BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5429

Length=966
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|WP_037052485.1|  hypothetical protein                             62.4    5e-08   
ref|WP_036987809.1|  hypothetical protein                             57.0    6e-07   
ref|WP_004425204.1|  hypothetical protein                             58.2    9e-07   Pseudomonas oleovorans/pseudoalcaligenes group
ref|WP_016967856.1|  hypothetical protein                             53.1    3e-05   Pseudomonas fluorescens
ref|WP_011058979.1|  MULTISPECIES: hypothetical protein               51.2    1e-04   Pseudomonas
ref|WP_041115640.1|  hypothetical protein                             51.2    2e-04   Pseudomonas protegens
ref|XP_004246726.1|  PREDICTED: serine/arginine-rich splicing fac...  51.6    4e-04   Solanum lycopersicum
dbj|BAQ72298.1|  putative uncharacterized protein                     50.1    4e-04   Pseudomonas sp. Os17
ref|XP_010326037.1|  PREDICTED: serine/arginine-rich splicing fac...  51.2    5e-04   
ref|WP_025130508.1|  hypothetical protein                             49.3    7e-04   Pseudomonas sp. PH1b
ref|XP_010326038.1|  PREDICTED: serine/arginine-rich splicing fac...  50.8    8e-04   Solanum lycopersicum
ref|WP_017678705.1|  hypothetical protein                             48.9    9e-04   Pseudomonas
ref|XP_004246725.1|  PREDICTED: serine/arginine-rich splicing fac...  50.4    0.001   Solanum lycopersicum



>ref|WP_037052485.1| hypothetical protein [Pseudomonas oleovorans]
Length=223

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 22/130 (17%)
 Frame = -2

Query  770  KVMTDQDGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEE  591
            +V   + GY+R+P  +R +    + GY+R+P  +R +    +  Y+R+P  +R  V   E
Sbjct  92   RVQLAEGGYERTPGGQRVQ--LAEGGYERTPGGQRVQ--LAEGGYERTPGGQR--VQLAE  145

Query  590  DGYGRSPKGKRSHSPSKREKVMTEEDGYDRSPKGKRSHIPSKR-------EKVMTEEDGY  432
             GY R+P G+R         V   E GY+R+P G+R  +           ++V   E GY
Sbjct  146  GGYERTPGGQR---------VQLAEGGYERTPGGQRVQLAEGGYERTPGGQRVQLAEGGY  196

Query  431  DRSPKGKRSH  402
            +R+P G+R  
Sbjct  197  ERTPGGQRVQ  206


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 70/149 (47%), Gaps = 32/149 (21%)
 Frame = -2

Query  701  QDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSKREKVMT  522
            ++G +R+P  +R +    +D  DR+P ++R +++  E GY R+P G+R         V  
Sbjct  49   ENGAERTPGMQRLQ--LAEDGADRTPGAQRFQLV--EGGYDRTPGGQR---------VQL  95

Query  521  EEDGYDRSPKGKRSHIPS-------KREKVMTEEDGYDRSPKGKRSHSPSSPERGSIAPR  363
             E GY+R+P G+R  +           ++V   E GY+R+P G+R           +A  
Sbjct  96   AEGGYERTPGGQRVQLAEGGYERTPGGQRVQLAEGGYERTPGGQRVQ---------LAEG  146

Query  362  KYDESPFEANGRSGSSPSPRYERSPADDR  276
             Y+ +P    G+        YER+P   R
Sbjct  147  GYERTP---GGQRVQLAEGGYERTPGGQR  172


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 15/113 (13%)
 Frame = -2

Query  770  KVMTDQDGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEE  591
            +V   + GY+R+P  +R +    + GY+R+P  +R +    +  Y+R+P  +R  V   E
Sbjct  124  RVQLAEGGYERTPGGQRVQ--LAEGGYERTPGGQRVQ--LAEGGYERTPGGQR--VQLAE  177

Query  590  DGYGRSPKGKRSHSPSKREKVMTEEDGYDRSPKGKRSHIPSKREKVMTEEDGY  432
             GY R+P G+R         V   E GY+R+P G+R  +       + E+ G+
Sbjct  178  GGYERTPGGQR---------VQLAEGGYERTPGGQRVQLAEGGSDRLIEQRGH  221



>ref|WP_036987809.1| hypothetical protein, partial [Pseudomonas sp. URMO17WK12:I3]
Length=89

