428),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 129/193 (67%), Gaps = 19/193 (10%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE V+  +T   E ++    +  V+SS N G+FE HTTGFGSKMM KMG+
Sbjct  584  VSFVSSGLIHSETVQ--VTVDAEETN----RNGVTSSANIGSFEEHTTGFGSKMMAKMGY  637

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA---NETKTPTPKSVGFGEDLPT  570
            T G GLGK+GQG+A+PI+V QRPK+LGLG +    S     N++     KS+G G +   
Sbjct  638  TEGAGLGKNGQGMAQPIEVIQRPKSLGLGVEFSNNSAEPARNKSSRVGAKSLGVGVEFSN  697

Query  569  RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPIL  390
                     S  + A   S   G+FE HTKGFGSKMMAKMGFVEGTGLG++SQGIT P+ 
Sbjct  698  ---------SPAKPAPNKSSNVGAFEKHTKGFGSKMMAKMGFVEGTGLGRESQGITTPLS  748

Query  389  ATRRPKSQGLGAK  351
            A R PKS+GLGAK
Sbjct  749  AVRLPKSRGLGAK  761



>ref|XP_010542083.1| PREDICTED: uncharacterized protein LOC104815398 [Tarenaya hassleriana]
Length=798

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 130/194 (67%), Gaps = 7/194 (4%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+++SE V  + +   +      E    SS+ N+GAFE+HT GFGSKMM KMG+
Sbjct  595  VSFVSSGVINSETVGTEASREKDPKQVVAEPSGASSAANFGAFEVHTKGFGSKMMAKMGY  654

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGAD----VPETSTANETKTPTPKSVGFGEDLP  573
              G GLGKDG+G+A+PI+V QRPK+LGLG D    V E   ++ + +   K    G+D  
Sbjct  655  IEGAGLGKDGKGLAQPIEVVQRPKSLGLGLDFSPSVEENQPSSSSGSGRRKGNSSGKD--  712

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
             +  K     S+      G  GFG+FE HTKGFGS+MMAKMGFVEGTGLG+DSQG+T P+
Sbjct  713  PKHEKGVSGSSRSGGGGGGGKGFGAFEQHTKGFGSRMMAKMGFVEGTGLGRDSQGMTNPL  772

Query  392  LATRRPKSQGLGAK  351
             A RRPK++GLGA+
Sbjct  773  FAVRRPKARGLGAE  786



>gb|EEC83275.1| hypothetical protein OsI_28629 [Oryza sativa Indica Group]
Length=519

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 115/190 (61%), Gaps = 16/190 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S G M+    E     +T    SC EK   S S   G FE+HT GFGSKMM KMGF
Sbjct  342  VSFVSCGTMAESVTETIAVATTSGEVSC-EKIVESDSVKLGTFEMHTKGFGSKMMAKMGF  400

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQG+ +PIQ  QRPK+LGLG +    + A + ++  P         P R+ 
Sbjct  401  IEGTGLGKDGQGMMQPIQPIQRPKSLGLGVEFDSEAEAIKARSEPPTK---ARSEPWRNL  457

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
            +  + G           G GSFE HTKGFGSKMMA+MGFVEG+GLGKD QGI  P+ A R
Sbjct  458  RKVEIG-----------GVGSFERHTKGFGSKMMARMGFVEGSGLGKDGQGIVNPLTAVR  506

Query  380  RPKSQGLGAK  351
            RPKS GLGAK
Sbjct  507  RPKSMGLGAK  516



>ref|XP_007013705.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013706.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013707.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31324.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31325.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31326.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
Length=650

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 123/196 (63%), Gaps = 25/196 (13%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG MSSE VE++  +   ++++C E K + SS  +GAFE+HT GFGSKMM KMGF
Sbjct  472  VSFVSSGHMSSETVEVRTMDPEGTAETC-EHKGIVSSAQFGAFEVHTKGFGSKMMAKMGF  530

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANE------TKTPTPKSVGFGED  579
              GG        +A PI+V QRPK+LGLG D P  S+ ++      +     ++ GFG  
Sbjct  531  VDGGGLGKDGQGMARPIEVIQRPKSLGLGVDFPSASSDSDMVQNISSGASERRTKGFGN-  589

Query  578  LPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITA  399
                             A+    GFG+FE HTKGFGSKMMAKMGFVEG GLGKDSQG+  
Sbjct  590  ----------------SARGQHKGFGAFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGMVN  633

Query  398  PILATRRPKSQGLGAK  351
            P++A R PKS+GLGAK
Sbjct  634  PLVAARLPKSRGLGAK  649



>ref|XP_006660014.1| PREDICTED: uncharacterized protein LOC102712285, partial [Oryza 
brachyantha]
Length=678

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S G M+    E     ST    SC EK   S+S   G FE+HT GFGSKMM KMGF
Sbjct  501  VSFVSCGTMAESVTETIAVASTSGEASC-EKIVESNSVKLGTFEMHTKGFGSKMMAKMGF  559

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT-PTPKSVGFGEDLPTRs  564
              G GLGKDGQG+ +PI+  QRPK+LGLG      + A + ++ PT K+       P R 
Sbjct  560  IEGTGLGKDGQGMMQPIETVQRPKSLGLGVVFDSEAEAIKARSEPTAKA----RSEPKRF  615

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
             +  +             G GSFE HTKGFGSKMMA+MGFVEG+GLGKD QGI  P+ A 
Sbjct  616  SRKVEMS-----------GVGSFERHTKGFGSKMMARMGFVEGSGLGKDGQGIVTPLTAV  664

Query  383  RRPKSQGLGAK  351
            RRPKS GLGAK
Sbjct  665  RRPKSMGLGAK  675



>ref|XP_007013704.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31323.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=765

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 123/196 (63%), Gaps = 25/196 (13%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG MSSE VE++  +   ++++C E K + SS  +GAFE+HT GFGSKMM KMGF
Sbjct  587  VSFVSSGHMSSETVEVRTMDPEGTAETC-EHKGIVSSAQFGAFEVHTKGFGSKMMAKMGF  645

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANE------TKTPTPKSVGFGED  579
              GG        +A PI+V QRPK+LGLG D P  S+ ++      +     ++ GFG  
Sbjct  646  VDGGGLGKDGQGMARPIEVIQRPKSLGLGVDFPSASSDSDMVQNISSGASERRTKGFGN-  704

Query  578  LPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITA  399
                             A+    GFG+FE HTKGFGSKMMAKMGFVEG GLGKDSQG+  
Sbjct  705  ----------------SARGQHKGFGAFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGMVN  748

Query  398  PILATRRPKSQGLGAK  351
            P++A R PKS+GLGAK
Sbjct  749  PLVAARLPKSRGLGAK  764



>gb|EEE68404.1| hypothetical protein OsJ_26758 [Oryza sativa Japonica Group]
Length=640

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 115/190 (61%), Gaps = 16/190 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S G M+    E     +T    SC EK   S S   G FE+HT GFGSKMM KMGF
Sbjct  463  VSFVSCGTMAESVTETIAVATTSGEVSC-EKIVESDSVKLGTFEMHTKGFGSKMMAKMGF  521

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQG+ +PIQ  QRPK+LGLG +    + A + ++  P         P R+ 
Sbjct  522  IEGTGLGKDGQGMMQPIQPIQRPKSLGLGVEFDSEAEAIKARSEPPTKA---RSEPWRNL  578

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
            +  + G           G GSFE HTKGFGSKMMA+MGFVEG+GLGKD QGI  P+ A R
Sbjct  579  RKVEIG-----------GVGSFERHTKGFGSKMMARMGFVEGSGLGKDGQGIVNPLTAVR  627

Query  380  RPKSQGLGAK  351
            RPKS GLGAK
Sbjct  628  RPKSMGLGAK  637



>ref|NP_001061456.1| Os08g0288500 [Oryza sativa Japonica Group]
 dbj|BAD01347.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD01361.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23370.1| Os08g0288500 [Oryza sativa Japonica Group]
Length=742

 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 115/190 (61%), Gaps = 16/190 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S G M+    E     +T    SC EK   S S   G FE+HT GFGSKMM KMGF
Sbjct  565  VSFVSCGTMAESVTETIAVATTSGEVSC-EKIVESDSVKLGTFEMHTKGFGSKMMAKMGF  623

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQG+ +PIQ  QRPK+LGLG +    + A + ++  P         P R+ 
Sbjct  624  IEGTGLGKDGQGMMQPIQPIQRPKSLGLGVEFDSEAEAIKARSEPPTKA---RSEPWRNL  680

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
            +  + G           G GSFE HTKGFGSKMMA+MGFVEG+GLGKD QGI  P+ A R
Sbjct  681  RKVEIG-----------GVGSFERHTKGFGSKMMARMGFVEGSGLGKDGQGIVNPLTAVR  729

Query  380  RPKSQGLGAK  351
            RPKS GLGAK
Sbjct  730  RPKSMGLGAK  739



>dbj|BAJ84968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 112/189 (59%), Gaps = 10/189 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG M  E V   +   + + D   EK  V S +  G FE HT GFGSKMM KMGF
Sbjct  45   VSFVSSGTMV-ETVTEAVAVGSTAGDVSSEK-VVGSDSKLGTFETHTKGFGSKMMAKMGF  102

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQGI +P+Q  QRPK+LGLG +      A ++++  P +       P R  
Sbjct  103  IEGTGLGKDGQGILQPVQAIQRPKSLGLGVEFDSELEAAKSRSEPPAN-------PRREL  155

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
               +   +           G+FE HTKGFGSKMM KMGFV G+GLGKD QGI  P+ A R
Sbjct  156  GRSRSEPRRNTRPPEMYDCGTFERHTKGFGSKMMVKMGFVPGSGLGKDGQGIVNPLTAVR  215

Query  380  RPKSQGLGA  354
            RPKS+GLGA
Sbjct  216  RPKSRGLGA  224


 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  P+ A +RPKS GLG +
Sbjct  82   LGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVE  133



>ref|XP_009358504.1| PREDICTED: uncharacterized protein LOC103949129 [Pyrus x bretschneideri]
 ref|XP_009358505.1| PREDICTED: uncharacterized protein LOC103949129 [Pyrus x bretschneideri]
Length=640

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 116/188 (62%), Gaps = 17/188 (9%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M S    L + +S E+S    +    + ST Y +FELHT GFGSKM+ KMG+
Sbjct  468  VSFVSSGVMQSAAESLTV-DSIEAS----KNNVAAGSTEYRSFELHTKGFGSKMLAKMGY  522

Query  737  TGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsrk  558
              GGLGKDGQG+A PI+V QRPK+LGLG +    +     KTP         ++P + R 
Sbjct  523  IEGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSTPAEIPVGKTPP------ANNIPVKRRS  576

Query  557  sgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRR  378
              +      +        G FE HTKGFGSKMMAKMGFV G GLGKDSQGI  P+ A R 
Sbjct  577  QAQSSQTQSER------VGYFEKHTKGFGSKMMAKMGFVGGMGLGKDSQGIVNPLAAVRL  630

Query  377  PKSQGLGA  354
            PKS+GLGA
Sbjct  631  PKSRGLGA  638


 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  502  YRSFELHTKGFGSKMLAKMGYIEG-GLGKDGQGMAAPIEVIQRPKSLGLGVE  552



>ref|XP_011017950.1| PREDICTED: uncharacterized protein LOC105121122 [Populus euphratica]
Length=737

 Score =   158 bits (399),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 120/190 (63%), Gaps = 19/190 (10%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M S   E    +S E + +   K   SSS+ +GAFE+HT GFGSKMM KMGF
Sbjct  565  VSFVSSGVMQSGDAETITVDSQEINGTGENKDATSSSSKFGAFEVHTKGFGSKMMEKMGF  624

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+A+PI+V+QRPK+LGLG D  + S  +    P     G          
Sbjct  625  IQGGGLGKDGQGMAQPIEVTQRPKSLGLGVDFSDISVDSVKNKPQSSRTG----------  674

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
                           +   G+FE HTKGFGSKMMAKMGFVEG GLGKDSQGI  PI+A R
Sbjct  675  --------TSIKHSKTENLGAFEMHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPIVAVR  726

Query  380  RPKSQGLGAK  351
            RPK++GLGAK
Sbjct  727  RPKARGLGAK  736



>gb|KJB64581.1| hypothetical protein B456_010G054900 [Gossypium raimondii]
Length=786

 Score =   158 bits (400),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 131/189 (69%), Gaps = 14/189 (7%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFISSG+M SE  E++ T+   +S+S +E K +  S  +GAFE+HT GFGSKMM KMGF
Sbjct  609  VSFISSGVMVSETDEIRTTDPEGTSES-YEHKGIIRSAQFGAFEVHTKGFGSKMMAKMGF  667

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+A+PI+V QRPK+LGLG +   TS+ ++      KS G  E+   R  
Sbjct  668  VEGGGLGKDGQGMAQPIEVVQRPKSLGLGVNFTSTSSDSDR---VHKSGGASENHSKRFG  724

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
             S K   +          FG+FE HTKGFGSKMMAKMGFVEG GLGKDSQGI  P++A+R
Sbjct  725  DSSKDQHKS---------FGAFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLVASR  775

Query  380  RPKSQGLGA  354
             PKS+GLGA
Sbjct  776  LPKSRGLGA  784


 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -2

Query  833  HEKKCVSSSTN----YGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPK  669
            H K+   SS +    +GAFE HT GFGSKMM KMGF  G GLGKD QGI  P+  S+ PK
Sbjct  719  HSKRFGDSSKDQHKSFGAFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLVASRLPK  778

Query  668  ALGLGAD  648
            + GLGA+
Sbjct  779  SRGLGAN  785



>ref|XP_009338424.1| PREDICTED: uncharacterized protein LOC103930775 [Pyrus x bretschneideri]
Length=762

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 118/188 (63%), Gaps = 18/188 (10%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M S    L + +S E+S    + K  + ST Y +FELHT GFGSKM+ KMG+
Sbjct  591  VSFVSSGVMQSAAESLTV-DSIEAS----KNKVAAESTEYRSFELHTKGFGSKMLAKMGY  645

Query  737  TGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsrk  558
              GGLGKDGQG+A PI+V QRPK+LGLG +             TP  +  G+  P  +  
Sbjct  646  VEGGLGKDGQGMAAPIEVIQRPKSLGLGVEF-----------STPVEIPVGKTPPANNIP  694

Query  557  sgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRR  378
              +  +Q  + Q    G+  FE HTKGFG KMMAKMGFV G GLGKDSQGI  P+ + R 
Sbjct  695  VKRSQAQSSQTQSERVGY--FEKHTKGFGLKMMAKMGFVGGMGLGKDSQGIVNPLASVRL  752

Query  377  PKSQGLGA  354
            PKS+GLGA
Sbjct  753  PKSRGLGA  760


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 71/138 (51%), Gaps = 21/138 (15%)
 Frame = -2

Query  704  IAEPIQVSQRPKALGLGAD--VPETSTANETKTP-TPKSVGFGE-----DLPT-------  570
            + EP +   RP+ +G G D   PE+  ++E KTP T    G G      + P        
Sbjct  539  VVEPGRDKNRPRKIGKGIDFKTPESKQSSERKTPKTSAKRGSGNMDSYANTPVSFVSSGV  598

Query  569  -----RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGI  405
                  S       +   K    S  + SFE HTKGFGSKM+AKMG+VEG GLGKD QG+
Sbjct  599  MQSAAESLTVDSIEASKNKVAAESTEYRSFELHTKGFGSKMLAKMGYVEG-GLGKDGQGM  657

Query  404  TAPILATRRPKSQGLGAK  351
             API   +RPKS GLG +
Sbjct  658  AAPIEVIQRPKSLGLGVE  675



>gb|KEH32162.1| D111/G-patch domain protein [Medicago truncatula]
Length=783

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 131/196 (67%), Gaps = 9/196 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG + SE V++ I   +E +DS + KK  +SS N G+FE+HTTGFGSKMM KMG+
Sbjct  589  VSFVSSGTIHSETVQV-IAVDSEETDSAN-KKGATSSANVGSFEVHTTGFGSKMMAKMGY  646

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGA------DVPETSTANETKTPTPKSVGFGED  579
            T GGGLGK+GQG+A+PI+V QRPK+LGLG       D P   +   +K  T  S   G  
Sbjct  647  TEGGGLGKNGQGMAQPIEVIQRPKSLGLGVEFSSNVDDPTRDSIGTSKKHTKSSSRVGSS  706

Query  578  LPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITA  399
                   S     +       + G GSFE HTKGFGSKMMAKMGFVEG+GLG++SQGITA
Sbjct  707  EKRTKGSSSIGSFEKHTKGSSTSGIGSFEKHTKGFGSKMMAKMGFVEGSGLGRESQGITA  766

Query  398  PILATRRPKSQGLGAK  351
            P+ A R PKS+GLGAK
Sbjct  767  PLGAVRLPKSRGLGAK  782



>ref|XP_002325162.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
 gb|EEF03727.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
Length=737

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 125/190 (66%), Gaps = 20/190 (11%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M S  VE    +S E +++  EKK  +SS+ +GAFE+HT GFGSKMM KMGF
Sbjct  566  VSFVSSGVMQSGDVETITVDSREINET-GEKKDATSSSKFGAFEVHTKGFGSKMMAKMGF  624

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+A+P++V+QRPK+LGLG D  + S  +    P     G          
Sbjct  625  IEGGGLGKDGQGMAQPVEVTQRPKSLGLGVDFSDISVDSVKNKPQSSRTG----------  674

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
                        Q  +   G+FE HTKGFGSK+MAKMGFVEG GLGKDSQGI  PI+A +
Sbjct  675  --------TSGKQSKTENLGAFEKHTKGFGSKIMAKMGFVEGMGLGKDSQGIVNPIVAVK  726

Query  380  RPKSQGLGAK  351
            RPK++GLGAK
Sbjct  727  RPKARGLGAK  736



>ref|XP_004973180.1| PREDICTED: uncharacterized protein LOC101758421 [Setaria italica]
Length=756

 Score =   156 bits (394),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 119/190 (63%), Gaps = 10/190 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S G M+ E V   I   +    +   K   S++T  G+FE+HT GFGSKMM KMGF
Sbjct  573  VSFVSCGTMA-ESVTETIAVDSSGGHTSPGKAAESNTTELGSFEVHTKGFGSKMMAKMGF  631

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +T   K+       P++ R
Sbjct  632  IEGTGLGKDGQGIVQPIQAIHRPKSLGLGVEFNSEAEAIKARTEPMKA----RSEPSKVR  687

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
               ++  +  +      G GSFE HTKGFGSKMMAKMGFV G+GLG+D QGI  P+ A R
Sbjct  688  PELRRNVRALETS----GVGSFERHTKGFGSKMMAKMGFVPGSGLGRDGQGIPTPLTAVR  743

Query  380  RPKSQGLGAK  351
            RPKSQGLGAK
Sbjct  744  RPKSQGLGAK  753



>gb|EMT16376.1| Tuftelin-interacting protein 11 [Aegilops tauschii]
Length=779

 Score =   155 bits (393),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 109/190 (57%), Gaps = 4/190 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG M+    E     ST    SC  +K V S +  G FE HT GFGSKMM KMGF
Sbjct  588  VSFVSSGTMAETATEAVAVGSTAGDVSC--EKVVGSDSKLGTFETHTKGFGSKMMAKMGF  645

