BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig542

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788736.1|  PREDICTED: luminal-binding protein 4               414   2e-137   Nicotiana sylvestris
sp|Q03684.1|BIP4_TOBAC  RecName: Full=Luminal-binding protein 4; ...    414   3e-137   Nicotiana tabacum [American tobacco]
gb|ACK55195.1|  ER luminal-binding protein                              412   8e-137   Nicotiana benthamiana
ref|XP_009588550.1|  PREDICTED: luminal-binding protein 4               412   8e-137   Nicotiana tomentosiformis
ref|XP_009773333.1|  PREDICTED: luminal-binding protein 5               407   1e-134   Nicotiana sylvestris
gb|AGS42239.1|  ER luminal-binding protein                              406   3e-134   Capsicum annuum
emb|CDP05035.1|  unnamed protein product                                405   1e-133   Coffea canephora [robusta coffee]
ref|XP_009592769.1|  PREDICTED: luminal-binding protein 5               404   2e-133   Nicotiana tomentosiformis
gb|KJB39586.1|  hypothetical protein B456_007G020600                    395   6e-133   Gossypium raimondii
ref|XP_011075955.1|  PREDICTED: luminal-binding protein 5               402   2e-132   Sesamum indicum [beniseed]
ref|XP_004234985.1|  PREDICTED: luminal-binding protein 5               401   2e-132   Solanum lycopersicum
ref|XP_007211088.1|  hypothetical protein PRUPE_ppa002489mg             401   3e-132   Prunus persica
gb|KJB39579.1|  hypothetical protein B456_007G020300                    395   1e-131   Gossypium raimondii
gb|KGN50013.1|  hypothetical protein Csa_5G149330                       397   5e-131   Cucumis sativus [cucumbers]
ref|XP_006350519.1|  PREDICTED: luminal-binding protein 5-like          397   6e-131   Solanum tuberosum [potatoes]
ref|XP_008437399.1|  PREDICTED: luminal-binding protein 5               397   8e-131   Cucumis melo [Oriental melon]
emb|CAC14168.1|  putative luminal binding protein                       397   1e-130   Corylus avellana [European hazelnut]
gb|AAK21920.1|AF338252_1  BiP-isoform D                                 391   1e-130   Glycine max [soybeans]
gb|KJB39584.1|  hypothetical protein B456_007G020600                    396   2e-130   Gossypium raimondii
gb|AAW55475.1|  ER-binding protein                                      396   2e-130   Malus pumila [paradise apple]
ref|XP_008390320.1|  PREDICTED: luminal-binding protein 5               396   2e-130   Malus domestica [apple tree]
gb|KJB39580.1|  hypothetical protein B456_007G020300                    396   2e-130   Gossypium raimondii
ref|XP_008239207.1|  PREDICTED: luminal-binding protein 5               396   2e-130   Prunus mume [ume]
ref|NP_001292703.1|  luminal-binding protein 5                          395   6e-130   Cucumis sativus [cucumbers]
ref|XP_010266594.1|  PREDICTED: luminal-binding protein 5               394   1e-129   Nelumbo nucifera [Indian lotus]
gb|KHN16716.1|  Luminal-binding protein 5                               396   1e-129   Glycine soja [wild soybean]
ref|XP_011084527.1|  PREDICTED: luminal-binding protein 5-like          394   1e-129   Sesamum indicum [beniseed]
gb|KHG04866.1|  Luminal-binding 5                                       396   1e-129   Gossypium arboreum [tree cotton]
ref|XP_009770477.1|  PREDICTED: luminal-binding protein 4-like          394   2e-129   Nicotiana sylvestris
ref|XP_009619852.1|  PREDICTED: luminal-binding protein 4-like          394   2e-129   Nicotiana tomentosiformis
ref|XP_008337565.1|  PREDICTED: luminal-binding protein 5-like          393   3e-129   
gb|AAA99920.1|  glucose-regulated protein 78                            383   3e-129   Solanum lycopersicum
gb|KHM99873.1|  Luminal-binding protein 5                               393   3e-129   Glycine soja [wild soybean]
ref|XP_006476337.1|  PREDICTED: luminal-binding protein 5-like          393   4e-129   Citrus sinensis [apfelsine]
ref|XP_012074649.1|  PREDICTED: luminal-binding protein 5               393   4e-129   Jatropha curcas