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (48%), Gaps = 34/115 (30%)
 Frame = -2

Query  755  QDGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGR  576
            +DG+DR+P    A     +DG+DR+P  +       +D +DR+P  +       EDG+ R
Sbjct  6    EDGFDRTP----AGQTVAEDGFDRTPAGQTVA----EDGFDRTPAGQ----TVAEDGFDR  53

Query  575  SPKGKRSHSPSKREKVMTEEDGYDRSPKGKRSHIPSKREKVMTEEDGYDRSPKGK  411
            +P G+              EDG+DR+P G+              EDG+DR+P G+
Sbjct  54   TPAGQ-----------TVAEDGFDRTPAGQ-----------TVAEDGFDRTPAGQ  86



>ref|WP_004425204.1| hypothetical protein [Pseudomonas pseudoalcaligenes]
 emb|CDM39172.1| hypothetical protein BN5_0560 [Pseudomonas pseudoalcaligenes 
CECT 5344]
 emb|CDR89793.1| hypothetical protein PPSAL_0555 [Pseudomonas pseudoalcaligenes]
Length=175

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 62/113 (55%), Gaps = 15/113 (13%)
 Frame = -2

Query  770  KVMTDQDGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEE  591
            ++   +DGYDR+P  +R +     DGYDR+P ++R + +  +  Y+R+P ++R ++   E
Sbjct  76   RLQLAEDGYDRTPGAQRIQ--LADDGYDRTPGAQRIQLV--EGGYERTPGAQRLQLA--E  129

Query  590  DGYGRSPKGKRSHSPSKREKVMTEEDGYDRSPKGKRSHIPSKREKVMTEEDGY  432
            DGY R+P  +R         +   +DGYDR+P  +R  +       + E+ G+
Sbjct  130  DGYDRTPGAQR---------IQLADDGYDRTPGAQRIQLAEGGSDRLIEQRGH  173



>ref|WP_016967856.1| hypothetical protein [Pseudomonas fluorescens]
Length=155

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 23/99 (23%)
 Frame = -2

Query  698  DGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSKREKVMTE  519
            DGYDR+P   + +++ E D YDR+P  +       EDGY R+P+G+              
Sbjct  59   DGYDRTP---QGQSIAE-DGYDRTPQGQN----VAEDGYNRTPQGQN-----------VA  99

Query  518  EDGYDRSPKGKRSHIPSK---REKVMTEEDGYDRSPKGK  411
            EDGYDR+P+G+      +    EK + E DGY+R+P+G+
Sbjct  100  EDGYDRTPQGQNVAEGGRDRLEEKGLVE-DGYNRTPQGQ  137


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 53/92 (58%), Gaps = 16/92 (17%)
 Frame = -2

Query  752  DGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRS  573
            DGYDR+P   + +++ E DGYDR+P  +       +D Y+R+P  +       EDGY R+
Sbjct  59   DGYDRTP---QGQSIAE-DGYDRTPQGQNVA----EDGYNRTPQGQN----VAEDGYDRT  106

Query  572  PKGKRSHSPSK---REKVMTEEDGYDRSPKGK  486
            P+G+      +    EK + E DGY+R+P+G+
Sbjct  107  PQGQNVAEGGRDRLEEKGLVE-DGYNRTPQGQ  137



>ref|WP_011058979.1| MULTISPECIES: hypothetical protein [Pseudomonas fluorescens group]
 gb|AAY96018.1| conserved hypothetical protein [Pseudomonas protegens Pf-5]
 gb|AGL82417.1| hypothetical protein PFLCHA0_c06180 [Pseudomonas protegens CHA0]
Length=155

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 23/99 (23%)
 Frame = -2

Query  698  DGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSKREKVMTE  519
            DGYDR+P  +       +D YDR+P  +       EDGY R+P+G+              
Sbjct  59   DGYDRTPQGQSVA----EDGYDRTPQGQN----VAEDGYDRTPQGQN-----------VA  99

Query  518  EDGYDRSPKGKRSHIPSK---REKVMTEEDGYDRSPKGK  411
            EDGYDR+P+G+      +    EK + E DGY R+P+G+
Sbjct  100  EDGYDRTPQGQNVAEGGRDRLEEKGLVE-DGYSRTPQGQ  137


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 16/92 (17%)
 Frame = -2

Query  752  DGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRS  573
            DGYDR+P   + +++ E DGYDR+P  +       +D YDR+P  +       EDGY R+
Sbjct  59   DGYDRTP---QGQSVAE-DGYDRTPQGQNVA----EDGYDRTPQGQN----VAEDGYDRT  106