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP-ETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGKDGQGI +P+Q  QRPK+LGLG +   E   A     P  K+         R 
Sbjct  646  IEGTGLGKDGQGILQPVQAIQRPKSLGLGVEFDSELEAAKARSEPPAKARPEPAANARRE  705

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                +   +           G+FE HTKGFGSKMM KMGFV G+GLGKD QGI  P+ A 
Sbjct  706  LSRSRSEPRRNTRPPEMYDCGTFERHTKGFGSKMMVKMGFVPGSGLGKDGQGIVNPLTAV  765

Query  383  RRPKSQGLGA  354
            RRPKS+GLGA
Sbjct  766  RRPKSRGLGA  775


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  P+ A +RPKS GLG +
Sbjct  625  LGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVE  676



>ref|XP_008801999.1| PREDICTED: uncharacterized protein LOC103715973 isoform X2 [Phoenix 
dactylifera]
Length=786

 Score =   155 bits (393),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 113/191 (59%), Gaps = 37/191 (19%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFIS G M  + V  K+   +  S  C +K   S S+  GAFE+HTTGFGSKMM KMGF
Sbjct  630  VSFISCGTMQVDSVTEKMAVDSHGSAKC-DKTAKSRSSKLGAFEVHTTGFGSKMMAKMGF  688

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGAD-VPETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGKDGQG+ +PI+V +RPK+LGLG    P+TS         P+S           
Sbjct  689  VEGTGLGKDGQGMVQPIEVIKRPKSLGLGVQFTPDTSDVR----IKPES-----------  733

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                               FG+FE HT GFGS+MMAKMGFV GTGLGKDSQGI  P+ A 
Sbjct  734  -------------------FGAFEKHTTGFGSRMMAKMGFVPGTGLGKDSQGIINPLTAV  774

Query  383  RRPKSQGLGAK  351
            + PKS+GLGAK
Sbjct  775  KLPKSRGLGAK  785



>ref|XP_008801998.1| PREDICTED: uncharacterized protein LOC103715973 isoform X1 [Phoenix 
dactylifera]
Length=794

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 113/191 (59%), Gaps = 37/191 (19%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFIS G M  + V  K+   +  S  C +K   S S+  GAFE+HTTGFGSKMM KMGF
Sbjct  638  VSFISCGTMQVDSVTEKMAVDSHGSAKC-DKTAKSRSSKLGAFEVHTTGFGSKMMAKMGF  696

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGAD-VPETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGKDGQG+ +PI+V +RPK+LGLG    P+TS         P+S           
Sbjct  697  VEGTGLGKDGQGMVQPIEVIKRPKSLGLGVQFTPDTSDVR----IKPES-----------  741

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                               FG+FE HT GFGS+MMAKMGFV GTGLGKDSQGI  P+ A 
Sbjct  742  -------------------FGAFEKHTTGFGSRMMAKMGFVPGTGLGKDSQGIINPLTAV  782

Query  383  RRPKSQGLGAK  351
            + PKS+GLGAK
Sbjct  783  KLPKSRGLGAK  793



>gb|EYU25294.1| hypothetical protein MIMGU_mgv1a003157mg [Erythranthe guttata]
Length=604

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 135/192 (70%), Gaps = 18/192 (9%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            +SF+SSGIM    VEL  TEST  +   + +K  ++S  YGAFE+HTTGFGSKM+ KMG+
Sbjct  421  LSFVSSGIMDPAIVELTTTESTNET---NPEKQTAASLEYGAFEMHTTGFGSKMLAKMGY  477

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT---PKSVGFGEDLPT  570
              GGGLGKDGQG+A+PI+V QRPK+LGLGA  PE S++ +  T     PKSV        
Sbjct  478  VEGGGLGKDGQGVAKPIEVFQRPKSLGLGAVAPEASSSKQPTTNVKAQPKSV--------  529

Query  569  RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPIL  390
               +S   G++ + A+  +  FGSFE HTKGFGSKMMAKMGFVEG GLGKD+QGI  P++
Sbjct  530  ---RSKSCGTKAKPAKIENNNFGSFEKHTKGFGSKMMAKMGFVEGAGLGKDAQGIINPLV  586

Query  389  ATRRPKSQGLGA  354
            A RRPKS GLGA
Sbjct  587  AVRRPKSVGLGA  598


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  809  STNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  648
            + N+G+FE HT GFGSKMM KMGF  G GLGKD QGI  P+   +RPK++GLGA+
Sbjct  545  NNNFGSFEKHTKGFGSKMMAKMGFVEGAGLGKDAQGIINPLVAVRRPKSVGLGAN  599



>ref|XP_006381899.1| hypothetical protein POPTR_0006s20370g, partial [Populus trichocarpa]
 gb|ERP59696.1| hypothetical protein POPTR_0006s20370g, partial [Populus trichocarpa]
Length=275

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 120/190 (63%), Gaps = 16/190 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M    VE     + E +++  E K  +SS+ YGAFE+HT GFGSKMM KMGF
Sbjct  100  VSFVSSGVMQPGVVETTTLGAQEINETG-ENKDATSSSKYGAFEVHTKGFGSKMMEKMGF  158

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+A+PI+V QRPK+LGLG D    S  +    P     G          
Sbjct  159  IQGGGLGKDGQGMAQPIEVIQRPKSLGLGVDFSNISGDSVKNKPQSLETG----------  208

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
                  +        +P FG+FE HTKGFGSKMM +MGFVEG GLGKDSQGI  P++A R
Sbjct  209  ----TATGKSGKHSKTPSFGAFEKHTKGFGSKMMTRMGFVEGKGLGKDSQGIVNPLVAVR  264

Query  380  RPKSQGLGAK  351
            R K++GLGAK
Sbjct  265  RRKARGLGAK  274



>ref|XP_011033482.1| PREDICTED: uncharacterized protein LOC105131955 [Populus euphratica]
Length=724

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 122/190 (64%), Gaps = 18/190 (9%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M    VE  IT   +  +   E K  +SS+ YGAFE+HT GFGSKMM KMGF
Sbjct  551  VSFVSSGVMQPGVVET-ITVGAQEINETGENKDATSSSKYGAFEVHTKGFGSKMMEKMGF  609

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+A+PI+  QRPK+LGLG D    S  +  K P     G G+       
Sbjct  610  IQGGGLGKDGQGMAQPIEAIQRPKSLGLGVDFSNISGDSVKKKPQILETGTGK-------  662

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
                      +    +P FG+FE HTKGFGSKMM +MGFVEG GLGKDSQGI +P++A  
Sbjct  663  ---------FEKHSKTPSFGAFEKHTKGFGSKMMTRMGFVEGKGLGKDSQGIVSPLVAVT  713

Query  380  RPKSQGLGAK  351
            RPK++GLGAK
Sbjct  714  RPKARGLGAK  723



>ref|XP_002523543.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38882.1| zinc finger protein, putative [Ricinus communis]
Length=775

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 125/191 (65%), Gaps = 26/191 (14%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSGIMS E VE+   +S E+  S  E K  +S+   GAFE+HT GFGSKMM KMGF
Sbjct  608  VSFVSSGIMS-EAVEMTTMDSKETETS--ENKDTTSTAKVGAFEVHTKGFGSKMMAKMGF  664

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETS-TANETKTPTPKSVGFGEDLPTRs  564
              GGGLG+DGQGIAEPI+  QRPK+LGLGA++P+T+    + K  +   +G    L +  
Sbjct  665  VEGGGLGRDGQGIAEPIEAIQRPKSLGLGANIPDTNGDPMDNKLQSAGRLGKHAKLQS--  722

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                G+FE HTKGFGSKMMA+MGFVEG GLGK+SQGI  P+ A 
Sbjct  723  -------------------LGAFEKHTKGFGSKMMARMGFVEGMGLGKNSQGIVNPLAAV  763

Query  383  RRPKSQGLGAK  351
            R PKS+GLGAK
Sbjct  764  RLPKSRGLGAK  774


 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  645
            GAFE HT GFGSKMM +MGF  G GLGK+ QGI  P+   + PK+ GLGA V
Sbjct  724  GAFEKHTKGFGSKMMARMGFVEGMGLGKNSQGIVNPLAAVRLPKSRGLGAKV  775



>ref|XP_003573663.1| PREDICTED: uncharacterized protein LOC100845409 [Brachypodium 
distachyon]
Length=751

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 114/195 (58%), Gaps = 15/195 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG M  E V   IT  +   D+  E    S S   G FE+HT GFGSKMM KMGF
Sbjct  561  VSFVSSGTMV-ETVTEAITVDSTGGDASPENVVESDSAKLGTFEMHTKGFGSKMMAKMGF  619

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT------PTPKSVGFGED  579
              G GLGKDGQGI +PIQ   RPK+LGLG +    + A + ++      P P        
Sbjct  620  IEGTGLGKDGQGIVQPIQAIHRPKSLGLGVEFDSEAEAMKARSELANARPEPSKA---RS  676

Query  578  LPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITA  399
             P+++R   ++  +           G+FE HTKGFGSKMM KMGFV G GLGKD QGI  
Sbjct  677  EPSKARSEQRRNIRPADMNS----LGTFERHTKGFGSKMMVKMGFVPGYGLGKDGQGIVN  732

Query  398  PILATRRPKSQGLGA  354
            P+ A RRP+S+GLGA
Sbjct  733  PLTAVRRPRSRGLGA  747


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  327
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  PI A  RPKS GLG +  F     
Sbjct  599  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGVE--FDSEAE  656

Query  326  SLSSREKL  303
            ++ +R +L
Sbjct  657  AMKARSEL  664



>gb|AES91716.2| D111/G-patch domain protein [Medicago truncatula]
Length=798

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 137/211 (65%), Gaps = 24/211 (11%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG + SE V++ I   +E +DS + KK  +SS N G+FE+HTTGFGSKMM KMG+
Sbjct  589  VSFVSSGTIHSETVQV-IAVDSEETDSAN-KKGATSSANVGSFEVHTTGFGSKMMAKMGY  646

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGA------DVPETST---------------AN  624
            T GGGLGK+GQG+A+PI+V QRPK+LGLG       D P   +               ++
Sbjct  647  TEGGGLGKNGQGMAQPIEVIQRPKSLGLGVEFSSNVDDPTRDSIGTSKKHTKSSSRVGSS  706

Query  623  ETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGF  444
            E +T    S+G  E     S  SG    +       + G GSFE HTKGFGSKMMAKMGF
Sbjct  707  EKRTKGSSSIGSFEKHTKGSSTSGIGSFEKHTKGSSTSGIGSFEKHTKGFGSKMMAKMGF  766

Query  443  VEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            VEG+GLG++SQGITAP+ A R PKS+GLGAK
Sbjct  767  VEGSGLGRESQGITAPLGAVRLPKSRGLGAK  797



>ref|XP_010687767.1| PREDICTED: uncharacterized protein LOC104901840 [Beta vulgaris 
subsp. vulgaris]
Length=801

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 131/193 (68%), Gaps = 9/193 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCV-SSSTNYGAFELHTTGFGSKMMVKMG  741
            VSF+SSG++ SE V++   +  E+S+   E K + +SS+ + +FE+HT GFGSKMM KMG
Sbjct  610  VSFVSSGVIQSETVQVSTVKPNENSN--QESKAIDNSSSTFASFEVHTKGFGSKMMAKMG  667

Query  740  FT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVG--FGEDLPT  570
            +  G GLGKDG+GI++PI+  QRPK+LGLG    E+S  NET TP  K  G    +  P 
Sbjct  668  YVEGDGLGKDGKGISQPIEAVQRPKSLGLGMAFVESS--NET-TPVAKRSGGSVRKSTPN  724

Query  569  RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPIL  390
             +         G   +  +P  G+FE HTKGFGSKMMA+MGFV+G GLG++SQGI  P++
Sbjct  725  TNETMPVAKRSGGSGRNSTPNIGAFEKHTKGFGSKMMARMGFVDGAGLGRNSQGIVTPLV  784

Query  389  ATRRPKSQGLGAK  351
            A RRPK++GLGA+
Sbjct  785  AVRRPKARGLGAE  797



>ref|XP_003609519.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Medicago truncatula]
Length=809

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 137/211 (65%), Gaps = 24/211 (11%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG + SE V++ I   +E +DS + KK  +SS N G+FE+HTTGFGSKMM KMG+
Sbjct  600  VSFVSSGTIHSETVQV-IAVDSEETDSAN-KKGATSSANVGSFEVHTTGFGSKMMAKMGY  657

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGA------DVPETST---------------AN  624
            T GGGLGK+GQG+A+PI+V QRPK+LGLG       D P   +               ++
Sbjct  658  TEGGGLGKNGQGMAQPIEVIQRPKSLGLGVEFSSNVDDPTRDSIGTSKKHTKSSSRVGSS  717

Query  623  ETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGF  444
            E +T    S+G  E     S  SG    +       + G GSFE HTKGFGSKMMAKMGF
Sbjct  718  EKRTKGSSSIGSFEKHTKGSSTSGIGSFEKHTKGSSTSGIGSFEKHTKGFGSKMMAKMGF  777

Query  443  VEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            VEG+GLG++SQGITAP+ A R PKS+GLGAK
Sbjct  778  VEGSGLGRESQGITAPLGAVRLPKSRGLGAK  808



>ref|XP_010913385.1| PREDICTED: uncharacterized protein LOC105039084 isoform X2 [Elaeis 
guineensis]
Length=772

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 110/191 (58%), Gaps = 37/191 (19%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFIS GIM    +   +      S  C EK   S S+  GAFE HT GFGSKMM KMGF
Sbjct  617  VSFISCGIMQVNSMTENMAVDPHGSTKC-EKSAKSRSSKLGAFEEHTKGFGSKMMAKMGF  675

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGK+GQG+ +PI+V +RPK+LGLG  + P+ S         P+S+G         
Sbjct  676  VDGAGLGKEGQGMVQPIEVIKRPKSLGLGVQITPDISDVR----VKPESLG---------  722

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                 +FE HTKGFGS+MMAKMGFV GTGLGKD+QGI  P+ A 
Sbjct  723  ---------------------AFEKHTKGFGSRMMAKMGFVPGTGLGKDAQGIINPLTAV  761

Query  383  RRPKSQGLGAK  351
            + PKS+GLGAK
Sbjct  762  KLPKSRGLGAK  772



>ref|XP_010913384.1| PREDICTED: uncharacterized protein LOC105039084 isoform X1 [Elaeis 
guineensis]
Length=776

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 110/191 (58%), Gaps = 37/191 (19%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFIS GIM    +   +      S  C EK   S S+  GAFE HT GFGSKMM KMGF
Sbjct  621  VSFISCGIMQVNSMTENMAVDPHGSTKC-EKSAKSRSSKLGAFEEHTKGFGSKMMAKMGF  679

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGK+GQG+ +PI+V +RPK+LGLG  + P+ S         P+S+G         
Sbjct  680  VDGAGLGKEGQGMVQPIEVIKRPKSLGLGVQITPDISDVR----VKPESLG---------  726

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                 +FE HTKGFGS+MMAKMGFV GTGLGKD+QGI  P+ A 
Sbjct  727  ---------------------AFEKHTKGFGSRMMAKMGFVPGTGLGKDAQGIINPLTAV  765

Query  383  RRPKSQGLGAK  351
            + PKS+GLGAK
Sbjct  766  KLPKSRGLGAK  776



>ref|XP_010042746.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like, partial [Eucalyptus grandis]
Length=263

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 118/193 (61%), Gaps = 20/193 (10%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M SE  E+       +S++  E   + +S ++GAFE+HT GFGSKMM +MGF
Sbjct  84   VSFVSSGVMPSETTEISPVNLAGASENGEEHVSLVTSESFGAFEVHTRGFGSKMMARMGF  143

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANETKTPTPKSVGFGEDLP  573
              G GLGK G G+AEPI+V +RPK+LGLG   PE+        E+++ + KS   G    
Sbjct  144  IEGQGLGKGGTGLAEPIEVIKRPKSLGLGMSFPESGEEPERNRESESQSTKSKQSGRGAS  203

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
             R                     G+FE HTKGFGS++MAKMGFVEG GLGKDSQGI  P+
Sbjct  204  VRRIPQC---------------IGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPL  248

Query  392  LATRRPKSQGLGA  354
             A R PKS+GL A
Sbjct  249  AAVRLPKSRGLDA  261



>ref|XP_009387542.1| PREDICTED: uncharacterized protein LOC103974432 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=712

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 113/191 (59%), Gaps = 38/191 (20%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S+G+M  +  +  IT   +SS S   +   +S  + GAFE+HT GFGS++M KMGF
Sbjct  557  VSFVSTGVMEVDPAKETIT--VDSSASTSLETVATSHASIGAFEVHTKGFGSRLMAKMGF  614

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGK GQG+ +PIQV +RPK+LGLG     ETS+A          +G         
Sbjct  615  VEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQFEDETSSAGA-------EIGR--------  659

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                G+FE HTKGFGSKMM KMGFV GTGLGKDSQGI  P+ A 
Sbjct  660  -------------------IGAFERHTKGFGSKMMVKMGFVPGTGLGKDSQGIINPLTAV  700

Query  383  RRPKSQGLGAK  351
            ++PKS+GLGAK
Sbjct  701  KQPKSRGLGAK  711



>ref|XP_009387541.1| PREDICTED: uncharacterized protein LOC103974432 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=728

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 113/191 (59%), Gaps = 38/191 (20%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S+G+M  +  +  IT   +SS S   +   +S  + GAFE+HT GFGS++M KMGF
Sbjct  573  VSFVSTGVMEVDPAKETIT--VDSSASTSLETVATSHASIGAFEVHTKGFGSRLMAKMGF  630

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTPTPKSVGFGEDLPTRs  564
              G GLGK GQG+ +PIQV +RPK+LGLG     ETS+A          +G         
Sbjct  631  VEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQFEDETSSAGA-------EIGR--------  675

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                G+FE HTKGFGSKMM KMGFV GTGLGKDSQGI  P+ A 
Sbjct  676  -------------------IGAFERHTKGFGSKMMVKMGFVPGTGLGKDSQGIINPLTAV  716

Query  383  RRPKSQGLGAK  351
            ++PKS+GLGAK
Sbjct  717  KQPKSRGLGAK  727



>ref|XP_004508396.1| PREDICTED: uncharacterized protein LOC101505169 [Cicer arietinum]
Length=806

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 132/211 (63%), Gaps = 26/211 (12%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG +  E V++ I   +E +DS H KK  +SS N G+FE+HTTGFGSKMM KMG+
Sbjct  599  VSFVSSGTIHPETVKV-IAVDSEETDSAH-KKGDTSSANIGSFEVHTTGFGSKMMAKMGY  656

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLP----  573
            T GGGLGK+GQG+A+PI+V +RPK+LGLG +   +S  +E     P  +G  E       
Sbjct  657  TEGGGLGKNGQGMAQPIEVIKRPKSLGLGVEF--SSNLDEPTRDNPSGIGTSEKHTKGSS  714

Query  572  -----TRsrksgkkgsqgqkaqygSPGF------------GSFENHTKGFGSKMMAKMGF  444
                 T+   S     +  K       F            G+FE HTKGFGSKMMAKMGF
Sbjct  715  SIGKHTKGSSSFVSFEKHTKGSSSFASFEKHTKGSSSSSIGAFEKHTKGFGSKMMAKMGF  774