ref|XP_012086670.1|  PREDICTED: luminal-binding protein 5-like          392   5e-129   Jatropha curcas
ref|XP_003530453.1|  PREDICTED: luminal-binding protein 5               392   6e-129   Glycine max [soybeans]
ref|XP_009802727.1|  PREDICTED: luminal-binding protein                 392   7e-129   Nicotiana sylvestris
ref|XP_006439283.1|  hypothetical protein CICLE_v10019184mg             392   8e-129   Citrus clementina [clementine]
ref|XP_009593820.1|  PREDICTED: luminal-binding protein                 392   9e-129   Nicotiana tomentosiformis
gb|KJB18908.1|  hypothetical protein B456_003G074600                    384   1e-128   Gossypium raimondii
ref|XP_009358650.1|  PREDICTED: luminal-binding protein 5-like          392   1e-128   Pyrus x bretschneideri [bai li]
gb|KJB18909.1|  hypothetical protein B456_003G074600                    384   1e-128   Gossypium raimondii
ref|XP_010107258.1|  Luminal-binding protein 5                          391   1e-128   Morus notabilis
gb|AJF19166.1|  endoplasmic reticulum chaperone binding protein         391   1e-128   Lycium chinense [Chinese boxthorn]
gb|KHG09348.1|  Luminal-binding 5                                       391   2e-128   Gossypium arboreum [tree cotton]
gb|AAB86942.1|  endoplasmic reticulum HSC70-cognate binding prote...    391   2e-128   Glycine max [soybeans]
ref|XP_007040596.1|  Heat shock protein 70 (Hsp 70) family protein      391   2e-128   
gb|KJB24175.1|  hypothetical protein B456_004G131400                    386   2e-128   Gossypium raimondii
gb|KJB18915.1|  hypothetical protein B456_003G074600                    384   3e-128   Gossypium raimondii
gb|KJB18910.1|  hypothetical protein B456_003G074600                    384   3e-128   Gossypium raimondii
sp|Q42434.1|BIP_SPIOL  RecName: Full=Luminal-binding protein; Sho...    390   5e-128   Spinacia oleracea
ref|XP_010671405.1|  PREDICTED: luminal-binding protein                 390   5e-128   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009396163.1|  PREDICTED: luminal-binding protein 2-like          390   6e-128   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB18911.1|  hypothetical protein B456_003G074600                    385   9e-128   Gossypium raimondii
ref|XP_006286332.1|  hypothetical protein CARUB_v100044651mg            380   1e-127   
gb|EYU19660.1|  hypothetical protein MIMGU_mgv1a002500mg                389   1e-127   Erythranthe guttata [common monkey flower]
emb|CBI34546.3|  unnamed protein product                                387   1e-127   Vitis vinifera
gb|KJB18913.1|  hypothetical protein B456_003G074600                    383   2e-127   Gossypium raimondii
ref|XP_002518865.1|  heat shock protein, putative                       389   2e-127   Ricinus communis
ref|XP_007160200.1|  hypothetical protein PHAVU_002G301400g             388   3e-127   Phaseolus vulgaris [French bean]
emb|CBI23034.3|  unnamed protein product                                387   3e-127   Vitis vinifera
ref|XP_002263323.1|  PREDICTED: luminal-binding protein 5               387   5e-127   Vitis vinifera
ref|XP_002276268.2|  PREDICTED: luminal-binding protein 5-like is...    387   6e-127   Vitis vinifera
gb|KHG07305.1|  Luminal-binding 5                                       387   6e-127   Gossypium arboreum [tree cotton]
ref|XP_006286341.1|  hypothetical protein CARUB_v100065121mg            381   8e-127   
gb|KJB24174.1|  hypothetical protein B456_004G131400                    387   9e-127   Gossypium raimondii
ref|XP_004503582.1|  PREDICTED: luminal-binding protein-like            387   1e-126   Cicer arietinum [garbanzo]
ref|XP_011026831.1|  PREDICTED: luminal-binding protein 5               386   2e-126   Populus euphratica
ref|XP_002299448.1|  BiP isoform A family protein                       385   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010055986.1|  PREDICTED: luminal-binding protein                 385   3e-126   Eucalyptus grandis [rose gum]