Query  572  PKGKRSHSPSK---REKVMTEEDGYDRSPKGK  486
            P+G+      +    EK + E DGY R+P+G+
Sbjct  107  PQGQNVAEGGRDRLEEKGLVE-DGYSRTPQGQ  137



>ref|WP_041115640.1| hypothetical protein [Pseudomonas protegens]
 dbj|BAO59970.1| hypothetical protein PPC_0623 [Pseudomonas protegens Cab57]
Length=155

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 23/99 (23%)
 Frame = -2

Query  698  DGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSKREKVMTE  519
            DGYDR+P  +       +D YDR+P  +       EDGY R+P+G+              
Sbjct  59   DGYDRTPQGQSVA----EDGYDRTPQGQN----VAEDGYDRTPQGQN-----------VA  99

Query  518  EDGYDRSPKGKRSHIPSK---REKVMTEEDGYDRSPKGK  411
            EDGYDR+P+G+      +    EK + E DGY R+P+G+
Sbjct  100  EDGYDRTPQGQNVAEGGRDRLEEKGLVE-DGYSRTPQGQ  137


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 16/92 (17%)
 Frame = -2

Query  752  DGYDRSPPFKRAKAMTEQDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRS  573
            DGYDR+P   + +++ E DGYDR+P  +       +D YDR+P  +       EDGY R+
Sbjct  59   DGYDRTP---QGQSVAE-DGYDRTPQGQNVA----EDGYDRTPQGQN----VAEDGYDRT  106

Query  572  PKGKRSHSPSK---REKVMTEEDGYDRSPKGK  486
            P+G+      +    EK + E DGY R+P+G+
Sbjct  107  PQGQNVAEGGRDRLEEKGLVE-DGYSRTPQGQ  137



>ref|XP_004246726.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X3 [Solanum lycopersicum]
Length=295

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -2

Query  626  PPSKREKV--MTEEDGYGRSPKGKR---SHSPSKREKVMTEEDGYDRSPKGKRSHIPSKR  462
            PP KRE+V  +     Y RSP+ ++   S  P  R++  T E+G   SP   +S  PS  
Sbjct  166  PPPKREQVDQVKRSRSYSRSPEPRKDSPSPPPKTRKRSPTPEEG---SPMEAKS--PSS-  219

Query  461  EKVMTEEDGYDRSPKGKRSHSPSSPERGSIAPRKY-DESPFEANGRSGSSPSPRYERSPA  285
               M EE  Y +SP+ +RS SPSS  R S APRKY D+SP EANG S  SPSP+Y+R+  
Sbjct  220  --PMREEGAYSQSPR-ERSVSPSSTRRDSPAPRKYDDDSPAEANGGS-RSPSPKYQRNHE  275

Query  284  DDRDD  270
            DD D+
Sbjct  276  DDEDE  280



>dbj|BAQ72298.1| putative uncharacterized protein [Pseudomonas sp. Os17]
 dbj|BAQ78502.1| putative uncharacterized protein [Pseudomonas sp. St29]
Length=155

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 23/99 (23%)
 Frame = -2

Query  698  DGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSKREKVMTE  519
            DGYDR+P  +       +D YDR+P  +       EDGY R+P+G+              
Sbjct  59   DGYDRTPQGQSVA----EDGYDRTPQGQN----VAEDGYDRTPQGQN-----------VA  99

Query  518  EDGYDRSPKGKRSHIPSK---REKVMTEEDGYDRSPKGK  411
            EDGYDR+P+G+      +    EK +  EDG+ R+P+G+
Sbjct  100  EDGYDRTPQGQTVAEGGRDRLEEKGLV-EDGFSRTPQGQ  137



>ref|XP_010326037.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X4 [Solanum lycopersicum]
Length=294

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -2

Query  626  PPSKREKV--MTEEDGYGRSPKGKR---SHSPSKREKVMTEEDGYDRSPKGKRSHIPSKR  462
            PP KRE+V  +     Y RSP+ ++   S  P  R++  T E+G   SP   +S  PS  
Sbjct  165  PPPKREQVDQVKRSRSYSRSPEPRKDSPSPPPKTRKRSPTPEEG---SPMEAKS--PSS-  218