Query  443  VEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            VEG GLG+DSQGITAP+ A R PKS+GLGAK
Sbjct  775  VEGAGLGRDSQGITAPLGAVRLPKSRGLGAK  805



>ref|XP_010109666.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
 gb|EXC23988.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
Length=804

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 103/173 (60%), Gaps = 26/173 (15%)
 Frame = -2

Query  866  ITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPI  690
            I + T S+D    +   S S   GAFE HT GFGSKMM KMGF  G GLGKD QGI  PI
Sbjct  656  IVDDTASNDPASSRPLKSKSQKLGAFEKHTKGFGSKMMAKMGFVEGKGLGKDSQGIVNPI  715

Query  689  QVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSP  510
            +   RPK+LGLG +   +   ++T +  P S       P +S+                 
Sbjct  716  K---RPKSLGLGVEF--SHIVDDTASSDPAS-----SRPLKSKSQK--------------  751

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
              G+FE HTKGFGSKMMAKMGFVEG GLGKDSQGI  P+LA R PKS+GLGAK
Sbjct  752  -LGAFEKHTKGFGSKMMAKMGFVEGKGLGKDSQGIVNPLLAVRLPKSRGLGAK  803


 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 123/190 (65%), Gaps = 27/190 (14%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M SE VE    + +E+ +S  + K V+ S N+GAFE HT GFGSKMM KMGF
Sbjct  563  VSFVSSGVMQSETVEDTAADFSET-NSGWKNKEVAGSANFGAFEEHTKGFGSKMMAKMGF  621

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGK+G+GIAEPI+V +RPK+LGLG +   +   ++T +  P S       P +S+
Sbjct  622  IEGGGLGKEGKGIAEPIEVIKRPKSLGLGVEF--SHIVDDTASNDPAS-----SRPLKSK  674

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
                               G+FE HTKGFGSKMMAKMGFVEG GLGKDSQGI  PI   +
Sbjct  675  SQK---------------LGAFEKHTKGFGSKMMAKMGFVEGKGLGKDSQGIVNPI---K  716

Query  380  RPKSQGLGAK  351
            RPKS GLG +
Sbjct  717  RPKSLGLGVE  726



>ref|NP_001152479.1| LOC100286119 [Zea mays]
 gb|ACG47812.1| G-patch domain containing protein [Zea mays]
 tpg|DAA46960.1| TPA: g-patch domain containing protein [Zea mays]
Length=733

 Score =   144 bits (363),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 108/190 (57%), Gaps = 18/190 (9%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+  G +     E  I   +    SC  K   S+ST+ G+FE+HT GFGSKMM KMGF
Sbjct  558  VSFVKCGTIVDSLTEA-IAGPSGGDTSC-VKPVESNSTHLGSFEVHTKGFGSKMMAKMGF  615

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +    K +           
Sbjct  616  IEGTGLGKDGQGIVQPIQAVHRPKSLGLGVEFDSVAEAIKARAEPIKLI-----------  664

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
                   +       + G GSFE HTKGFGSKMM  MGFV G+GLGKD QGI  P+   R
Sbjct  665  ----SELRRNVWAPETSGVGSFEKHTKGFGSKMMVNMGFVPGSGLGKDGQGIATPLTGVR  720

Query  380  RPKSQGLGAK  351
            RPKS+GLGA+
Sbjct  721  RPKSRGLGAE  730



>ref|XP_006453696.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 ref|XP_006453697.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66936.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66937.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
Length=744

 Score =   144 bits (362),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 124/189 (66%), Gaps = 16/189 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            +SF+SSGI+ S+ VE++  ++ E +++   K  VSS T  GAFE+HT GFGSKMM KMG+
Sbjct  569  MSFVSSGILQSDSVEIRTVDAVEINETFESKGTVSS-TQIGAFEVHTKGFGSKMMAKMGY  627

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+++PI+  QRPK LGLG +   T   +  K     S            
Sbjct  628  VEGGGLGKDGQGMSKPIEAIQRPKKLGLGVEFSNTDDDSSRKESRSDSA-----------  676

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
               +K S+   A+ G+   G+FE HT+GFGSKMMAKMGFVEG GLG+DSQGI  P+ A R
Sbjct  677  ---RKESRSNSAKKGAQNIGAFEKHTRGFGSKMMAKMGFVEGMGLGRDSQGIVNPLAAVR  733

Query  380  RPKSQGLGA  354
             PKS+GLGA
Sbjct  734  LPKSRGLGA  742


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGSKMMAKMG+VEG GLGKD QG++ PI A +RPK  GLG +
Sbjct  607  IGAFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMSKPIEAIQRPKKLGLGVE  658



>gb|KCW82693.1| hypothetical protein EUGRSUZ_C04073 [Eucalyptus grandis]
Length=304

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 119/218 (55%), Gaps = 31/218 (14%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+   E  E+       +S++  +   + +S ++GAFE+ T GFGSKM  K   
Sbjct  101  VSFVSSGVTPPETTEISPVNLAGASENGEKHVTLVTSESFGAFEVQTRGFGSKMRRKWDL  160

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANETKTPTPKSVGFGEDLP  573
              G GLGK G  +AEPIQ  +RP++LGLG   PE+        E+++ + KS   G    
Sbjct  161  IEGQGLGKGGTSLAEPIQAIKRPQSLGLGMSFPESGEEPERNKESESQSAKSKQSGRGAS  220

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
             R                     G+FE HTKGFGS++MAKMGFVEG GLGKDSQGI  P+
Sbjct  221  VRRTPQS---------------IGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPL  265

Query  392  LATRRPKSQGLGA-----------K**FMVSFHSLSSR  312
             A R PKS+GLGA              ++VS+ +L SR
Sbjct  266  AAVRLPKSRGLGATLVRIYRSPTSASSYLVSYSTLQSR  303



>gb|KCW44417.1| hypothetical protein EUGRSUZ_L02096 [Eucalyptus grandis]
Length=287

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 115/192 (60%), Gaps = 20/192 (10%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M SE  E+       +S++  E   + +S ++GAFE+H  GFGSKMM KMGF
Sbjct  88   VSFVSSGVMPSETTEISPVNLAGASENGEEHVTLITSESFGAFEVHARGFGSKMMAKMGF  147

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANETKTPTPKSVGFGEDLP  573
              G GLGK G G+AEPI+V + PK+LGLG   PE+        E+++ + KS   G    
Sbjct  148  IEGQGLGKGGTGLAEPIEVIKHPKSLGLGMSFPESGEEPERNRESESQSAKSKQSGRGAS  207

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
             R                     G+FE HTKGFGS++MAKMGFVE  GLGKDSQGI  P+
Sbjct  208  VRRTPQ---------------SIGAFERHTKGFGSRVMAKMGFVESMGLGKDSQGIVNPL  252

Query  392  LATRRPKSQGLG  357
             A R PKS+GLG
Sbjct  253  AAVRLPKSRGLG  264



>ref|XP_009366281.1| PREDICTED: uncharacterized protein LOC103956064 [Pyrus x bretschneideri]
Length=758

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 124/191 (65%), Gaps = 21/191 (11%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITEST--ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKM  744
            VSF+SSG+M S       TES   +S D+  + K V+ ST Y +FE+HT GFGSKM+ KM
Sbjct  584  VSFVSSGVMQS------ATESVTVDSIDASCKGKAVAESTEYRSFEVHTKGFGSKMLAKM  637

Query  743  GFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTR  567
            G+  GGGLGKDGQG+A PI+V QRPK+LGLG +   +     ++TP P +    +  P R
Sbjct  638  GYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSSSIEIPVSRTP-PVNNNAVKSNPVR  696

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
            SR   +               G+FE HTKGFGSKMMAKMGFVEGTGLGKDSQGI  P+ A
Sbjct  697  SRSQTQSQR-----------VGAFERHTKGFGSKMMAKMGFVEGTGLGKDSQGIVNPLSA  745

Query  386  TRRPKSQGLGA  354
             R PKS+GLGA
Sbjct  746  VRLPKSRGLGA  756


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  619  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  670



>ref|XP_009341849.1| PREDICTED: uncharacterized protein LOC103933875 [Pyrus x bretschneideri]
Length=765

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 124/191 (65%), Gaps = 21/191 (11%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITEST--ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKM  744
            VSF+SSG+M S       TES   +S D+  + K V+ ST Y +FE+HT GFGSKM+ KM
Sbjct  591  VSFVSSGVMQS------ATESVTVDSIDASCKGKAVAESTEYRSFEVHTKGFGSKMLAKM  644

Query  743  GFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTR  567
            G+  GGGLGKDGQG+A PI+V QRPK+LGLG +   +     ++TP P +    +  P R
Sbjct  645  GYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSSSIEILVSRTP-PVNNNAVKSNPVR  703

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
            SR   +               G+FE HTKGFGSKMMAKMGFVEGTGLGKDSQGI  P+ A
Sbjct  704  SRSQTQSQR-----------VGAFERHTKGFGSKMMAKMGFVEGTGLGKDSQGIVNPLSA  752

Query  386  TRRPKSQGLGA  354
             R PKS+GLGA
Sbjct  753  VRLPKSRGLGA  763


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  327
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +  F  S  
Sbjct  626  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE--FSSSIE  683

Query  326  SLSSR  312
             L SR
Sbjct  684  ILVSR  688



>ref|XP_009341804.1| PREDICTED: uncharacterized protein LOC103933838 [Pyrus x bretschneideri]
Length=765

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 124/191 (65%), Gaps = 21/191 (11%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITEST--ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKM  744
            VSF+SSG+M S       TES   +S D+  + K V+ ST Y +FE+HT GFGSKM+ KM
Sbjct  591  VSFVSSGVMQS------ATESVTVDSIDASCKGKAVAESTEYRSFEVHTKGFGSKMLAKM  644

Query  743  GFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTR  567
            G+  GGGLGKDGQG+A PI+V QRPK+LGLG +   +     ++TP P +    +  P R
Sbjct  645  GYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSSSIEILVSRTP-PVNNNAVKSNPVR  703

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
            SR   +               G+FE HTKGFGSKMMAKMGFVEGTGLGKDSQGI  P+ A
Sbjct  704  SRSQTQSQR-----------VGAFERHTKGFGSKMMAKMGFVEGTGLGKDSQGIVNPLSA  752

Query  386  TRRPKSQGLGA  354
             R PKS+GLGA
Sbjct  753  VRLPKSRGLGA  763


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  327
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +  F  S  
Sbjct  626  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE--FSSSIE  683

Query  326  SLSSR  312
             L SR
Sbjct  684  ILVSR  688



>ref|XP_007155121.1| hypothetical protein PHAVU_003G175300g [Phaseolus vulgaris]
 gb|ESW27115.1| hypothetical protein PHAVU_003G175300g [Phaseolus vulgaris]
Length=759

 Score =   142 bits (358),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 120/193 (62%), Gaps = 18/193 (9%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSGI+ SE V L + E+ E+       K V+ S N G+FE HTTGFGSKMM KMG+
Sbjct  580  VSFVSSGIIDSETVPLMVFEAEETYG-----KGVTGSANIGSFEEHTTGFGSKMMAKMGY  634

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTPT---PKSVGFGEDLPT  570
            TGGG        +A+PIQV QRPK+LGLG +          KT      +SVG G +L  
Sbjct  635  TGGGGLGKNGQGMAQPIQVIQRPKSLGLGVEFSSDPGEPARKTSLRVGAESVGLGVELSN  694

Query  569  RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPIL  390
            +  + G   S            G+FE HTKGFGSKMMAKMGFVEG GLG++SQGIT P+ 
Sbjct  695  KPGEPGMNRSSR---------VGAFERHTKGFGSKMMAKMGFVEGKGLGRESQGITTPLT  745

Query  389  ATRRPKSQGLGAK  351
            A R PKS+GLGAK
Sbjct  746  ALRLPKSRGLGAK  758



>ref|XP_006407631.1| hypothetical protein EUTSA_v10020109mg [Eutrema salsugineum]
 gb|ESQ49084.1| hypothetical protein EUTSA_v10020109mg [Eutrema salsugineum]
Length=783

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 127/198 (64%), Gaps = 16/198 (8%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTN---YGAFELHTTGFGSKMMVK  747
            VSF+SSG++ SE    K   S++  D+    +    +TN    GAFE+HT GFGSKMM K
Sbjct  592  VSFVSSGVIDSEIAVAKT--SSDDRDAKQVAETTPGATNGAYIGAFEVHTKGFGSKMMAK  649

Query  746  MGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPT  570
            MGF  GGGLGKDG+GIA+PI+  QRPK+LGLG D P  S     + P+P S     + P+
Sbjct  650  MGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFPINS-----EDPSPSSNNAKRNKPS  704

Query  569  Rsrksgkkgsqgq-----kaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGI  405
             S K  K+ S         A+      G+FE HT GFGS+MMA+MGFVEG+GLG+DSQGI
Sbjct  705  SSGKHVKRISHESGGASGSARIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRDSQGI  764

Query  404  TAPILATRRPKSQGLGAK  351
              P+ A RRPK++GLGA+
Sbjct  765  VNPLFAVRRPKARGLGAE  782



>ref|XP_012071430.1| PREDICTED: uncharacterized protein LOC105633456 [Jatropha curcas]
 gb|KDP38622.1| hypothetical protein JCGZ_03975 [Jatropha curcas]
Length=756

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 123/191 (64%), Gaps = 26/191 (14%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+S GIMS E V+    +S E+  S  E K    S   G+FE+HT GFGSKMM KMG+
Sbjct  589  VSFVSKGIMS-EMVDTMTKDSEEAETS--ENKVTIISAKVGSFEVHTKGFGSKMMAKMGY  645

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSV-GFGEDLPTRs  564
              GGGLGKDGQG+AEPI+V QRPK+LGLGA++  ++  +++    P+++  F +    R 
Sbjct  646  VEGGGLGKDGQGMAEPIEVIQRPKSLGLGANI--SNPTDDSMENKPQTIERFEKHAKPR-  702

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                G+FE HTKGFGSKMMA+MGFVEG GLGK SQGI  P++A 
Sbjct  703  ------------------NLGAFEKHTKGFGSKMMARMGFVEGMGLGKHSQGIINPLVAA  744

Query  383  RRPKSQGLGAK  351
            R PKS+GLGAK
Sbjct  745  RLPKSRGLGAK  755



>ref|XP_008336930.1| PREDICTED: uncharacterized protein LOC103400027 [Malus domestica]
Length=757

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 120/188 (64%), Gaps = 18/188 (10%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG+M S    L + +S E+S    + K  + ST Y +FE+HT GFGSKM+ KMG+
Sbjct  584  VSFVSSGVMQSAAEGLTV-DSIEAS----KNKVAAESTEYRSFEVHTKGFGSKMLAKMGY  638

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GGGLGKDGQG+A PI+V QRPK+LGLG +         +KTP  K++      P R R
Sbjct  639  IEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSTPVEIPVSKTPPVKNI------PVRRR  692

Query  560  ksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATR  381
               +      +        GSFE HTKGFGSKMMAKMGFVEG GLGKDSQGI  P+ A R
Sbjct  693  SQAQSSQTQSER------VGSFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVYPLAAVR  746

Query  380  RPKSQGLG  357
             PKS+GLG
Sbjct  747  LPKSRGLG  754


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  618  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  669



>gb|KFK38375.1| hypothetical protein AALP_AA3G105800 [Arabis alpina]
Length=761

 Score =   139 bits (350),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 124/197 (63%), Gaps = 13/197 (7%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSS--TNYGAFELHTTGFGSKMMVKM  744
            VSF+SSG++ SE    K +   +++    E    +SS   + GAFE+HT GFGSKMM KM
Sbjct  569  VSFVSSGVIDSEIAVAKTSSDDKNTKQVAETTLGASSDGVDIGAFEVHTRGFGSKMMAKM  628

Query  743  GFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-----PETSTANETKTPTPKSVGFGE  582
            GF  GGGLGKDG+GIA+PI+  QRPK+LGLG D        +S++N  K   P S G   
Sbjct  629  GFIEGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSISTEDPSSSSNNAKRNRPSSSG---  685

Query  581  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  402
                  R S   G     A+      G+FE HT GFGSKMMA+MGFVEG+GLG+DSQGI 
Sbjct  686  --KHVKRISHDSGGGSGSARIRDKRLGAFEQHTTGFGSKMMARMGFVEGSGLGRDSQGIV  743

Query  401  APILATRRPKSQGLGAK  351
             P++A RRP+ +GLGA+
Sbjct  744  NPLVAVRRPRVRGLGAE  760



>ref|XP_007203786.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
 gb|EMJ04985.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
Length=767

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 122/191 (64%), Gaps = 23/191 (12%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITEST--ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKM  744
            VSF+SSG+M S       TEST  +S D   + K V  +  + +FE+HT GFGSKM+ KM
Sbjct  595  VSFVSSGLMQS------ATESTTVDSIDPSSKNKDVVEAAEFHSFEVHTKGFGSKMLAKM  648

Query  743  GFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTR  567
            GF  GGGLGKDGQG+A PI+V QRPK+LGLG +   T       TP        +  P +
Sbjct  649  GFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSNTVDLPVNNTPV-------KSYPVK  701

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
            ++   ++ SQ Q+        GSFE HTKGFGSKMMAKMGFVEG GLGKDSQGI  P+ A
Sbjct  702  NKSQSQRVSQPQR-------VGSFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLAA  754

Query  386  TRRPKSQGLGA  354
             R PKS+GLGA
Sbjct  755  VRLPKSRGLGA  765


 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG+ API   +RPKS GLG +
Sbjct  630  FHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  681



>ref|XP_010265699.1| PREDICTED: uncharacterized protein LOC104603377 [Nelumbo nucifera]
Length=820

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 126/234 (54%), Gaps = 54/234 (23%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFISSG+M  + VE   T  +  ++S  E K VS+S+  GAFE+HT GFGSKMM KMGF
Sbjct  596  VSFISSGVMRVDVVEEITTPESNKNNSSIESKDVSNSSKLGAFEMHTRGFGSKMMTKMGF  655

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-----------PETSTANETKT------  612
              GGGLGKDGQG+ EPI+  +RPK+LGLG +            PE   A E  T      
Sbjct  656  VEGGGLGKDGQGMVEPIEAIKRPKSLGLGVNFSKTDDDTVRSKPEQFRAFEKHTKGFGSK  715

Query  611  ---------------------------PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygS  513
                                         PKS+G G +            +     +   
Sbjct  716  MMAKMGFVEGGGLGKDGQGMVEPIEAIKRPKSLGLGVNF---------SKTDDDTVRSKP  766

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
              F +FE HTKGFGSKMMAKMGFVEG GLG+DSQG+  P++A R PKS+GLGAK
Sbjct  767  EQFRAFEKHTKGFGSKMMAKMGFVEGMGLGRDSQGMVNPLVAVRLPKSRGLGAK  820



>ref|XP_008242893.1| PREDICTED: uncharacterized protein LOC103341193 [Prunus mume]
Length=769

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 121/191 (63%), Gaps = 23/191 (12%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITEST--ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKM  744
            VSF+SSG+M S       TEST  +S D   + K V     + +FE+HT GFGSKM+ KM
Sbjct  597  VSFVSSGVMQS------ATESTTVDSVDPSSKNKDVVEVAEFHSFEVHTKGFGSKMLAKM  650