emb|CDP12195.1|  unnamed protein product                                385   4e-126   Coffea canephora [robusta coffee]
gb|KCW72555.1|  hypothetical protein EUGRSUZ_E01024                     386   6e-126   Eucalyptus grandis [rose gum]
gb|ACJ11746.1|  luminal binding protein                                 384   6e-126   Gossypium hirsutum [American cotton]
gb|KJB18907.1|  hypothetical protein B456_003G074600                    384   7e-126   Gossypium raimondii
ref|XP_006343810.1|  PREDICTED: luminal-binding protein-like            384   1e-125   Solanum tuberosum [potatoes]
ref|XP_002303672.1|  BiP isoform A family protein                       384   1e-125   Populus trichocarpa [western balsam poplar]
ref|XP_011022455.1|  PREDICTED: luminal-binding protein 5-like          384   1e-125   Populus euphratica
gb|EYU25251.1|  hypothetical protein MIMGU_mgv1a002497mg                384   2e-125   Erythranthe guttata [common monkey flower]
ref|XP_006405286.1|  hypothetical protein EUTSA_v10027674mg             384   2e-125   Eutrema salsugineum [saltwater cress]
ref|NP_001234636.1|  luminal-binding protein precursor                  383   2e-125   
ref|NP_199017.2|  Luminal-binding protein 2                             382   2e-125   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA12348.1|  luminal binding protein (BiP)                          383   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851119.1|  Luminal-binding protein 2                             383   3e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300491.1|  PREDICTED: luminal-binding protein                 383   3e-125   Fragaria vesca subsp. vesca
ref|XP_010918502.1|  PREDICTED: luminal-binding protein 4-like          382   4e-125   Elaeis guineensis
ref|XP_006401475.1|  hypothetical protein EUTSA_v10012896mg             382   8e-125   Eutrema salsugineum [saltwater cress]
emb|CDX79726.1|  BnaC03g20620D                                          381   9e-125   
gb|KFK32162.1|  hypothetical protein AALP_AA6G205800                    381   1e-124   Arabis alpina [alpine rockcress]
gb|KEH21274.1|  heat shock 70 kDa protein                               381   1e-124   Medicago truncatula
dbj|BAA13948.1|  luminal binding protein                                381   1e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132761.1|  PREDICTED: mediator of RNA polymerase II tra...    381   2e-124   Brassica rapa
emb|CDY23972.1|  BnaC03g17190D                                          380   2e-124   Brassica napus [oilseed rape]
gb|AAA81953.1|  BiP isoform C                                           374   2e-124   Glycine max [soybeans]
ref|XP_002887878.1|  hypothetical protein ARALYDRAFT_892955             380   3e-124   Arabidopsis lyrata subsp. lyrata
ref|XP_002868566.1|  hypothetical protein ARALYDRAFT_493781             380   3e-124   
ref|XP_010436161.1|  PREDICTED: mediator of RNA polymerase II tra...    380   3e-124   Camelina sativa [gold-of-pleasure]
ref|XP_008796727.1|  PREDICTED: luminal-binding protein 5               380   3e-124   Phoenix dactylifera
emb|CDY63497.1|  BnaC07g48050D                                          379   4e-124   Brassica napus [oilseed rape]
ref|XP_010473721.1|  PREDICTED: mediator of RNA polymerase II tra...    380   4e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010430591.1|  PREDICTED: mediator of RNA polymerase II tra...    379   5e-124   Camelina sativa [gold-of-pleasure]
ref|XP_004503579.1|  PREDICTED: luminal-binding protein-like            379   6e-124   Cicer arietinum [garbanzo]
gb|AAZ95244.1|  putative luminal-binding protein                        379   7e-124   Isatis tinctoria [woad]
ref|XP_010446984.1|  PREDICTED: mediator of RNA polymerase II tra...    379   2e-123   Camelina sativa [gold-of-pleasure]
gb|KDO76632.1|  hypothetical protein CISIN_1g0059551mg                  370   2e-123   Citrus sinensis [apfelsine]