Query  461  EKVMTEEDGYDRSPKGKRSHSPSSPERGSIAPRKY-DESPFEANGRSGSSPSPRYERSPA  285
               M EE  Y +SP+ +RS SPSS  R S APRKY D+SP EANG S  SPSP+Y+R+  
Sbjct  219  --PMREEGAYSQSPR-ERSVSPSSTRRDSPAPRKYDDDSPAEANGGS-RSPSPKYQRNHE  274

Query  284  DDRDD  270
            DD D+
Sbjct  275  DDEDE  279



>ref|WP_025130508.1| hypothetical protein [Pseudomonas sp. PH1b]
Length=168

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 16/102 (16%)
 Frame = -2

Query  698  DGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSK---REKV  528
            DGYDR+P  +       +D YDR+P  +       EDGY R+P+G+      +    EK 
Sbjct  59   DGYDRTPQGQSVA----EDGYDRTPQGQN----VAEDGYDRTPQGQNVAEGGRDRLEEKG  110

Query  527  MTEEDGYDRSPKGKRSHIPSK---REKVMTEEDGYDRSPKGK  411
            + E DGY R+P+G+      +    EK + E DGY R+P+G+
Sbjct  111  LVE-DGYSRTPQGQTVAEGGRDRLEEKGLVE-DGYSRTPQGQ  150



>ref|XP_010326038.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X5 [Solanum lycopersicum]
Length=273

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -2

Query  626  PPSKREKV--MTEEDGYGRSPKGKR---SHSPSKREKVMTEEDGYDRSPKGKRSHIPSKR  462
            PP KRE+V  +     Y RSP+ ++   S  P  R++  T E+G   SP   +S  PS  
Sbjct  144  PPPKREQVDQVKRSRSYSRSPEPRKDSPSPPPKTRKRSPTPEEG---SPMEAKS--PSS-  197

Query  461  EKVMTEEDGYDRSPKGKRSHSPSSPERGSIAPRKY-DESPFEANGRSGSSPSPRYERSPA  285
               M EE  Y +SP+ +RS SPSS  R S APRKY D+SP EANG S  SPSP+Y+R+  
Sbjct  198  --PMREEGAYSQSPR-ERSVSPSSTRRDSPAPRKYDDDSPAEANGGS-RSPSPKYQRNHE  253

Query  284  DDRDD  270
            DD D+
Sbjct  254  DDEDE  258



>ref|WP_017678705.1| hypothetical protein [Pseudomonas alcaliphila]
Length=159

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 56/105 (53%), Gaps = 20/105 (19%)
 Frame = -2

Query  701  QDGYDRSPPSKRAKAMTEQDDYDRSPPSKREKVMTEEDGYGRSPKGKRSHSPSKREKVMT  522
            +DG DR+P ++R + +TE   Y+R+P ++R +++  E GY R+P  +R         V  
Sbjct  49   EDGSDRTPGAQRIQ-LTE-GGYERTPGAQRIQLV--EGGYERTPGAQR---------VQL  95

Query  521  EEDGYDRSPKGKRSHIPS-------KREKVMTEEDGYDRSPKGKR  408
             E GYDR+P  +R  +           +++   E GY+R+P  +R
Sbjct  96   AEGGYDRTPGAQRLQLAEDGSDRTPGAQRIQLAEGGYERTPGAQR  140



>ref|XP_004246725.1| PREDICTED: serine/arginine-rich splicing factor RS2Z33 isoform 
X1 [Solanum lycopersicum]
Length=315

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = -2

Query  626  PPSKREKV--MTEEDGYGRSPKGKR---SHSPSKREKVMTEEDGYDRSPKGKRSHIPSKR  462
            PP KRE+V  +     Y RSP+ ++   S  P  R++  T E+G   SP   +S  PS  
Sbjct  186  PPPKREQVDQVKRSRSYSRSPEPRKDSPSPPPKTRKRSPTPEEG---SPMEAKS--PSS-  239

Query  461  EKVMTEEDGYDRSPKGKRSHSPSSPERGSIAPRKY-DESPFEANGRSGSSPSPRYERSPA  285
               M EE  Y +SP+ +RS SPSS  R S APRKY D+SP EANG S  SPSP+Y+R+  
Sbjct  240  --PMREEGAYSQSPR-ERSVSPSSTRRDSPAPRKYDDDSPAEANGGS-RSPSPKYQRNHE  295

Query  284  DDRDD  270
            DD D+
Sbjct  296  DDEDE  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2364259253926