Query  743  GFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTR  567
            GF  GGGLGKDGQG+A PI+V QRPK+LGLG +   T       TP   +       P +
Sbjct  651  GFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSNTVDLPVNNTPVKSN-------PVK  703

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
            ++   ++ SQ QK        GSFE HTKGFGSKMMAKMGFVEG GLGKDSQGI  P+ A
Sbjct  704  NKAQSQRVSQPQK-------VGSFEKHTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLAA  756

Query  386  TRRPKSQGLGA  354
             R PKS+GLGA
Sbjct  757  VRLPKSRGLGA  767


 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG+ API   +RPKS GLG +
Sbjct  632  FHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  683



>ref|XP_011655824.1| PREDICTED: uncharacterized protein LOC101215133 isoform X3 [Cucumis 
sativus]
Length=649

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 118/207 (57%), Gaps = 35/207 (17%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVS---------------SSTNYGAFEL  783
            VSF+SSG+M  E +E K       +D   +   VS               S  + G+FEL
Sbjct  459  VSFVSSGVMQPESMEEKPVNDVNDADKGKDIVAVSEMIEMTTSNVNNMDISRDSIGSFEL  518

Query  782  HTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST--ANETKT  612
            HT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST  A + + 
Sbjct  519  HTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTSAAGDNQA  578

Query  611  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  432
                S   G                   A   +   G+FE HTKGFGSKMMAKMGFVEG 
Sbjct  579  SGISSARTG-----------------SSALEKTKKIGAFEVHTKGFGSKMMAKMGFVEGM  621

Query  431  GLGKDSQGITAPILATRRPKSQGLGAK  351
            GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  622  GLGKDSQGIINPLLPVRRPKARGLGAK  648



>ref|XP_004146703.1| PREDICTED: uncharacterized protein LOC101215133 isoform X2 [Cucumis 
sativus]
Length=793

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 118/207 (57%), Gaps = 35/207 (17%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVS---------------SSTNYGAFEL  783
            VSF+SSG+M  E +E K       +D   +   VS               S  + G+FEL
Sbjct  603  VSFVSSGVMQPESMEEKPVNDVNDADKGKDIVAVSEMIEMTTSNVNNMDISRDSIGSFEL  662

Query  782  HTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST--ANETKT  612
            HT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST  A + + 
Sbjct  663  HTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTSAAGDNQA  722

Query  611  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  432
                S   G                   A   +   G+FE HTKGFGSKMMAKMGFVEG 
Sbjct  723  SGISSARTG-----------------SSALEKTKKIGAFEVHTKGFGSKMMAKMGFVEGM  765

Query  431  GLGKDSQGITAPILATRRPKSQGLGAK  351
            GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  766  GLGKDSQGIINPLLPVRRPKARGLGAK  792



>gb|KGN65218.1| hypothetical protein Csa_1G266150 [Cucumis sativus]
Length=783

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 118/207 (57%), Gaps = 35/207 (17%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVS---------------SSTNYGAFEL  783
            VSF+SSG+M  E +E K       +D   +   VS               S  + G+FEL
Sbjct  593  VSFVSSGVMQPESMEEKPVNDVNDADKGKDIVAVSEMIEMTTSNVNNMDISRDSIGSFEL  652

Query  782  HTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST--ANETKT  612
            HT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST  A + + 
Sbjct  653  HTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTSAAGDNQA  712

Query  611  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  432
                S   G                   A   +   G+FE HTKGFGSKMMAKMGFVEG 
Sbjct  713  SGISSARTG-----------------SSALEKTKKIGAFEVHTKGFGSKMMAKMGFVEGM  755

Query  431  GLGKDSQGITAPILATRRPKSQGLGAK  351
            GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  756  GLGKDSQGIINPLLPVRRPKARGLGAK  782



>ref|XP_011655819.1| PREDICTED: uncharacterized protein LOC101215133 isoform X1 [Cucumis 
sativus]
Length=803

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 118/207 (57%), Gaps = 35/207 (17%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVS---------------SSTNYGAFEL  783
            VSF+SSG+M  E +E K       +D   +   VS               S  + G+FEL
Sbjct  613  VSFVSSGVMQPESMEEKPVNDVNDADKGKDIVAVSEMIEMTTSNVNNMDISRDSIGSFEL  672

Query  782  HTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST--ANETKT  612
            HT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST  A + + 
Sbjct  673  HTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTSAAGDNQA  732

Query  611  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  432
                S   G                   A   +   G+FE HTKGFGSKMMAKMGFVEG 
Sbjct  733  SGISSARTG-----------------SSALEKTKKIGAFEVHTKGFGSKMMAKMGFVEGM  775

Query  431  GLGKDSQGITAPILATRRPKSQGLGAK  351
            GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  776  GLGKDSQGIINPLLPVRRPKARGLGAK  802



>emb|CDY41580.1| BnaC05g43170D [Brassica napus]
Length=738

 Score =   133 bits (334),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 118/198 (60%), Gaps = 15/198 (8%)
 Frame = -2

Query  917  VSFISSGIMSSE----KVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMV  750
            VSF+SSGI+ SE    K    + ++ +  ++  E    SS  + GAFE+HT GFGSKMM 
Sbjct  546  VSFVSSGIIDSEIAVAKTSFDVKDAKQVGEATPE---ASSGADIGAFEVHTRGFGSKMMA  602

Query  749  KMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANETKTPTPKSVGFG  585
            KMGF  GG        IA+PI+  QRPK+LGLG     D  E S ++       +S   G
Sbjct  603  KMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDFSIDTEEASPSSNNNAKRNRSSSSG  662

Query  584  EDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGI  405
            + +    R S   G     A+      G+FE HT GFGS+MMA+MGFV+G+GLG++SQGI
Sbjct  663  KQV---KRVSHVIGGGSGSARIRDKRLGAFEQHTTGFGSRMMARMGFVDGSGLGRESQGI  719

Query  404  TAPILATRRPKSQGLGAK  351
              P++A RRPK++GLGA+
Sbjct  720  VNPLVAVRRPKARGLGAE  737



>ref|XP_008443896.1| PREDICTED: uncharacterized protein LOC103487380 isoform X1 [Cucumis 
melo]
Length=800

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 118/205 (58%), Gaps = 31/205 (15%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSD-------SCHEKKCVSSSTN--------YGAFEL  783
            VSF+S G+M  E +E++        D       +    + ++S+ N         G+FEL
Sbjct  610  VSFVSCGVMQPELMEVRQVHDANDVDKGKDIVATSEMIEMITSNVNNTDISRDSIGSFEL  669

Query  782  HTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
            HT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST+       
Sbjct  670  HTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTS----AAG  725

Query  605  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  426
                 +     TRS    K               G+FE HTKGFGSKMMAKMGFVEG GL
Sbjct  726  DNQASWVSSARTRSGALEKSKR-----------IGAFEVHTKGFGSKMMAKMGFVEGMGL  774

Query  425  GKDSQGITAPILATRRPKSQGLGAK  351
            GKDSQGI  P+L  RRPK++GLGAK
Sbjct  775  GKDSQGIVNPLLPVRRPKARGLGAK  799



>ref|XP_008443898.1| PREDICTED: uncharacterized protein LOC103487380 isoform X2 [Cucumis 
melo]
Length=795

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 118/205 (58%), Gaps = 31/205 (15%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSD-------SCHEKKCVSSSTN--------YGAFEL  783
            VSF+S G+M  E +E++        D       +    + ++S+ N         G+FEL
Sbjct  605  VSFVSCGVMQPELMEVRQVHDANDVDKGKDIVATSEMIEMITSNVNNTDISRDSIGSFEL  664

Query  782  HTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
            HT GFGSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST+       
Sbjct  665  HTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTS----AAG  720

Query  605  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  426
                 +     TRS    K               G+FE HTKGFGSKMMAKMGFVEG GL
Sbjct  721  DNQASWVSSARTRSGALEKSKR-----------IGAFEVHTKGFGSKMMAKMGFVEGMGL  769

Query  425  GKDSQGITAPILATRRPKSQGLGAK  351
            GKDSQGI  P+L  RRPK++GLGAK
Sbjct  770  GKDSQGIVNPLLPVRRPKARGLGAK  794



>ref|XP_010464642.1| PREDICTED: uncharacterized protein LOC104745160 isoform X3 [Camelina 
sativa]
Length=776

 Score =   132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 112/194 (58%), Gaps = 9/194 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE    K +   ++          S+  + GAFE+HT GFGSKMM KMGF
Sbjct  586  VSFVSSGVIDSEIAVAKASGEKDAKRVAETTPGTSNGADIGAFEMHTRGFGSKMMAKMGF  645

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANETKTPTPKSVGFGEDLP  573
              GG        IA+PI+  +RPK+LGLG     D  + S ++       +S   G+ + 
Sbjct  646  IDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSNNNAKRNRSSSSGKHV-  704

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
               +            +      G+FE HT+GFGS+MMA+MGFVEG+GLG+DSQGI  P+
Sbjct  705  ---KHISHDNGASSSGRIRDKRLGAFEQHTRGFGSRMMARMGFVEGSGLGRDSQGIVNPL  761

Query  392  LATRRPKSQGLGAK  351
            +A RRP+++G+GA+
Sbjct  762  VAVRRPRARGIGAE  775



>ref|XP_010464640.1| PREDICTED: uncharacterized protein LOC104745160 isoform X1 [Camelina 
sativa]
 ref|XP_010464641.1| PREDICTED: uncharacterized protein LOC104745160 isoform X2 [Camelina 
sativa]
Length=777

 Score =   132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 112/194 (58%), Gaps = 9/194 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE    K +   ++          S+  + GAFE+HT GFGSKMM KMGF
Sbjct  587  VSFVSSGVIDSEIAVAKASGEKDAKRVAETTPGTSNGADIGAFEMHTRGFGSKMMAKMGF  646

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANETKTPTPKSVGFGEDLP  573
              GG        IA+PI+  +RPK+LGLG     D  + S ++       +S   G+ + 
Sbjct  647  IDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSNNNAKRNRSSSSGKHV-  705

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
               +            +      G+FE HT+GFGS+MMA+MGFVEG+GLG+DSQGI  P+
Sbjct  706  ---KHISHDNGASSSGRIRDKRLGAFEQHTRGFGSRMMARMGFVEGSGLGRDSQGIVNPL  762

Query  392  LATRRPKSQGLGAK  351
            +A RRP+++G+GA+
Sbjct  763  VAVRRPRARGIGAE  776



>ref|XP_002884758.1| hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61017.1| hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score =   132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 114/195 (58%), Gaps = 11/195 (6%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSGI+ SE    K     ++          S+  + GAFE+HT GFGSKMM KMGF
Sbjct  587  VSFVSSGIIDSEIAVGKTLGEKDAKQVAESTPGTSNGADIGAFEVHTRGFGSKMMAKMGF  646

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRsr  561
              GG        IA+PI+  QRPK+LGLG D        +T+ PTP S    +   + S 
Sbjct  647  IDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDF-----NIDTEDPTPSSNNNAKRNRSSSS  701

Query  560  ksgkkgsqgqkaqygSPG-----FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAP  396
                K    +    GS G      G+FE HT GFGS+MMA+MGFVEG+GLG++SQGI  P
Sbjct  702  GKHVKRISHENGASGSGGIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRESQGIVNP  761

Query  395  ILATRRPKSQGLGAK  351
            ++A RRP+++G+GA+
Sbjct  762  LVAVRRPRARGIGAE  776



>ref|XP_010486559.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010486560.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Camelina 
sativa]
Length=775

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 111/194 (57%), Gaps = 9/194 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE    K +   ++          S+  + GAFELHT GFGSKMM KMGF
Sbjct  585  VSFVSSGVIDSEIAIAKTSGEKDAKRVAETTPGTSNGADIGAFELHTRGFGSKMMAKMGF  644

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANETKTPTPKSVGFGEDLP  573
              GG        IA+PI+  +RPK+LGLG     D  + S ++       +S   G+ + 
Sbjct  645  IDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSNNNAKRNRSSSSGKHV-  703

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
               +            +      G+FE HT GFGS+MMA+MGFVEG+GLG+DSQGI  P+
Sbjct  704  ---KHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRDSQGIVNPL  760

Query  392  LATRRPKSQGLGAK  351
            +A RRP+++G+GA+
Sbjct  761  VAVRRPRARGIGAE  774



>ref|XP_010486561.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Camelina 
sativa]
Length=777

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 111/194 (57%), Gaps = 9/194 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE    K +   ++          S+  + GAFELHT GFGSKMM KMGF
Sbjct  587  VSFVSSGVIDSEIAIAKTSGEKDAKRVAETTPGTSNGADIGAFELHTRGFGSKMMAKMGF  646

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANETKTPTPKSVGFGEDLP  573
              GG        IA+PI+  +RPK+LGLG     D  + S ++       +S   G+ + 
Sbjct  647  IDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSNNNAKRNRSSSSGKHV-  705

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
               +            +      G+FE HT GFGS+MMA+MGFVEG+GLG+DSQGI  P+
Sbjct  706  ---KHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRDSQGIVNPL  762

Query  392  LATRRPKSQGLGAK  351
            +A RRP+++G+GA+
Sbjct  763  VAVRRPRARGIGAE  776



>ref|XP_010477969.1| PREDICTED: uncharacterized protein LOC104756959 [Camelina sativa]
Length=775

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 108/196 (55%), Gaps = 13/196 (7%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE    K T   ++          S+  + GAFELHT GFGSKMM KMGF
Sbjct  585  VSFVSSGVIDSEIAVAKTTGEKDAKRVAETTPGTSNGADIGAFELHTRGFGSKMMAKMGF  644

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLGADVP-ET-----STANETKTPTPKSVGFGED  579
              GG        IA+PI+  +RPK+LGLG D   ET     S+ N  K     S G    
Sbjct  645  IDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIETEDMSPSSNNNAKRNRSSSSG----  700

Query  578  LPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITA  399
                 +            +      G+FE HT GFGS+MMA+MGFVEG+GLG+DSQGI  
Sbjct  701  --KHVKHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRDSQGIVN  758

Query  398  PILATRRPKSQGLGAK  351
            P+ A RRP+ +G+GA+
Sbjct  759  PLAAVRRPRGRGIGAE  774



>ref|XP_010244790.1| PREDICTED: uncharacterized protein LOC104588524 [Nelumbo nucifera]
Length=737

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 115/190 (61%), Gaps = 35/190 (18%)
 Frame = -2

Query  917  VSFISSGIMSSE-KVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMG  741
            V F+SSGIM ++ + +++  +S ++  +  E + +SSS+  GAFE+HT GFGSKMM KMG
Sbjct  579  VLFVSSGIMHADVQEDMRTPDSNKNCSTDPENRVISSSSKLGAFEMHTKGFGSKMMAKMG  638

Query  740  FT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPTRs  564
            F  GGGLG+DGQG+ EP++  + PK+LGLG                 K++G     P R 
Sbjct  639  FVEGGGLGRDGQGMVEPLEAIKWPKSLGLGVKFS-------------KAIGTARSQPER-  684

Query  563  rksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILAT  384
                                G+FE HTKG GS+MM +MGFVEG GLG+DSQGI  P++A 
Sbjct  685  -------------------IGAFEKHTKGSGSRMMERMGFVEGMGLGRDSQGIVTPLVAV  725

Query  383  RRPKSQGLGA  354
            R PKS+GLGA
Sbjct  726  RLPKSRGLGA  735


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGSKMMAKMGFVEG GLG+D QG+  P+ A + PKS GLG K
Sbjct  619  LGAFEMHTKGFGSKMMAKMGFVEGGGLGRDGQGMVEPLEAIKWPKSLGLGVK  670


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  645
            GAFE HT G GS+MM +MGF  G GLG+D QGI  P+   + PK+ GLGA+ 
Sbjct  686  GAFEKHTKGSGSRMMERMGFVEGMGLGRDSQGIVTPLVAVRLPKSRGLGANA  737



>ref|XP_004287228.1| PREDICTED: uncharacterized protein LOC101294206 [Fragaria vesca 
subsp. vesca]
Length=778

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 112/199 (56%), Gaps = 12/199 (6%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESS----------DSCHEKKCVSSSTNYGAFELHTTGF  768
            VSF+SSG+M S+  E+   +S  S           D+  + +    S ++ +FE+HT GF
Sbjct  581  VSFVSSGVMQSQ-TEITTIDSVASRTEIITIKSTIDASSKNEGAVGSADFRSFEVHTKGF  639

Query  767  GSKMMVKMGFTGGGLGKDGQGI-AEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVG  591
            GSKM+ KMGF  GG         AEPI+  QRPK+LGLG +   T       TP+ ++  
Sbjct  640  GSKMLAKMGFIEGGGLGKDGQGRAEPIEAVQRPKSLGLGVEFSNTIGVQVINTPSRQNPA  699

Query  590  FGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQ  411
                    S KS    +   + +  +   GSFE HTKGFGSKMMA+MGFVEG GLGKDSQ
Sbjct  700  KNTPAKRNSAKSMLAKNNPVRNKPQTERVGSFERHTKGFGSKMMARMGFVEGMGLGKDSQ  759

Query  410  GITAPILATRRPKSQGLGA  354
            GI  P+ A R  KS+G+GA
Sbjct  760  GIVNPLAAVRLRKSRGIGA  778


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG   PI A +RPKS GLG +
Sbjct  629  FRSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGRAEPIEAVQRPKSLGLGVE  680



>ref|XP_006299668.1| hypothetical protein CARUB_v10015856mg [Capsella rubella]
 gb|EOA32566.1| hypothetical protein CARUB_v10015856mg [Capsella rubella]
Length=774

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 119/194 (61%), Gaps = 9/194 (5%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSG++ SE      + + ++          S+  + GAFE+HT GFGSKMM KMGF
Sbjct  584  VSFVSSGVIDSEIAVANTSGAKDAKQVAETTPGTSNGADIGAFEVHTRGFGSKMMAKMGF  643

Query  737  -TGGGLGKDGQGIAEPIQVSQRPKALGLG----ADVPETSTANETKTPTPKSVGFGEDLP  573
              GGGLGKDG+GI++PI+  QRPK+LGLG     D  +TS ++       +S   G+   
Sbjct  644  IDGGGLGKDGKGISQPIEAVQRPKSLGLGLDFSIDTEDTSPSSNNNAKRNRSSSSGK---  700

Query  572  TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPI  393
              ++            +      G+FE HT GFGS+MMA+MGFVEG+GLG++SQGI  P+
Sbjct  701  -HAKHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRESQGIVNPL  759

Query  392  LATRRPKSQGLGAK  351
            +A RRP+ +G+GA+
Sbjct  760  VAVRRPRVRGIGAE  773



>emb|CDY54616.1| BnaA05g28700D [Brassica napus]
Length=701

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 116/196 (59%), Gaps = 25/196 (13%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKC------VSSSTNYGAFELHTTGFGSKM  756
            VSF+S G++ SE     I  +  SSD    K+        SS  + GAFE+HT GFGSKM
Sbjct  523  VSFVSCGVIDSE-----IAVAKTSSDVNVAKQVGETTPEASSGADIGAFEVHTRGFGSKM  577