dbj|BAD95470.1|  BiP                                                    378   2e-123   Glycine max [soybeans]
gb|KHN16714.1|  Luminal-binding protein 5                               378   2e-123   Glycine soja [wild soybean]
emb|CDY46766.1|  BnaA03g17100D                                          377   3e-123   Brassica napus [oilseed rape]
gb|KHM99871.1|  Luminal-binding protein 4                               377   4e-123   Glycine soja [wild soybean]
gb|ACF86491.1|  unknown                                                 377   5e-123   Zea mays [maize]
ref|NP_001045675.1|  Os02g0115900                                       377   5e-123   
ref|NP_001105894.1|  luminal-binding protein 3 precursor                377   5e-123   Zea mays [maize]
gb|AGT16206.1|  luminal-binding protein                                 377   6e-123   Saccharum hybrid cultivar R570
gb|AGT15890.1|  luminal-binding protein                                 377   6e-123   Saccharum hybrid cultivar R570
ref|NP_198206.1|  Luminal-binding protein 1                             377   6e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16055.1|  luminal-binding protein 2 precursor                     377   7e-123   Saccharum hybrid cultivar R570
gb|KDO76630.1|  hypothetical protein CISIN_1g0059551mg                  371   7e-123   Citrus sinensis [apfelsine]
ref|XP_003525327.2|  PREDICTED: luminal-binding protein                 377   1e-122   
ref|NP_001105893.1|  luminal-binding protein 2 precursor                376   1e-122   
emb|CDX77423.1|  BnaA07g05610D                                          375   1e-122   
ref|XP_006827760.1|  PREDICTED: luminal-binding protein                 376   1e-122   Amborella trichopoda
gb|KDO76631.1|  hypothetical protein CISIN_1g0059551mg                  370   2e-122   Citrus sinensis [apfelsine]
ref|XP_009102505.1|  PREDICTED: mediator of RNA polymerase II tra...    375   3e-122   
gb|EPS69483.1|  luminal-binding protein 5                               374   9e-122   Genlisea aurea
ref|XP_004952156.1|  PREDICTED: luminal-binding protein 3-like          374   1e-121   Setaria italica
ref|XP_006648229.1|  PREDICTED: luminal-binding protein 2-like          373   2e-121   Oryza brachyantha
dbj|BAA13947.1|  luminal binding protein                                372   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010662895.1|  PREDICTED: luminal-binding protein 5-like is...    372   1e-120   Vitis vinifera
ref|XP_010545034.1|  PREDICTED: luminal-binding protein 4               371   1e-120   Tarenaya hassleriana [spider flower]
gb|KDO76629.1|  hypothetical protein CISIN_1g0059551mg                  370   1e-120   Citrus sinensis [apfelsine]
ref|XP_009392825.1|  PREDICTED: luminal-binding protein 2               370   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418642.1|  PREDICTED: luminal-binding protein 2-like          370   3e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB63469.1|  endosperm lumenal binding protein                       370   3e-120   Oryza sativa [red rice]
ref|XP_002317789.2|  BiP isoform A family protein                       368   2e-119   Populus trichocarpa [western balsam poplar]
ref|NP_001238736.1|  BiP isoform B precursor                            368   2e-119   
ref|XP_003573226.1|  PREDICTED: luminal-binding protein 3               368   2e-119   Brachypodium distachyon [annual false brome]
gb|KFK32977.1|  hypothetical protein AALP_AA6G313600                    367   2e-119   Arabis alpina [alpine rockcress]
emb|CDX67525.1|  BnaA07g15650D                                          364   4e-119   
gb|KEH21282.1|  heat shock cognate 70 kDa-like protein                  367   5e-119   Medicago truncatula
ref|XP_010934830.1|  PREDICTED: luminal-binding protein 4               366   6e-119   Elaeis guineensis
gb|AAA62325.1|  HSP70                                                   363   4e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT16454.1|  Luminal-binding protein 4                               364   7e-118   