Query  755  MVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGED  579
            M KMGF  GG        IA+PI+  QRPK+LGLG D   +   +E   P   +      
Sbjct  578  MAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDF--SIDTDEASPPINNNA-----  630

Query  578  LPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITA  399
                  K  +  S G++ + GS   G+FE HT GFGS+MMA+MGFV+G+GLG++SQGI  
Sbjct  631  ------KKNRSSSSGKQVKRGSHDIGAFEQHTTGFGSRMMARMGFVDGSGLGRESQGIVN  684

Query  398  PILATRRPKSQGLGAK  351
            P++A RRP+++GLGA+
Sbjct  685  PLVAVRRPRARGLGAE  700



>ref|XP_010041360.1| PREDICTED: zinc finger CCCH-type with G patch domain-containing 
protein-like [Eucalyptus grandis]
Length=278

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 102/169 (60%), Gaps = 20/169 (12%)
 Frame = -2

Query  848  SSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRP  672
            +S++  E   + +S ++GAFE+H  GFGSKMM KMGF  G GLGK G G+AEPI+V + P
Sbjct  102  ASENGEEHVTLITSESFGAFEVHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHP  161

Query  671  KALGLGADVPET----STANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGF  504
            K+LGLG   PE+        E+++ + KS   G     R                     
Sbjct  162  KSLGLGMSFPESGEEPERNRESESQSAKSKQSGRGASVRRTPQ---------------SI  206

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G+FE HTKGFGS++MAKMGFVE  GLGKDSQGI  P+ A R PKS+GLG
Sbjct  207  GAFERHTKGFGSRVMAKMGFVESMGLGKDSQGIVNPLAAVRLPKSRGLG  255


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
            + GAFE HT GFGS++M KMGF    GLGKD QGI  P+   + PK+ GLG     T+  
Sbjct  205  SIGAFERHTKGFGSRVMAKMGFVESMGLGKDSQGIVNPLAAVRLPKSRGLG-----TTLV  259

Query  626  NETKTPTPKS  597
               ++PT  S
Sbjct  260  RIYRSPTSAS  269



>ref|XP_009146893.1| PREDICTED: uncharacterized protein LOC103870513 [Brassica rapa]
Length=739

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 116/206 (56%), Gaps = 31/206 (15%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKC------VSSSTNYGAFELHTTGFGSKM  756
            VSF+S G++ SE     I  +  SSD    K+        SS  + GAFE+HT GFGSKM
Sbjct  547  VSFVSCGVIDSE-----IAVAKTSSDVNVAKQVGETTPEASSGADIGAFEVHTRGFGSKM  601

Query  755  MVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADV---------PETSTANETKTPT  606
            M KMGF  GG        IA+PI+  QRPK+LGLG D          P  + A + ++ +
Sbjct  602  MAKMGFIEGGGLGKEGKGIAQPIEAIQRPKSLGLGLDFSIDTDEAISPINNNARKNRSSS  661

Query  605  P-KSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  429
              K V  G         S   G     A+      G+FE HT GFGS+MMA+MGFV+G+G
Sbjct  662  SGKQVKRG---------SHDIGGGSSSARIRDKRLGAFEQHTTGFGSRMMARMGFVDGSG  712

Query  428  LGKDSQGITAPILATRRPKSQGLGAK  351
            LG++SQGI  P++A RRP+++GLGA+
Sbjct  713  LGRESQGIVNPLVAVRRPRARGLGAE  738



>ref|NP_566359.1| D111/G-patch domain-containing protein [Arabidopsis thaliana]
 gb|AAF23251.1|AC015985_9 hypothetical protein [Arabidopsis thaliana]
 gb|AAL09738.1| AT3g09850/F8A24_10 [Arabidopsis thaliana]
 gb|AAN18212.1| At3g09850/F8A24_10 [Arabidopsis thaliana]
 gb|AEE74821.1| D111/G-patch domain-containing protein [Arabidopsis thaliana]
Length=781

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 107/192 (56%), Gaps = 3/192 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSF+SSGI+ SE    K +    + +        S+  + GAFE+HT GFGSKMM KMGF
Sbjct  589  VSFVSSGIIDSEIAVAKTSVEKVAKEVAETTPGTSNGADIGAFEVHTRGFGSKMMAKMGF  648

Query  737  TGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGEDLPT--R  567
              GG        IA+PI+  QRPK+LGLG D    +      +    +        +   
Sbjct  649  IDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSIDTEDPSPSSNNNNNAKRNRSSSSGKH  708

Query  566  srksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILA  387
             ++           +      G+FE HT GFGS+MMA+MGFVEG+GLG++SQGI  P++A
Sbjct  709  GKRITHDNGASGSGRIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRESQGIVNPLVA  768

Query  386  TRRPKSQGLGAK  351
             RRP+++G+GA+
Sbjct  769  VRRPRARGIGAE  780



>tpg|DAA46961.1| TPA: hypothetical protein ZEAMMB73_831663 [Zea mays]
Length=125

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 79/137 (58%), Gaps = 16/137 (12%)
 Frame = -2

Query  758  MMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGE  582
            MM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +    K +    
Sbjct  1    MMAKMGFIEGTGLGKDGQGIVQPIQAVHRPKSLGLGVEFDSVAEAIKARAEPIKLI----  56

Query  581  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  402
                          +       + G GSFE HTKGFGSKMM  MGFV G+GLGKD QGI 
Sbjct  57   -----------SELRRNVWAPETSGVGSFEKHTKGFGSKMMVNMGFVPGSGLGKDGQGIA  105

Query  401  APILATRRPKSQGLGAK  351
             P+   RRPKS+GLGA+
Sbjct  106  TPLTGVRRPKSRGLGAE  122


 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -2

Query  809  STNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  648
            ++  G+FE HT GFGSKMMV MGF  G GLGKDGQGIA P+   +RPK+ GLGA+
Sbjct  68   TSGVGSFEKHTKGFGSKMMVNMGFVPGSGLGKDGQGIATPLTGVRRPKSRGLGAE  122



>ref|XP_010040586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Eucalyptus grandis]
Length=981

 Score =   118 bits (296),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 81/136 (60%), Gaps = 20/136 (15%)
 Frame = -2

Query  746  MGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA----NETKTPTPKSVGFGE  582
            MGFT   GLGK G G+AEPI+V +RPK+LGLG   PE+        E+++ + KS   G 
Sbjct  1    MGFTEARGLGKGGTGLAEPIEVIKRPKSLGLGMSFPESGVEPERNRESESQSAKSKQSGR  60

Query  581  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  402
                R                     G+FE HTKGFGS++MAKMGFVEG GLGKDSQGI 
Sbjct  61   GASVRRTPQS---------------IGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIV  105

Query  401  APILATRRPKSQGLGA  354
             P+ A R PKS+GLGA
Sbjct  106  NPLAAVRLPKSRGLGA  121


 Score = 68.2 bits (165),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            +SF  SG+      E + ++S +S  S        +  + GAFE HT GFGS++M KMGF
Sbjct  33   MSFPESGVEPERNRESE-SQSAKSKQSGRGASVRRTPQSIGAFERHTKGFGSRVMAKMGF  91

Query  737  TGG-GLGKDGQGIAEPIQVSQRPKALGLGA  651
              G GLGKD QGI  P+   + PK+ GLGA
Sbjct  92   VEGMGLGKDSQGIVNPLAAVRLPKSRGLGA  121



>gb|KCW82695.1| hypothetical protein EUGRSUZ_C04076 [Eucalyptus grandis]
Length=123

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 82/138 (59%), Gaps = 24/138 (17%)
 Frame = -2

Query  746  MGFTGGG-LGKDGQGIAEPIQVSQRPKALGLGADVPET------STANETKTPTPKSVGF  588
            MGF  G  LG+ G G+AEPI+V +RPK+LGLG   PE+      +  +E+++   K  G 
Sbjct  1    MGFIEGQVLGRGGTGLAEPIEVIKRPKSLGLGMSFPESGEEPERNRESESQSAKLKQSGR  60

Query  587  GEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQG  408
            G  +                 +      G+FE HTKGFGS++MAKMGFVEG GLGKDSQG
Sbjct  61   GASV-----------------RRTPQSIGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQG  103

Query  407  ITAPILATRRPKSQGLGA  354
            I  P+ A R PKS+GLGA
Sbjct  104  IVNPLAAVRFPKSRGLGA  121


 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = -2

Query  863  TESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQ  687
            ++S +   S        +  + GAFE HT GFGS++M KMGF  G GLGKD QGI  P+ 
Sbjct  50   SQSAKLKQSGRGASVRRTPQSIGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPLA  109

Query  686  VSQRPKALGLGA  651
              + PK+ GLGA
Sbjct  110  AVRFPKSRGLGA  121



>emb|CBI25601.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFISSGIM SE V+++   S E+  + HE K  +SST  GAFE+HT GFGS+MM KMGF
Sbjct  544  VSFISSGIMQSEAVQMETAGSIEAESTYHENKGGASSTKLGAFEVHTKGFGSRMMAKMGF  603

Query  737  TGG-GLGKDGQGIAEPIQVSQRPKALGLGAD  648
              G GLGKDGQG+ + I+V++RPK+LGLG +
Sbjct  604  VAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  634


 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGS+MMAKMGFV G GLGKD QG+   I  T+RPKS GLG +
Sbjct  583  LGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  634



>ref|XP_002265219.2| PREDICTED: uncharacterized protein LOC100260114 [Vitis vinifera]
Length=677

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            VSFISSGIM SE V+++   S E+  + HE K  +SST  GAFE+HT GFGS+MM KMGF
Sbjct  585  VSFISSGIMQSEAVQMETAGSIEAESTYHENKGGASSTKLGAFEVHTKGFGSRMMAKMGF  644

Query  737  TGG-GLGKDGQGIAEPIQVSQRPKALGLGAD  648
              G GLGKDGQG+ + I+V++RPK+LGLG +
Sbjct  645  VAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  675


 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGS+MMAKMGFV G GLGKD QG+   I  T+RPKS GLG +
Sbjct  624  LGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  675



>gb|EPS60366.1| hypothetical protein M569_14436, partial [Genlisea aurea]
Length=64

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%), Gaps = 2/51 (4%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGG--GLGKDGQGIAEPIQVSQRPKALGLGA  651
            G+FE HTTGFGSKM+ KMG+ GG  GLGKDGQGI+EPI+VSQRPK+LGLGA
Sbjct  11   GSFERHTTGFGSKMLAKMGYVGGRRGLGKDGQGISEPIEVSQRPKSLGLGA  61


 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEG-TGLGKDSQGITAPILATRRPKSQGLGA  354
            GSFE HT GFGSKM+AKMG+V G  GLGKD QGI+ PI  ++RPKS GLGA
Sbjct  11   GSFERHTTGFGSKMLAKMGYVGGRRGLGKDGQGISEPIEVSQRPKSLGLGA  61



>gb|KDO59352.1| hypothetical protein CISIN_1g043289mg [Citrus sinensis]
Length=695

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            +SF+SSGI+ S+ VE++  ++ + +++C  K  VSS T  GAFE+HT GFGSKMM KMG+
Sbjct  569  MSFVSSGILQSDSVEIRTVDAVDINETCESKGTVSS-TQIGAFEVHTKGFGSKMMAKMGY  627

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  636
              GGGLGKDGQG+++PI+  QRPK LGLG +   T
Sbjct  628  VEGGGLGKDGQGMSKPIEAIQRPKKLGLGVEFSNT  662


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HTKGFGSKMMAKMG+VEG GLGKD QG++ PI A +RPK  GLG +
Sbjct  607  IGAFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMSKPIEAIQRPKKLGLGVE  658



>ref|XP_001776479.1| predicted protein [Physcomitrella patens]
 gb|EDQ58746.1| predicted protein [Physcomitrella patens]
Length=856

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
             G FE HTKGFGS+MM+KMGFVEG GLG+D QGI +P+ A +RPKS GLGA
Sbjct  799  IGHFEAHTKGFGSRMMSKMGFVEGQGLGRDGQGIYSPLEAVKRPKSLGLGA  849


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  860  ESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQV  684
            E+T S  S   K   +     G FE HT GFGS+MM KMGF  G GLG+DGQGI  P++ 
Sbjct  779  EATTSRSSTVVKVSSTVPATIGHFEAHTKGFGSRMMSKMGFVEGQGLGRDGQGIYSPLEA  838

Query  683  SQRPKALGLGADVPET  636
             +RPK+LGLGA  P T
Sbjct  839  VKRPKSLGLGAYAPST  854



>ref|XP_001418877.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97170.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=105

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -2

Query  860  ESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF--TGGGLGKDGQGIAEPIQ  687
            E  E + +      V +   YGAFE HTTGFGS+M+ KMGF   G G+G++G+GIAEP+ 
Sbjct  29   EFIEKARAKKRGTVVGAGHEYGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVT  88

Query  686  VSQRPKALGLGA  651
             + R K +GLGA
Sbjct  89   ATTRGKRVGLGA  100


 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  354
            +G+FE HT GFGS+M+AKMGF  +G+G+G++ +GI  P+ AT R K  GLGA
Sbjct  49   YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVTATTRGKRVGLGA  100



>ref|XP_003080235.1| Tuftelin-interacting protein TIP39, contains G-patch domain (ISS) 
[Ostreococcus tauri]
Length=230

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            V + + G   + + E +  E  E + +  +   V +   YGAFE HTTGFGS+M+ KMGF
Sbjct  135  VVYPNRGARRAAEHEQREREKLERARTKKKGVVVGAGHEYGAFEKHTTGFGSRMLAKMGF  194

Query  737  --TGGGLGKDGQGIAEPIQVSQRPKALGLGA  651
               G G+G++G GIAEP+    R K +GLGA
Sbjct  195  QGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  225


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  354
            +G+FE HT GFGS+M+AKMGF  +G+G+G++  GI  P+ A  R K  GLGA
Sbjct  174  YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  225



>emb|CEF98642.1| G-patch domain [Ostreococcus tauri]
Length=390

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            V + + G   + + E +  E  E + +  +   V +   YGAFE HTTGFGS+M+ KMGF
Sbjct  295  VVYPNRGARRAAEHEQREREKLERARTKKKGVVVGAGHEYGAFEKHTTGFGSRMLAKMGF  354

Query  737  --TGGGLGKDGQGIAEPIQVSQRPKALGLGA  651
               G G+G++G GIAEP+    R K +GLGA
Sbjct  355  QGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  385


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  354
            +G+FE HT GFGS+M+AKMGF  +G+G+G++  GI  P+ A  R K  GLGA
Sbjct  334  YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGAGIAEPLTAMTRAKRVGLGA  385



>ref|XP_005645320.1| hypothetical protein COCSUDRAFT_57335 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20776.1| hypothetical protein COCSUDRAFT_57335 [Coccomyxa subellipsoidea 
C-169]
Length=582

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -2

Query  821  CVSSSTNYGAFELHTTGFGSKMMVKMGF--TGGGLGKDGQGIAEPIQVSQRPKALGLGAD  648
             V +S  +G+FE HTTGFGS+M+ K GF   G GLG++ QG AEPI    RPK LGLGA+
Sbjct  521  IVETSLRFGSFERHTTGFGSRMLAKYGFEGQGAGLGRNSQGRAEPINAVMRPKNLGLGAN  580


 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGSFE HT GFGS+M+AK GF  +G GLG++SQG   PI A  RPK+ GLGA
Sbjct  528  FGSFERHTTGFGSRMLAKYGFEGQGAGLGRNSQGRAEPINAVMRPKNLGLGA  579



>emb|CDQ06825.1| Protein Bm9097, isoform a [Brugia malayi]
Length=434

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 65/148 (44%), Gaps = 27/148 (18%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
            + G +E HT G G K+++KMG+  G GLG+   GI   IQ    PK      D+  TS+ 
Sbjct  175  DIGDWEKHTRGIGMKLLLKMGYRAGEGLGRKSDGIVHAIQPVIFPKNEAATNDLA-TSSW  233

Query  626  NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  447
             E K     +V  G+                          G +E HT+G G K++ KMG
Sbjct  234  KEYKQERRGNVTIGD-------------------------IGDWEKHTRGIGMKLLLKMG  268

Query  446  FVEGTGLGKDSQGITAPILATRRPKSQG  363
            +  G GLG+ S GI   I     PK + 
Sbjct  269  YRAGEGLGRKSDGIVHAIQPVIFPKKKN  296



>ref|XP_006679437.1| hypothetical protein BATDEDRAFT_25372 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79675.1| hypothetical protein BATDEDRAFT_25372 [Batrachochytrium dendrobatidis 
JAM81]
Length=1036

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            F +FE HTKGFGSKM+AKMG+V GTGLG +  GI API    RP   GLG
Sbjct  282  FATFERHTKGFGSKMLAKMGYVPGTGLGANRVGIIAPIDVKLRPSGMGLG  331


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  654
            N+  FE HT GFGSKM+ KMG+  G GLG +  GI  PI V  RP  +GLG
Sbjct  281  NFATFERHTKGFGSKMLAKMGYVPGTGLGANRVGIIAPIDVKLRPSGMGLG  331



>ref|XP_002163283.2| PREDICTED: tuftelin-interacting protein 11-like [Hydra vulgaris]
Length=797

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -2

Query  875  ELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAE  696
            E+ I   +E      + K V +S N+GA+E +TTGFGSKM+ KMG+ G GLGK G+GI E
Sbjct  90   EMNIPVISEERKKGFKSKTVINSKNFGAWEKYTTGFGSKMLEKMGYKGKGLGKHGEGITE  149

Query  695  PIQVSQRPKALGLGADVPETSTANE  621
            PI+  +R     +GA   ET  + E
Sbjct  150  PIEAFKRGGRAAIGAYGSETKKSRE  174


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
             FG++E +T GFGSKM+ KMG+ +G GLGK  +GIT PI A +R     +GA
Sbjct  114  NFGAWEKYTTGFGSKMLEKMGY-KGKGLGKHGEGITEPIEAFKRGGRAAIGA  164



>ref|XP_011650047.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Cucumis sativus]
 gb|KGN63340.1| hypothetical protein Csa_2G431100 [Cucumis sativus]
Length=871

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 43/76 (57%), Gaps = 7/76 (9%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD-------V  645
            N GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +       +
Sbjct  199  NVGAFEKHTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKEAPKI  258

Query  644  PETSTANETKTPTPKS  597
            P      E   P P S
Sbjct  259  PALQEVEEKTLPQPTS  274


 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  512  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  248



>ref|XP_008462814.1| PREDICTED: tuftelin-interacting protein 11 [Cucumis melo]
Length=871

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD-------V  645
            N GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +       +
Sbjct  199  NVGAFEKHTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAPKI  258

Query  644  PETSTANETKTPTP  603
            P      E   P P
Sbjct  259  PALQEVEEKSLPQP  272


 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  512  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  248



>ref|XP_010094613.1| Tuftelin-interacting protein 11 [Morus notabilis]
 gb|EXB56432.1| Tuftelin-interacting protein 11 [Morus notabilis]
Length=940

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -2

Query  908  ISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFTGG  729
            I  G    EK + ++    +S      ++   S    G FE HT G G K++ KMG+ GG
Sbjct  257  IIEGAQKREKEKQRLKLENKSQSQGGGRRQSDSGAAVGGFEKHTKGIGMKLLEKMGYKGG  316

Query  728  GLGKDGQGIAEPIQVSQRPKALGLG  654
            GLGK+ QGI  PI+   RPK +G+G
Sbjct  317  GLGKNAQGIVAPIEAKLRPKNMGMG  341


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK++QGI API A  RPK+ G+G
Sbjct  294  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNAQGIVAPIEAKLRPKNMGMG  341



>ref|XP_010906679.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Elaeis guineensis]
Length=864

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G FENHTKG G K++  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  196  IGKFENHTKGIGMKLLKLMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  245


 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  827  KKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  654
            ++ V+ + + G FE HT G G K++  MG+  G GLGK+ QGI  PI+   RPK +G+G
Sbjct  187  RRDVTGTEDIGKFENHTKGIGMKLLKLMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  245



>emb|CBI26422.3| unnamed protein product [Vitis vinifera]
Length=739

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 12/104 (12%)
 Frame = -2

Query  917  VSFISSGI-MSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMG  741
            V+F+S+G+ M ++++EL      +  D+  + +  +   + G FE  T G G K+M KMG
Sbjct  75   VNFVSTGVVMPTQEIEL------DEHDNDDDGRREAELGDVGRFEKFTKGIGMKLMEKMG  128

Query  740  FTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  609
            +TGGGLGK+ QGI  PI+   RPK +G+G +        ETK P
Sbjct  129  YTGGGLGKNEQGIVAPIEAKLRPKNMGMGFN-----DYKETKLP  167


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE  TKG G K+M KMG+  G GLGK+ QGI API A  RPK+ G+G
Sbjct  110  GRFEKFTKGIGMKLMEKMGYT-GGGLGKNEQGIVAPIEAKLRPKNMGMG  157



>ref|XP_002501462.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62720.1| predicted protein [Micromonas sp. RCC299]
Length=1485

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = -2

Query  824   KCVSSSTNYGAFELHTTGFGSKMMVKMGFT--GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
             + V +  ++GAFE HT+GFGS+M+ KMGF   G G+GKDG+GI+EPI  S R K +GLGA
Sbjct  1423  RVVGAGHSFGAFEAHTSGFGSRMLAKMGFQGEGAGMGKDGRGISEPIAASIRGKRVGLGA  1482

Query  650   D  648
             +
Sbjct  1483  E  1483


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  506   FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             FG+FE HT GFGS+M+AKMGF  EG G+GKD +GI+ PI A+ R K  GLGA+
Sbjct  1431  FGAFEAHTSGFGSRMLAKMGFQGEGAGMGKDGRGISEPIAASIRGKRVGLGAE  1483



>ref|XP_004300043.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464964.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464965.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464966.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
Length=860

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTAN  624
            N G+FE HT  FG KM+ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      +   
Sbjct  191  NLGSFEQHTKAFGMKMLEKMGYKGGGLGKNQQGILAPIEAKLRPKNMGMG-----FNDYK  245

Query  623  ETKTPT  606
            ETK P+
Sbjct  246  ETKQPS  251


 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
              GSFE HTK FG KM+ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  NLGSFEQHTKAFGMKMLEKMGY-KGGGLGKNQQGILAPIEAKLRPKNMGMG  240



>ref|XP_010553814.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Tarenaya hassleriana]
Length=881

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 46/81 (57%), Gaps = 11/81 (14%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGL--------GADVP  642
            G FE  T GFG KM+ KMG+ GGGLGK+ QGI  PIQ   RPK +G+        GA +P
Sbjct  213  GQFEKFTKGFGMKMLEKMGYKGGGLGKNEQGIVAPIQAQLRPKKMGMGYNDFKETGAKLP  272

Query  641  ETSTANETKTPTPKSVGFGED  579
             T    E KT T   +G  E+
Sbjct  273  GTKQVEEKKTVT---IGISEN  290


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE  TKGFG KM+ KMG+ +G GLGK+ QGI API A  RPK  G+G
Sbjct  213  GQFEKFTKGFGMKMLEKMGY-KGGGLGKNEQGIVAPIQAQLRPKKMGMG  260



>ref|XP_003080850.1| Tuftelin-interacting protein TIP39, contains G-patch domain (ISS) 
[Ostreococcus tauri]
 emb|CAL55018.1| G-patch domain [Ostreococcus tauri]
Length=328

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            G G+FE HT+GFGS+++A+ GF  G+GLG+++QGI  P+ A  R K  GLGA
Sbjct  277  GMGAFEAHTRGFGSRILARFGFKPGSGLGRENQGIVEPLSAETRAKRAGLGA  328


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -2

Query  815  SSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            S+S   GAFE HT GFGS+++ + GF  G GLG++ QGI EP+    R K  GLGA
Sbjct  273  SASDGMGAFEAHTRGFGSRILARFGFKPGSGLGRENQGIVEPLSAETRAKRAGLGA  328



>gb|EHB00444.1| G patch domain-containing protein 2, partial [Heterocephalus 
glaber]
Length=527

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 5/59 (8%)
 Frame = -2

Query  770  FGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKS  597
             G++M+  MG+T G GLG+DG+GIAEPIQ  QRP+ LGLG  +P++++A    TPTP S
Sbjct  470  IGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPRGLGLGFPLPKSTSA----TPTPAS  524



>ref|XP_004880608.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004867444.1| PREDICTED: G patch domain-containing protein 2 [Heterocephalus 
glaber]
Length=528

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 5/59 (8%)
 Frame = -2

Query  770  FGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKS  597
             G++M+  MG+T G GLG+DG+GIAEPIQ  QRP+ LGLG  +P++++A    TPTP S
Sbjct  470  IGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPRGLGLGFPLPKSTSA----TPTPAS  524



>ref|XP_010065638.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Eucalyptus grandis]
 gb|KCW63225.1| hypothetical protein EUGRSUZ_G00845 [Eucalyptus grandis]
Length=859

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 8/83 (10%)
 Frame = -2

Query  827  KKCVSSSTNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG--  654
            K+    S N G FE +T G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  
Sbjct  176  KRDSYESGNVGGFEKYTKGIGMKLLEKMGYKGGGLGKNQQGIVAPVEAKLRPKNMGMGFN  235

Query  653  ------ADVPETSTANETKTPTP  603
                  A  P  S   E K P P
Sbjct  236  DYKETPAKAPVASLEPEEKKPLP  258


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE +TKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  186  GGFEKYTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPVEAKLRPKNMGMG  233



>ref|XP_005850261.1| hypothetical protein CHLNCDRAFT_50559 [Chlorella variabilis]
 gb|EFN58159.1| hypothetical protein CHLNCDRAFT_50559 [Chlorella variabilis]
Length=915

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G+K++AKMG+ EG GLG+D +GI+ P+ A  RPK  G+G
Sbjct  256  GKFEAHTKGIGAKLLAKMGWAEGEGLGRDRRGISKPLEAKLRPKGMGMG  304


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = -2

Query  869  KITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEP  693
            K +E+    +    K  V    + G FE HT G G+K++ KMG+  G GLG+D +GI++P
Sbjct  232  KQSEAAARVERSKVKAAVGPKADVGKFEAHTKGIGAKLLAKMGWAEGEGLGRDRRGISKP  291

Query  692  IQVSQRPKALGLG  654
            ++   RPK +G+G
Sbjct  292  LEAKLRPKGMGMG  304



>ref|XP_008804692.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
 ref|XP_008804693.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
 ref|XP_008804694.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
Length=868

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G FE+HTKG G K++  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  200  IGKFESHTKGIGLKLLKMMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  249


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -2

Query  827  KKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  654
            ++ V+ +   G FE HT G G K++  MG+  G GLGK+ QGI  PI+   RPK +G+G
Sbjct  191  RRDVTGTDEIGKFESHTKGIGLKLLKMMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  249



>gb|KII63443.1| Tuftelin-interacting protein 11 [Thelohanellus kitauei]
Length=714

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  800  YGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETS--T  630
            + ++E HTTGFGSKM+ KMGF  G GLGK G GI EPIQ   RP    LGA   E S   
Sbjct  72   FASWEKHTTGFGSKMLEKMGFKPGMGLGKHGSGIIEPIQAVSRPGRAALGAYGAEASENV  131

Query  629  ANETKTPTPKSV  594
             +ETK P+PK V
Sbjct  132  PSETK-PSPKPV  142


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            F S+E HT GFGSKM+ KMGF  G GLGK   GI  PI A  RP    LGA
Sbjct  72   FASWEKHTTGFGSKMLEKMGFKPGMGLGKHGSGIIEPIQAVSRPGRAALGA  122



>gb|EMP37184.1| Tuftelin-interacting protein 11 [Chelonia mydas]
Length=1157

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  506  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  556


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPET  636
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA   E 
Sbjct  502  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGAYGSER  561

Query  635  STANETKTPTPKS  597
            ++ +    P   S
Sbjct  562  TSQSLQDFPVVDS  574



>gb|KJB73095.1| hypothetical protein B456_011G214400, partial [Gossypium raimondii]
Length=616

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVP  642
            + G+FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P
Sbjct  73   DVGSFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAKLP  132

Query  641  ETSTANETKTPTPKSVG  591
                  E K+ + + VG
Sbjct  133  GLQQLEERKSVSQQPVG  149


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  75   GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  122



>ref|XP_012070277.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Jatropha curcas]
 gb|KDP39564.1| hypothetical protein JCGZ_02584 [Jatropha curcas]
Length=870

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -2

Query  809  STNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST  630
            S + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      + 
Sbjct  195  SGDVGEFEKHTKGIGFKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMG-----FND  249

Query  629  ANETKTPTPKSV  594
              E K P P+ +
Sbjct  250  FKEAKLPQPEEI  261


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  199  GEFEKHTKGIGFKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  246



>gb|KHG03685.1| Tuftelin-interacting 11 [Gossypium arboreum]
 gb|KHG18046.1| Tuftelin-interacting 11 [Gossypium arboreum]
Length=853

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVP  642
            + G+FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P
Sbjct  189  DVGSFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAKLP  248

Query  641  ETSTANETKTPTPKSVG  591
                  E K+ + + VG
Sbjct  249  GLQQLEEKKSVSQQPVG  265


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  238



>gb|ELK08915.1| G patch domain-containing protein 2 [Pteropus alecto]
Length=100

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = -2

Query  770  FGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
             G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P+++ A  T
Sbjct  42   IGNRMLQNMGWTPGSGLGRDGKGIAEPVQAMQRPKGLGLGYPLPKSTPAATT  93



>gb|KJB44347.1| hypothetical protein B456_007G247300 [Gossypium raimondii]
Length=853

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVP  642
            + G+FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P
Sbjct  189  DVGSFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAKLP  248

Query  641  ETSTANETKTPTPKSVG  591
                  E K+ + + VG
Sbjct  249  GLQQLEEKKSVSQQPVG  265


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  238



>ref|NP_001090845.1| tuftelin-interacting protein 11 [Xenopus (Silurana) tropicalis]
 gb|AAI21498.1| LOC100038256 protein [Xenopus (Silurana) tropicalis]
Length=825

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V+G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  818  VSSSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQR  675
            + S+T++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  132  IKSNTDFGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQR  180



>sp|Q0IIX9.2|TFP11_XENTR RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Xenopus 
(Silurana) tropicalis]
 gb|ABC69924.1| STIP [Xenopus (Silurana) tropicalis]
Length=825

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V+G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  818  VSSSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQR  675
            + S+T++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  132  IKSNTDFGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQR  180



>ref|XP_010459271.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Camelina sativa]
Length=851

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -2

Query  809  STNYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGA-DVPETS  633
            S + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+V  RPK +G+G  D  E  
Sbjct  190  SNDIGQFEKSTKGIGMKLLEKMGYQGGGLGKNQQGIVAPIEVQLRPKNMGMGYNDFKEAK  249

Query  632  TANETKTPTPKSVG  591
              +  K    K VG
Sbjct  250  LPDLNKVEEKKIVG  263


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G FE  TKG G K++ KMG+ +G GLGK+ QGI API    RPK+ G+G
Sbjct  193  IGQFEKSTKGIGMKLLEKMGY-QGGGLGKNQQGIVAPIEVQLRPKNMGMG  241



>ref|XP_005649692.1| TFP11-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25148.1| TFP11-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=862

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            P  G FE HTKG G+K++A MG+ EG GLG++ QGI+ PI    RPK  G+G
Sbjct  195  PSVGEFERHTKGIGAKLLAGMGYKEGEGLGRNRQGISKPIEVKLRPKGMGMG  246


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 8/67 (12%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGF-TGGGLGKDGQGIAEPIQVSQRPKALGLGAD-------VP  642
            G FE HT G G+K++  MG+  G GLG++ QGI++PI+V  RPK +G+G +       +P
Sbjct  198  GEFERHTKGIGAKLLAGMGYKEGEGLGRNRQGISKPIEVKLRPKGMGMGYNDYEEHKLIP  257

Query  641  ETSTANE  621
            +   A E
Sbjct  258  DEKPAEE  264



>ref|XP_011399724.1| hypothetical protein F751_0708 [Auxenochlorella protothecoides]
 gb|KFM26776.1| hypothetical protein F751_0708 [Auxenochlorella protothecoides]
Length=955

 Score = 63.5 bits (153),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 2/62 (3%)
 Frame = -2

Query  830  EKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT--GGGLGKDGQGIAEPIQVSQRPKALGL  657
            +K+ V+ +  YG FE HTTG GSK++ K GF   G GLGKDG G+ EP+ VSQR +  GL
Sbjct  894  DKQKVAKNMGYGQFERHTTGIGSKLLSKWGFAGEGAGLGKDGVGLTEPLLVSQRARQRGL  953

Query  656  GA  651
            GA
Sbjct  954  GA  955


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  354
            G+G FE HT G GSK+++K GF  EG GLGKD  G+T P+L ++R + +GLGA
Sbjct  903  GYGQFERHTTGIGSKLLSKWGFAGEGAGLGKDGVGLTEPLLVSQRARQRGLGA  955



>ref|XP_011098023.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Sesamum indicum]
Length=859

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  654
            GAFE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  190  GAFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPIEAKMRPKNMGMG  237


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  188  GVGAFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPIEAKMRPKNMGMG  237



>ref|XP_001702893.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96850.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=786

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK  GLG
Sbjct  99   PTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  150


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  821  CVSSSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  654
             +S+   +  FE HT G G K++ KMG+  G GLG++ QGIA P++   RPK +GLG
Sbjct  94   TLSTDPTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  150



>emb|CDP06007.1| unnamed protein product [Coffea canephora]
Length=847

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  633
            + G+FE HT G G +++ KMG+ GGGLGK+ QGI  PIQ   RPK +G+G  D  ET+
Sbjct  187  DVGSFEKHTKGIGLRLLEKMGYKGGGLGKNEQGIVSPIQAKLRPKNMGMGFNDYKETN  244


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  512  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            PG  GSFE HTKG G +++ KMG+ +G GLGK+ QGI +PI A  RPK+ G+G
Sbjct  185  PGDVGSFEKHTKGIGLRLLEKMGY-KGGGLGKNEQGIVSPIQAKLRPKNMGMG  236



>ref|XP_009397719.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=850

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K+M  MG+ EG+GLGK  QGI AP+ A  RPK+ G+G
Sbjct  185  GKFEVHTKGIGLKLMKMMGYKEGSGLGKSEQGIVAPVEAKLRPKNMGMG  233


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 2/75 (3%)
 Frame = -2

Query  815  SSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG-ADVP  642
            SS+ + G FE+HT G G K+M  MG+  G GLGK  QGI  P++   RPK +G+G  D  
Sbjct  179  SSADDVGKFEVHTKGIGLKLMKMMGYKEGSGLGKSEQGIVAPVEAKLRPKNMGMGFNDYK  238

Query  641  ETSTANETKTPTPKS  597
            E       + P  K+
Sbjct  239  EAKLPAVDEAPREKA  253



>ref|XP_010256250.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Nelumbo nucifera]
Length=849

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 6/69 (9%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVP  642
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P
Sbjct  188  DVGQFEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVTPIEAKLRPKNMGMGFNDYKEASLP  247

Query  641  ETSTANETK  615
                A E K
Sbjct  248  AVEEAEEKK  256


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI  PI A  RPK+ G+G
Sbjct  190  GQFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVTPIEAKLRPKNMGMG  237



>ref|XP_008339239.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11-like [Malus domestica]
Length=875

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTANE  621
            GAFE HT G G KM+  MG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ET    E
Sbjct  203  GAFEKHTKGIGMKMLKNMGYKGGGLGKNEQGILAPIEAKLRPKNMGMGFNDYKET----E  258

Query  620  TKTPT  606
             K P+
Sbjct  259  VKRPS  263


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G G+FE HTKG G KM+  MG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  201  GLGAFEKHTKGIGMKMLKNMGY-KGGGLGKNEQGILAPIEAKLRPKNMGMG  250



>ref|XP_001773432.1| predicted protein [Physcomitrella patens]
 gb|EDQ61805.1| predicted protein [Physcomitrella patens]
Length=834

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -2

Query  794  AFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETST  630
            +FE+ T G GSK++ KMG+ GGGLGK+ QGIA+PI+   RPK +G+G  +  ETST
Sbjct  179  SFEMFTRGIGSKLLEKMGYKGGGLGKNEQGIAQPIEAKLRPKNMGMGFNEFRETST  234


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  500  SFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            SFE  T+G GSK++ KMG+ +G GLGK+ QGI  PI A  RPK+ G+G
Sbjct  179  SFEMFTRGIGSKLLEKMGY-KGGGLGKNEQGIAQPIEAKLRPKNMGMG  225



>ref|XP_002506795.1| hypothetical protein MICPUN_113307 [Micromonas sp. RCC299]
 gb|ACO68053.1| hypothetical protein MICPUN_113307 [Micromonas sp. RCC299]
Length=788

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            P  G FE HTKG G K++ KMG+ +G GLGKD +G+ AP+    RPK+ G+G K
Sbjct  48   PKLGEFEKHTKGIGMKLLEKMGYKKGMGLGKDGKGMAAPMETQMRPKNMGMGFK  101


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLG  654
            G FE HT G G K++ KMG+  G GLGKDG+G+A P++   RPK +G+G
Sbjct  51   GEFEKHTKGIGMKLLEKMGYKKGMGLGKDGKGMAAPMETQMRPKNMGMG  99



>gb|ABC69949.1| STIP [Chlamydomonas reinhardtii]
Length=844

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK  GLG
Sbjct  182  PTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  233


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = -2

Query  884  EKVELKIT-ESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDG  711
            EK + ++  E     +       +S+   +  FE HT G G K++ KMG+  G GLG++ 
Sbjct  155  EKAQQRLQKEQAAVRNEVKRTATLSTDPTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNK  214

Query  710  QGIAEPIQVSQRPKALGLG  654
            QGIA P++   RPK +GLG
Sbjct  215  QGIARPVEARMRPKGMGLG  233



>ref|XP_010670678.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670679.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670680.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670681.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
Length=858

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  654
            N G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  197  NVGGFERHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMG  246


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  199  GGFERHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  246



>gb|KIZ04951.1| Tuftelin-interacting protein 11, partial [Monoraphidium neglectum]
Length=759

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            P F SFE  TKG GSK+++KMG+  G GLG++ QGI  PI A  RPK  G+G
Sbjct  272  PKFASFETFTKGIGSKLLSKMGYRPGEGLGREKQGIAKPIEAKLRPKGMGMG  323


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  654
            S   + +FE  T G GSK++ KMG+  G GLG++ QGIA+PI+   RPK +G+G
Sbjct  270  SDPKFASFETFTKGIGSKLLSKMGYRPGEGLGREKQGIAKPIEAKLRPKGMGMG  323



>ref|XP_004751526.1| PREDICTED: G patch domain-containing protein 2 [Mustela putorius 
furo]
 ref|XP_004788303.1| PREDICTED: G patch domain-containing protein 2 [Mustela putorius 
furo]
Length=528

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 5/61 (8%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A     PTP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTPA----APTPN  523

Query  599  S  597
            +
Sbjct  524  A  524



>ref|XP_010597714.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Loxodonta 
africana]
Length=528

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++STA  T
Sbjct  468  NNIGNRMLQSMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSSTAAAT  521



>ref|XP_006890634.1| PREDICTED: G patch domain-containing protein 2-like [Elephantulus 
edwardii]
Length=527

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++TA
Sbjct  467  NNIGNRMLQSMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTTA  517



>ref|XP_002325453.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
 gb|EEE99834.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
Length=690

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 11/77 (14%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG--------AD  648
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G        A 
Sbjct  18   DVGEFERHTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAKMRPKNMGMGFNDFKEASAK  77

Query  647  VP---ETSTANETKTPT  606
            +P   ET T ++ ++ T
Sbjct  78   LPQLQETETVSQRQSQT  94


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  20   GEFERHTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAKMRPKNMGMG  67



>ref|XP_008608077.1| hypothetical protein SDRG_04193 [Saprolegnia diclina VS20]
 gb|EQC38485.1| hypothetical protein SDRG_04193 [Saprolegnia diclina VS20]
Length=899

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            G +E HT GFG KM+ KMGF G  LGKD QGIA PI V  RP  LGLGA
Sbjct  212  GKWEKHTKGFGMKMLAKMGFKGR-LGKDEQGIAVPIAVKARPNQLGLGA  259


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
             G +E HTKGFG KM+AKMGF     LGKD QGI  PI    RP   GLGA
Sbjct  211  MGKWEKHTKGFGMKMLAKMGF--KGRLGKDEQGIAVPIAVKARPNQLGLGA  259



>ref|XP_009399051.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=853

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G F+++TKG G K+M  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  187  IGKFQSYTKGIGFKLMKMMGYKEGSGLGKNEQGIVAPIEAKLRPKNMGMG  236


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -2

Query  827  KKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  654
            K+ VS +   G F+ +T G G K+M  MG+  G GLGK+ QGI  PI+   RPK +G+G
Sbjct  178  KRDVSGADEIGKFQSYTKGIGFKLMKMMGYKEGSGLGKNEQGIVAPIEAKLRPKNMGMG  236



>ref|XP_009861899.1| PREDICTED: sip1/TFIP11 interacting protein isoform X1 [Ciona 
intestinalis]
 ref|XP_009861900.1| PREDICTED: sip1/TFIP11 interacting protein isoform X1 [Ciona 
intestinalis]
Length=826

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            F SFE HT+G G K++ KMG+  G GLGK +QGI  PI A +R K  GLGA
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = -2

Query  809  STNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  651
             + + +FE HT G G K++ KMG+  G GLGK  QGI  PI+  +R K  GLGA
Sbjct  141  DSQFASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194



>ref|NP_001091088.1| Sip1/TFIP11 interacting protein [Ciona intestinalis]
 gb|ABC69930.1| STIP [Ciona intestinalis]
Length=832

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            F SFE HT+G G K++ KMG+  G GLGK +QGI  PI A +R K  GLGA
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = -2

Query  809  STNYGAFELHTTGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  651
             + + +FE HT G G K++ KMG+  G GLGK  QGI  PI+  +R K  GLGA
Sbjct  141  DSQFASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194



>emb|CBK20550.2| unnamed protein product [Blastocystis hominis]
Length=91

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = -2

Query  782  HTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD-VPETSTANETK  615
            +TTGFG ++M KMGF G  LGKDGQGI+ PI   +RP+ LGLGA+   E ST    K
Sbjct  21   YTTGFGVELMRKMGFEGR-LGKDGQGISNPIATKKRPEGLGLGANGFKEASTLKANK  76



>ref|XP_002524028.1| tuftelin interacting protein, putative [Ricinus communis]
 gb|EEF38396.1| tuftelin interacting protein, putative [Ricinus communis]
Length=883

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  633
            G FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ETS
Sbjct  209  GEFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPIEAKLRPKNMGMGFNDYKETS  264


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  209  GEFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPIEAKLRPKNMGMG  256



>gb|EHH50537.1| hypothetical protein EGM_01387 [Macaca fascicularis]
Length=529

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  469  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  524



>gb|EHH15544.1| hypothetical protein EGK_01651 [Macaca mulatta]
Length=529

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  469  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  524



>ref|XP_006848800.1| PREDICTED: uncharacterized protein LOC18438554 [Amborella trichopoda]
 ref|XP_011625068.1| PREDICTED: uncharacterized protein LOC18438554 [Amborella trichopoda]
 gb|ERN10381.1| hypothetical protein AMTR_s00026p00123370 [Amborella trichopoda]
Length=752

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             G+FE HT GFGS+MMAKMGFVEG GLGKD QGIT P+ A +RPKS GLG K
Sbjct  695  MGTFEMHTTGFGSRMMAKMGFVEGGGLGKDGQGITEPLAAIQRPKSLGLGVK  746


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = -2

Query  917  VSFISSGIMSSEKVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGF  738
            V+F+SSGIM  +    K+    ++  +  +K+   SS   G FE+HTTGFGS+MM KMGF
Sbjct  657  VAFVSSGIMQVDFTGEKVRNLNKTKTTTEKKESTGSS-KMGTFEMHTTGFGSRMMAKMGF  715

Query  737  T-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
              GGGLGKDGQGI EP+   QRPK+LGLG 
Sbjct  716  VEGGGLGKDGQGITEPLAAIQRPKSLGLGV  745



>ref|XP_005540923.1| PREDICTED: G patch domain-containing protein 2 isoform X3 [Macaca 
fascicularis]
Length=504

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  444  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  499



>ref|XP_009117727.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Brassica rapa]
Length=837

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 9/80 (11%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVP  642
            + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P
Sbjct  184  DIGKFEKATKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAKLP  243

Query  641  ETSTANETKTPTPKSVGFGE  582
            +     E KT T   VG+ +
Sbjct  244  DLKKVEEKKTVT---VGWND  260


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  185  IGKFEKATKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  233



>ref|XP_006761403.1| PREDICTED: G patch domain-containing protein 2 [Myotis davidii]
Length=528

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+++ A  + TP P 
Sbjct  465  NNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAMQRPKGLGLGFPLPKSTPAAPS-TPIPA  523

Query  599  S  597
            S
Sbjct  524  S  524



>gb|ELK32169.1| G patch domain-containing protein 2 [Myotis davidii]
Length=505

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+++ A  + TP P 
Sbjct  442  NNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAMQRPKGLGLGFPLPKSTPAAPS-TPIPA  500

Query  599  S  597
            S
Sbjct  501  S  501



>gb|EPQ16193.1| G patch domain-containing protein 2 [Myotis brandtii]
Length=523

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+ ST     TP P 
Sbjct  460  NNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAMQRPKGLGLGFPLPK-STPTAPSTPIPA  518

Query  599  S  597
            S
Sbjct  519  S  519



>ref|XP_004415667.1| PREDICTED: G patch domain-containing protein 2 [Odobenus rosmarus 
divergens]
Length=528

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 5/61 (8%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A    T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTPA----TATPN  523

Query  599  S  597
            S
Sbjct  524  S  524



>ref|XP_005879952.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Myotis 
brandtii]
Length=529

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+ ST     TP P 
Sbjct  466  NNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAMQRPKGLGLGFPLPK-STPTAPSTPIPA  524

Query  599  S  597
            S
Sbjct  525  S  525



>ref|XP_007986612.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Chlorocebus 
sabaeus]
Length=534

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  474  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  529



>gb|ETE71201.1| Tuftelin-interacting protein 11, partial [Ophiophagus hannah]
Length=537

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  23   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKAAIGA  73


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  19   SFADFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKAAIGA  73



>ref|XP_007986613.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Chlorocebus 
sabaeus]
Length=528

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  523



>ref|XP_003893154.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Papio 
anubis]
Length=528

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  523



>ref|XP_001781004.1| predicted protein [Physcomitrella patens]
 gb|EDQ54188.1| predicted protein [Physcomitrella patens]
Length=835

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  791  FELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  654
            FE+ T G GSK++ KMG+ GGGLGK+ QGIA+PI+   RPK +G+G
Sbjct  180  FEMFTRGIGSKLLEKMGYKGGGLGKNEQGIAQPIEAKLRPKNMGMG  225


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  500  SFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            +FE  T+G GSK++ KMG+ +G GLGK+ QGI  PI A  RPK+ G+G
Sbjct  179  TFEMFTRGIGSKLLEKMGY-KGGGLGKNEQGIAQPIEAKLRPKNMGMG  225



>ref|XP_010361517.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Rhinopithecus 
roxellana]
Length=528

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  523



>ref|XP_005540922.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Macaca 
fascicularis]
 ref|XP_011842766.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Mandrillus 
leucophaeus]
 ref|XP_011759486.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Macaca 
nemestrina]
Length=528

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  523



>ref|XP_005540921.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Macaca 
fascicularis]
 ref|XP_011759485.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Macaca 
nemestrina]
Length=534

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  474  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  529



>ref|XP_010662048.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Vitis vinifera]
Length=863

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 50/98 (51%), Gaps = 15/98 (15%)
 Frame = -2

Query  869  KITESTESSDSCHEK-KCVSSST---------NYGAFELHTTGFGSKMMVKMGFTGGGLG  720
            KI E  +  +   EK K V  S          + G FE  T G G K+M KMG+TGGGLG
Sbjct  158  KIKEGAQRREREREKSKLVKKSQGGRREAELGDVGRFEKFTKGIGMKLMEKMGYTGGGLG  217

Query  719  KDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
            K+ QGI  PI+   RPK +G+G +        ETK P 
Sbjct  218  KNEQGIVAPIEAKLRPKNMGMGFN-----DYKETKLPA  250


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE  TKG G K+M KMG+  G GLGK+ QGI API A  RPK+ G+G
Sbjct  192  GRFEKFTKGIGMKLMEKMGYT-GGGLGKNEQGIVAPIEAKLRPKNMGMG  239



>ref|XP_008683891.1| PREDICTED: G patch domain-containing protein 2 isoform X3 [Ursus 
maritimus]
Length=504

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A  T
Sbjct  444  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTPATAT  497



>ref|XP_004685296.1| PREDICTED: G patch domain-containing protein 2 [Condylura cristata]
Length=527

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P++S A
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQALQRPKGLGLGFPLPKSSPA  518



>ref|XP_011232417.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Ailuropoda 
melanoleuca]
Length=504

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A  T
Sbjct  444  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTPATAT  497



>ref|XP_005540924.1| PREDICTED: G patch domain-containing protein 2 isoform X4 [Macaca 
fascicularis]
Length=497

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  437  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TNTPN  492



>ref|XP_007443812.1| PREDICTED: tuftelin-interacting protein 11 [Python bivittatus]
Length=741

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  49   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKAAIGA  99


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            S T++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA
Sbjct  45   SFTDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKAAIGA  99



>emb|CDY21767.1| BnaA09g45180D [Brassica napus]
Length=809

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 9/78 (12%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPET  636
            G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P+ 
Sbjct  158  GKFEKATKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAKLPDL  217

Query  635  STANETKTPTPKSVGFGE  582
                E KT T   VG+ +
Sbjct  218  KKVEEKKTVT---VGWND  232


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  158  GKFEKATKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  205



>ref|XP_007029764.1| GC-rich sequence DNA-binding factor-like protein with Tuftelin 
interacting domain [Theobroma cacao]
 gb|EOY10266.1| GC-rich sequence DNA-binding factor-like protein with Tuftelin 
interacting domain [Theobroma cacao]
Length=859

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = -2

Query  791  FELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPETST  630
            FE HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P    
Sbjct  193  FEKHTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKEAKLPGLQQ  252

Query  629  ANETKTPTPKSVG  591
             +E K+   + VG
Sbjct  253  LDEKKSVNQQPVG  265


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  497  FENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  193  FEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  238



>ref|XP_002926699.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Ailuropoda 
melanoleuca]
Length=528

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A  T
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTPATAT  521



>ref|XP_006203714.1| PREDICTED: G patch domain-containing protein 2 [Vicugna pacos]
Length=529

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
            T  G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+++ A
Sbjct  469  TNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAVQRPKGLGLGFPLPKSTPA  519



>ref|XP_006188221.1| PREDICTED: G patch domain-containing protein 2 [Camelus ferus]
Length=529

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
            T  G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+++ A
Sbjct  469  TNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAVQRPKGLGLGFPLPKSTPA  519



>ref|XP_008683889.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Ursus 
maritimus]
Length=528

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A  T
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSTPATAT  521



>ref|XP_007058458.1| PREDICTED: tuftelin-interacting protein 11 [Chelonia mydas]
Length=776

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA
Sbjct  134  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188



>ref|XP_005298544.1| PREDICTED: tuftelin-interacting protein 11 [Chrysemys picta bellii]
Length=827

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA
Sbjct  134  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188



>ref|XP_010972318.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Camelus 
bactrianus]
 ref|XP_010991366.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Camelus 
dromedarius]
Length=527

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
            T  G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+++ A
Sbjct  467  TNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAVQRPKGLGLGFPLPKSTPA  517



>ref|XP_008148048.1| PREDICTED: G patch domain-containing protein 2 [Eptesicus fuscus]
Length=530

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPK  600
               G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P ++ A  + TP P 
Sbjct  467  NNIGNRMLQNMGWTPGSGLGRDGKGLAEPIQAMQRPKGLGLGFPLPNSTPAAPS-TPIPA  525

Query  599  S  597
            S
Sbjct  526  S  526



>ref|XP_006137534.1| PREDICTED: tuftelin-interacting protein 11 [Pelodiscus sinensis]
Length=872

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  183  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  233


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     LGA
Sbjct  179  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  233



>ref|XP_002089187.1| Sip1-TFIP11 interacting protein [Drosophila yakuba]
 gb|ABC69937.1| STIP [Drosophila yakuba]
 gb|EDW88899.1| Sip1-TFIP11 interacting protein [Drosophila yakuba]
Length=839

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 3/92 (3%)
 Frame = -2

Query  848  SSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRP  672
            +S +   +  ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R 
Sbjct  144  ASTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRK  203

Query  671  KALGLGADVPETSTANETKTPTPKSVGFGEDL  576
                +GA  PET+ +   K  T KS+   ED+
Sbjct  204  GRGAIGAYGPETAASIGGK--TNKSIKVDEDV  233


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
              G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  159  NVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGA  210



>gb|KDO27238.1| hypothetical protein SPRG_07487 [Saprolegnia parasitica CBS 223.65]
Length=897

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            G +E HT GFG KM+ KMGF G  LGKD QGIA P+ V  RP  LGLGA
Sbjct  214  GKWEKHTKGFGMKMLAKMGFKGR-LGKDEQGIAVPVAVKARPNQLGLGA  261


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
             G +E HTKGFG KM+AKMGF +G  LGKD QGI  P+    RP   GLGA
Sbjct  213  MGKWEKHTKGFGMKMLAKMGF-KGR-LGKDEQGIAVPVAVKARPNQLGLGA  261



>ref|XP_011507993.1| PREDICTED: G patch domain-containing protein 2 isoform X3 [Homo 
sapiens]
Length=490

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  430  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TTTPN  485



>ref|XP_002078265.1| GD23359 [Drosophila simulans]
 gb|EDX03850.1| GD23359 [Drosophila simulans]
Length=751

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = -2

Query  851  ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            + S +   +  ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R
Sbjct  143  QPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVR  202

Query  674  PKALGLGADVPETSTANETKTPTPKSVGFGEDL  576
                 +GA  PET+ +   K  T KS+   ED+
Sbjct  203  KGRGAIGAYGPETAASIGGK--TNKSIKVDEDV  233


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
              G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  159  NVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGA  210



>ref|XP_008965018.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Pan 
paniscus]
Length=512

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  452  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TATPN  507



>ref|XP_002955122.1| hypothetical protein VOLCADRAFT_65509 [Volvox carteri f. nagariensis]
 gb|EFJ43876.1| hypothetical protein VOLCADRAFT_65509 [Volvox carteri f. nagariensis]
Length=786

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  512  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK   LG
Sbjct  119  PTFANFEKHTKGIGLKLLEKMGYKPGEGLGRNKQGIAKPVEARMRPKGMALG  170


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  821  CVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLG  654
             V++   +  FE HT G G K++ KMG+  G GLG++ QGIA+P++   RPK + LG
Sbjct  114  VVTADPTFANFEKHTKGIGLKLLEKMGYKPGEGLGRNKQGIAKPVEARMRPKGMALG  170



>ref|XP_010498050.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Camelina sativa]
Length=853

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGA-DVPETSTA  627
            + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+V  RPK +G+G  D  E    
Sbjct  194  DIGQFEKSTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEVQLRPKNMGMGYNDFKEAKLP  253

Query  626  NETKTPTPKSVG  591
            +  K    K VG
Sbjct  254  DLKKVEEKKIVG  265


 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G FE  TKG G K++ KMG+ +G GLGK+ QGI API    RPK+ G+G
Sbjct  195  IGQFEKSTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEVQLRPKNMGMG  243



>ref|XP_009616302.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009616309.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009616317.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009616324.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X2 [Nicotiana tomentosiformis]
Length=860

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  633
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS
Sbjct  190  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETS  247


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  192  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  239



>ref|XP_001172096.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Pan 
troglodytes]
 ref|XP_003814186.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Pan 
paniscus]
Length=528

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TATPN  523



>ref|XP_009616253.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616260.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616266.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616273.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616280.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616288.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009616296.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  633
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS
Sbjct  205  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETS  262


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  207  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  254



>ref|XP_009801630.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Nicotiana sylvestris]
 ref|XP_009801631.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Nicotiana sylvestris]
 ref|XP_009801632.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Nicotiana sylvestris]
Length=860

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETST  630
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS 
Sbjct  190  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETSA  248


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  192  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  239



>ref|XP_002037985.1| Sip1-TFIP11 interacting protein [Drosophila sechellia]
 gb|ABC69936.1| STIP [Drosophila sechellia]
 gb|EDW54403.1| Sip1-TFIP11 interacting protein [Drosophila sechellia]
Length=839

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = -2

Query  851  ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            + S +   +  ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R
Sbjct  143  QPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVR  202

Query  674  PKALGLGADVPETSTANETKTPTPKSVGFGEDL  576
                 +GA  PET+ +   K  T KS+   ED+
Sbjct  203  KGRGAIGAYGPETAASIGGK--TNKSIKVDEDV  233


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
              G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  159  NVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGA  210



>ref|XP_009603610.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Nicotiana tomentosiformis]
Length=860

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETST  630
            + G FE HT G G K++ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  ETS 
Sbjct  190  DVGGFEKHTKGIGMKLLEKMGYKGGGLGKNEQGILAPVEAKLRPKNMGMGFNDYKETSA  248


 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G K++ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G
Sbjct  192  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPVEAKLRPKNMGMG  239



>ref|XP_005959627.1| PREDICTED: tuftelin-interacting protein 11-like isoform X1 [Pantholops 
hodgsonii]
 ref|XP_005959628.1| PREDICTED: tuftelin-interacting protein 11-like isoform X2 [Pantholops 
hodgsonii]
Length=279

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  636
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR     +GA   E 
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAYGSER  197

Query  635  ST  630
            +T
Sbjct  198  TT  199



>ref|XP_009439775.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Pan 
troglodytes]
Length=491

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  431  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TATPN  486



>ref|NP_060510.1| G patch domain-containing protein 2 isoform 1 [Homo sapiens]
 sp|Q9NW75.1|GPTC2_HUMAN RecName: Full=G patch domain-containing protein 2 [Homo sapiens]
 dbj|BAA91509.1| unnamed protein product [Homo sapiens]
 gb|EAW93333.1| G patch domain containing 2 [Homo sapiens]
Length=528

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TTTPN  523



>ref|XP_011507991.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Homo 
sapiens]
Length=551

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  491  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TTTPN  546



>gb|ELW55478.1| G patch domain-containing protein 2 [Tupaia chinensis]
Length=92

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = -2

Query  881  KVELKITESTESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQG  705
            K+ +K+ E +E          ++      A  +     G++M+  MG+T G GLG+DG+G
Sbjct  6    KILIKVLELSER---------INGFVGENAQPILENNIGNRMLQNMGWTPGSGLGRDGKG  56

Query  704  IAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
            I+EPIQ  QRPK LGLG  +P+   A  T TP+
Sbjct  57   ISEPIQAMQRPKGLGLGFPLPK--NAPTTATPS  87



>ref|XP_003265143.1| PREDICTED: G patch domain-containing protein 2 [Nomascus leucogenys]
Length=528

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TTTPN  523



>ref|XP_006943032.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Felis 
catus]
Length=528

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
            +  G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+ + A  T
Sbjct  468  SNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKNTPAPAT  521



>gb|ABC69931.1| STIP [Ciona savignyi]
Length=820

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            F SFE HTKG G K++ KMG+  G GLGK +QGI  P+ A +R K  GLG+
Sbjct  141  FASFERHTKGIGMKLLTKMGYRHGRGLGKGNQGIINPVEAIKRNKKAGLGS  191



>ref|XP_001968838.1| GG25092 [Drosophila erecta]
 gb|EDV57897.1| GG25092 [Drosophila erecta]
Length=839

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -2

Query  818  VSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVP  642
            ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI++P+Q   R     +GA  P
Sbjct  154  IASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGAYGP  213

Query  641  ETSTANETKTPTPKSVGFGEDL  576
            ET+ +   K  T KS+   ED+
Sbjct  214  ETAASIGGK--TNKSIKVDEDV  233


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
              G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  159  NVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISQPVQAHVRKGRGAIGA  210



>ref|XP_006836389.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Amborella trichopoda]
 gb|ERM99242.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda]
Length=877

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD  648
            + G FE HT G G +++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +
Sbjct  197  DVGEFEKHTKGIGMRLLEKMGYKGGGLGKNAQGIVAPIEAKLRPKNMGMGYN  248


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE HTKG G +++ KMG+ +G GLGK++QGI API A  RPK+ G+G
Sbjct  199  GEFEKHTKGIGMRLLEKMGY-KGGGLGKNAQGIVAPIEAKLRPKNMGMG  246



>ref|XP_006015340.1| PREDICTED: tuftelin-interacting protein 11 [Alligator sinensis]
Length=853

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI +PI A +R     +GA
Sbjct  164  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGA  214



>ref|XP_006261823.1| PREDICTED: tuftelin-interacting protein 11 [Alligator mississippiensis]
Length=828

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI +PI A +R     +GA
Sbjct  139  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGA  189



>ref|XP_011507992.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Homo 
sapiens]
Length=514

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P++++A  T TP 
Sbjct  454  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSA--TTTPN  509



>ref|XP_011237225.1| PREDICTED: G patch domain-containing protein 2 isoform X7 [Mus 
musculus]
 gb|EDL13046.1| G patch domain containing 2, isoform CRA_b [Mus musculus]
Length=276

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT  612
            +  G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P++S  +   T
Sbjct  216  SNIGNRMLQSMGWTPGSGLGRDGRGIAEPVQAVQRPKGLGLGFPLPKSSPTSPAPT  271



>gb|KFK43898.1| hypothetical protein AALP_AA1G188300 [Arabis alpina]
Length=846

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVP  642
            + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P
Sbjct  183  DIGKFEKSTKGIGMKLLEKMGYKGGGLGKNQQGIVAPIEAQLRPKNMGMGYNDFKEAKLP  242

Query  641  ETSTANETKT  612
            +     E KT
Sbjct  243  DLKKVEEKKT  252


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
             G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  184  IGKFEKSTKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGMG  232



>ref|XP_010528677.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Tarenaya hassleriana]
Length=880

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  797  GAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETST  630
            G FE  T GFG KM+ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  E+S 
Sbjct  212  GQFEKFTKGFGMKMLEKMGYKGGGLGKNEQGIVAPVEAQLRPKNMGMGYKDFKESSA  268


 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
            G FE  TKGFG KM+ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G K
Sbjct  212  GQFEKFTKGFGMKMLEKMGY-KGGGLGKNEQGIVAPVEAQLRPKNMGMGYK  261



>dbj|BAC38928.1| unnamed protein product [Mus musculus]
Length=283

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT  612
            +  G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P++S  +   T
Sbjct  223  SNIGNRMLQSMGWTPGSGLGRDGRGIAEPVQAVQRPKGLGLGFPLPKSSPTSPAPT  278



>ref|XP_003930395.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=528

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P+++ A  T TP+
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTPA--TSTPS  523



>ref|NP_001087642.1| tuftelin-interacting protein 11 [Xenopus laevis]
 sp|Q66J74.1|TFP11_XENLA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Xenopus 
laevis]
 gb|AAH81033.1| MGC81713 protein [Xenopus laevis]
 gb|ABC69925.1| STIP [Xenopus laevis]
Length=824

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRR  378
            FGS+E HTKG G K++ KMG++ G GLGK++QGI API A +R
Sbjct  138  FGSWERHTKGIGQKLLQKMGYMPGRGLGKNAQGIIAPIEAKQR  180


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  818  VSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            + S+T++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  132  IKSNTDFGSWERHTKGIGQKLLQKMGYMPGRGLGKNAQGIIAPIEAKQR  180



>ref|XP_006916287.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Pteropus 
alecto]
Length=533

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  618
               G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P+++ A  T
Sbjct  473  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPVQAMQRPKGLGLGYPLPKSTPAATT  526



>ref|XP_001419174.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97467.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=244

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -2

Query  800  YGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  648
            + AFE HT G GS+++  MGFT G GLG+D QGIAE  +   R K  GLGA+
Sbjct  193  FAAFEAHTRGIGSRLLTAMGFTRGSGLGRDNQGIAEAPRAESRAKRAGLGAE  244


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  351
             F +FE HT+G GS+++  MGF  G+GLG+D+QGI     A  R K  GLGA+
Sbjct  192  AFAAFEAHTRGIGSRLLTAMGFTRGSGLGRDNQGIAEAPRAESRAKRAGLGAE  244



>ref|XP_006352537.1| PREDICTED: tuftelin-interacting protein 11-like [Solanum tuberosum]
Length=868

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTA  627
            + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ETS+A
Sbjct  196  DVGGFEKFTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKKMGMGFNDYKETSSA  255


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK  G+G
Sbjct  198  GGFEKFTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKKMGMG  245



>ref|XP_007471923.1| PREDICTED: G patch domain-containing protein 2 [Lipotes vexillifer]
Length=529

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPE---TSTANET  618
               G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+   T+TA+ T
Sbjct  469  NNIGNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPKGLGLGFPLPKSIPTATASNT  525



>gb|AAF26743.1|AF221101_1 septin interacting protein [Drosophila melanogaster]
Length=839

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -2

Query  851  ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            + S +   +  ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI+ P+Q   R
Sbjct  143  QPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVR  202

Query  674  PKALGLGADVPETSTANETKTPTPKSVGFGEDL  576
                 +GA  PET+ +   K  T KS+   ED+
Sbjct  203  KGRGAIGAYGPETAASIGGK--TNKSIKVDEDV  233


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
              G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  159  NVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGA  210



>ref|NP_524725.2| septin interacting protein 1, isoform A [Drosophila melanogaster]
 ref|NP_001285636.1| septin interacting protein 1, isoform B [Drosophila melanogaster]
 sp|Q9Y103.1|TFP11_DROME RecName: Full=Septin-interacting protein 1; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Drosophila 
melanogaster]
 gb|AAD38645.1|AF145670_1 BcDNA.GH11690 [Drosophila melanogaster]
 gb|AAF52282.1| septin interacting protein 1, isoform A [Drosophila melanogaster]
 gb|ACL89377.1| sip1-PA [synthetic construct]
 gb|AHN54151.1| septin interacting protein 1, isoform B [Drosophila melanogaster]
Length=839

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -2

Query  851  ESSDSCHEKKCVSSSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            + S +   +  ++S  N GA+E HT G G+K++++MG+  G GLGKD QGI+ P+Q   R
Sbjct  143  QPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVR  202

Query  674  PKALGLGADVPETSTANETKTPTPKSVGFGEDL  576
                 +GA  PET+ +   K  T KS+   ED+
Sbjct  203  KGRGAIGAYGPETAASIGGK--TNKSIKVDEDV  233


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  509  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
              G++E HT+G G+K++ +MG+  G GLGKD QGI+ P+ A  R     +GA
Sbjct  159  NVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGA  210



>gb|ELW66488.1| Tuftelin-interacting protein 11 [Tupaia chinensis]
Length=565

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  184



>ref|XP_004248294.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Solanum lycopersicum]
Length=867

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -2

Query  803  NYGAFELHTTGFGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTA  627
            + G FE  T G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ETS+A
Sbjct  195  DVGGFEKFTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDYKETSSA  254


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  503  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  357
            G FE  TKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  GGFEKFTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  244



>ref|XP_006094376.1| PREDICTED: G patch domain-containing protein 2 [Myotis lucifugus]
Length=154

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -2

Query  770  FGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETS  633
             G++M+  MG+T G GLG+DG+G+AEPIQ  QRPK LGLG  +P+++
Sbjct  93   IGNRMLQNMGWTPGSGLGRDGKGLAEPIQAMQRPKGLGLGFPLPKST  139



>ref|XP_010692950.1| PREDICTED: zinc finger CCCH domain-containing protein 22 [Beta 
vulgaris subsp. vulgaris]
Length=520

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGL  360
            F  +ENHT+G  SKMMA MG+ EG GLG + QGI  PIL    P  Q L
Sbjct  313  FAEWENHTRGMASKMMANMGYREGMGLGVEGQGIVNPILVKVLPPKQSL  361



>ref|XP_011784827.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Colobus 
angolensis palliatus]
Length=528

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  606
               G++M+  MG+T G GLG+DG+GI+EPIQ  QRPK LGLG  +P+++++  T TP 
Sbjct  468  NNIGNRMLQNMGWTPGSGLGRDGKGISEPIQAMQRPKGLGLGFPLPKSTSS--TNTPN  523



>dbj|BAC26744.1| unnamed protein product [Mus musculus]
Length=504

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT  612
            +  G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P++S  +   T
Sbjct  444  SNIGNRMLQSMGWTPGSGLGRDGRGIAEPVQAVQRPKGLGLGFPLPKSSPTSPAPT  499



>ref|XP_004615574.1| PREDICTED: tuftelin-interacting protein 11 [Sorex araneus]
Length=837

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIVNPIEAKQRKGKGAVGA  192


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIVNPIEAKQR  184



>ref|XP_004613109.1| PREDICTED: G patch domain-containing protein 2 [Sorex araneus]
Length=675

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA  627
            +  G++M+  MG+T G GLG+DG+GIAEPIQ  QRPK LGLG  +P+++ A
Sbjct  615  SNIGNRMLQNMGWTPGTGLGRDGKGIAEPIQALQRPKGLGLGFPLPKSTAA  665



>ref|XP_010580348.1| PREDICTED: tuftelin-interacting protein 11 [Haliaeetus leucocephalus]
Length=827

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  134  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  180



>ref|XP_007082564.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007082565.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Panthera 
tigris altaica]
Length=864

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQR  184



>ref|XP_008140712.1| PREDICTED: tuftelin-interacting protein 11 [Eptesicus fuscus]
Length=837

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|XP_006497258.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Mus 
musculus]
 ref|XP_006497259.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Mus 
musculus]
 gb|EDL13048.1| G patch domain containing 2, isoform CRA_d [Mus musculus]
Length=504

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT  612
            +  G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P++S  +   T
Sbjct  444  SNIGNRMLQSMGWTPGSGLGRDGRGIAEPVQAVQRPKGLGLGFPLPKSSPTSPAPT  499



>ref|XP_006762106.1| PREDICTED: tuftelin-interacting protein 11 [Myotis davidii]
 gb|ELK31482.1| Tuftelin-interacting protein 11 [Myotis davidii]
Length=837

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|XP_009927441.1| PREDICTED: tuftelin-interacting protein 11, partial [Haliaeetus 
albicilla]
Length=789

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  100  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  150


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  96   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  142



>gb|EDL13047.1| G patch domain containing 2, isoform CRA_c, partial [Mus musculus]
Length=537

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT  612
            +  G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P++S  +   T
Sbjct  477  SNIGNRMLQSMGWTPGSGLGRDGRGIAEPVQAVQRPKGLGLGFPLPKSSPTSPAPT  532



>ref|XP_006938603.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Felis 
catus]
Length=862

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQR  184



>ref|XP_006938601.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Felis 
catus]
 ref|XP_006938602.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Felis 
catus]
Length=864

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  138  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQR  184



>ref|XP_009490572.1| PREDICTED: tuftelin-interacting protein 11 [Pelecanus crispus]
Length=739

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  50   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  100


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  46   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  92



>gb|KFR00697.1| Tuftelin-interacting protein 11, partial [Nipponia nippon]
Length=761

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114



>ref|XP_010294372.1| PREDICTED: tuftelin-interacting protein 11, partial [Phaethon 
lepturus]
 gb|KFQ70101.1| Tuftelin-interacting protein 11, partial [Phaethon lepturus]
Length=761

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114



>ref|XP_005869775.1| PREDICTED: tuftelin-interacting protein 11 [Myotis brandtii]
 gb|EPQ09886.1| Tuftelin-interacting protein 11 [Myotis brandtii]
Length=837

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>gb|KFP23981.1| Tuftelin-interacting protein 11, partial [Colius striatus]
Length=644

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRR  378
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  68   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114



>gb|KFO95848.1| Tuftelin-interacting protein 11, partial [Calypte anna]
Length=760

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  71   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  121


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  67   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  113



>gb|KFQ43028.1| Tuftelin-interacting protein 11, partial [Nestor notabilis]
Length=761

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  68   SIVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114



>gb|KFM09886.1| Tuftelin-interacting protein 11, partial [Aptenodytes forsteri]
Length=761

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114



>gb|KFW83342.1| Tuftelin-interacting protein 11, partial [Manacus vitellinus]
Length=763

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  74   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  124


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  70   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  116



>ref|XP_006102063.1| PREDICTED: tuftelin-interacting protein 11 [Myotis lucifugus]
Length=837

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|NP_594091.1| RNA-binding splicing factor (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9UTK6.1|YKR3_SCHPO RecName: Full=G-patch domain-containing protein C1486.03 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB62413.1| RNA-binding splicing factor (predicted) [Schizosaccharomyces 
pombe]
Length=797

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  818  VSSSTNYGAFELHTTGFGSKMMVKMGF-TGGGLGKDGQGIAEPIQVSQRPKALGLGA  651
            VS + N    + +TTGFG+KM+ KMG+  G GLG + +GIAEP+Q   RP+ +GLGA
Sbjct  102  VSQAKNIPKMKFNTTGFGAKMLEKMGYKQGQGLGANAEGIAEPVQSKLRPERVGLGA  158


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  488  HTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            +T GFG+KM+ KMG+ +G GLG +++GI  P+ +  RP+  GLGA
Sbjct  114  NTTGFGAKMLEKMGYKQGQGLGANAEGIAEPVQSKLRPERVGLGA  158



>ref|XP_008492988.1| PREDICTED: tuftelin-interacting protein 11 [Calypte anna]
Length=786

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  97   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  147


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  93   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  139



>ref|XP_010208491.1| PREDICTED: tuftelin-interacting protein 11, partial [Colius striatus]
Length=633

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRR  378
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R
Sbjct  58   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  100


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  54   SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  100



>ref|XP_009908031.1| PREDICTED: tuftelin-interacting protein 11 [Picoides pubescens]
Length=821

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  134  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  180



>ref|XP_010016065.1| PREDICTED: tuftelin-interacting protein 11, partial [Nestor notabilis]
Length=776

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  87   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  137


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  83   SIVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  129



>ref|XP_011588379.1| PREDICTED: tuftelin-interacting protein 11 [Aquila chrysaetos 
canadensis]
Length=827

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  134  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  180



>ref|XP_005498249.1| PREDICTED: tuftelin-interacting protein 11 [Columba livia]
 gb|EMC86848.1| Tuftelin-interacting protein 11 [Columba livia]
Length=827

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  134  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  180



>ref|XP_006497260.1| PREDICTED: G patch domain-containing protein 2 isoform X2 [Mus 
musculus]
 gb|EDL13045.1| G patch domain containing 2, isoform CRA_a [Mus musculus]
Length=490

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  776  TGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT  612
            +  G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P++S  +   T
Sbjct  430  SNIGNRMLQSMGWTPGSGLGRDGRGIAEPVQAVQRPKGLGLGFPLPKSSPTSPAPT  485



>ref|XP_009983332.1| PREDICTED: tuftelin-interacting protein 11, partial [Tauraco 
erythrolophus]
 gb|KFV01662.1| Tuftelin-interacting protein 11, partial [Tauraco erythrolophus]
Length=761

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  68   SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  114



>ref|XP_008220637.1| PREDICTED: zinc finger CCCH domain-containing protein 22 [Prunus 
mume]
Length=499

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGL  360
            F  +ENHT+G  SKMMA MG++EGTGLG   QGI  PI     P  Q L
Sbjct  290  FAKWENHTRGIASKMMANMGYLEGTGLGASGQGIVDPISVKVLPAKQSL  338



>ref|XP_002197903.1| PREDICTED: tuftelin-interacting protein 11 [Taeniopygia guttata]
Length=827

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  134  SFVDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  180



>ref|XP_005230545.1| PREDICTED: tuftelin-interacting protein 11 [Falco peregrinus]
 ref|XP_005439614.1| PREDICTED: tuftelin-interacting protein 11 [Falco cherrug]
Length=827

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  506  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  354
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  812  SSTNYGAFELHTTGFGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQR  675
            S  ++G++E HT G G K++ KMG+  G GLGK+ QGI  PI+  QR
Sbjct  134  SFMDFGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQR  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2145599438534