gb|KHG03675.1|  Luminal-binding 5                                       363   8e-118   Gossypium arboreum [tree cotton]
dbj|BAJ85675.1|  predicted protein                                      363   9e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS58484.1|  Luminal-binding protein 3                               364   2e-117   Triticum urartu
ref|XP_009125214.1|  PREDICTED: mediator of RNA polymerase II tra...    362   2e-117   Brassica rapa
gb|AGN94841.1|  ER molecular chaperone                                  362   3e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001774724.1|  predicted protein                                  358   1e-115   
ref|XP_010259649.1|  PREDICTED: luminal-binding protein 4-like          358   1e-115   Nelumbo nucifera [Indian lotus]
emb|CAA89834.2|  luminal binding protein                                356   9e-115   Pseudotsuga menziesii
gb|ABR18447.1|  unknown                                                 354   9e-114   Picea sitchensis
ref|XP_006838409.1|  PREDICTED: luminal-binding protein                 352   4e-113   Amborella trichopoda
ref|NP_001290009.1|  mediator of RNA polymerase II transcription ...    352   4e-113   Vitis vinifera
ref|NP_001234941.1|  BiP isoform A                                      351   6e-113   
emb|CDY13371.1|  BnaC06g13860D                                          351   9e-113   Brassica napus [oilseed rape]
emb|CBI39503.3|  unnamed protein product                                348   1e-112   Vitis vinifera
ref|XP_010659633.1|  PREDICTED: mediator of RNA polymerase II tra...    348   5e-112   
ref|XP_002969949.1|  hypothetical protein SELMODRAFT_440900             347   3e-111   Selaginella moellendorffii
emb|CDP15491.1|  unnamed protein product                                345   8e-111   Coffea canephora [robusta coffee]
ref|XP_002981419.1|  hypothetical protein SELMODRAFT_444846             345   1e-110   Selaginella moellendorffii
ref|XP_006433401.1|  hypothetical protein CICLE_v10000531mg             344   2e-110   Citrus clementina [clementine]
ref|XP_001780840.1|  predicted protein                                  345   2e-110   
ref|XP_006479343.1|  PREDICTED: luminal-binding protein 5-like          343   4e-110   Citrus sinensis [apfelsine]
ref|XP_006423175.1|  hypothetical protein CICLE_v10027975mg             342   2e-109   
ref|XP_006423179.1|  hypothetical protein CICLE_v10030400mg             342   2e-109   
ref|XP_006405378.1|  hypothetical protein EUTSA_v10028192mg             334   2e-109   
gb|AFC88846.1|  putative luminal binding protein 7B4                    342   3e-109   Tetragonia tetragonioides
ref|XP_010458176.1|  PREDICTED: probable mediator of RNA polymera...    340   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011092383.1|  PREDICTED: luminal-binding protein 5-like          339   2e-108   Sesamum indicum [beniseed]
ref|XP_010458175.1|  PREDICTED: probable mediator of RNA polymera...    339   3e-108   
ref|XP_006306953.1|  hypothetical protein CARUB_v10008520mg             338   5e-108   Capsella rubella
ref|XP_008388543.1|  PREDICTED: luminal-binding protein 5-like          338   6e-108   
gb|KDO56235.1|  hypothetical protein CISIN_1g006194mg                   338   8e-108   Citrus sinensis [apfelsine]
ref|XP_007030985.1|  Heat shock protein 70 (Hsp 70) family protein      337   1e-107   
ref|NP_001184944.1|  protein BIP3                                       337   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423186.1|  hypothetical protein CICLE_v10030032mg             336   2e-107   
ref|XP_010475731.1|  PREDICTED: probable mediator of RNA polymera...    337   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006480058.1|  PREDICTED: luminal-binding protein 5-like          336   3e-107   
ref|XP_010475732.1|  PREDICTED: probable mediator of RNA polymera...    336   4e-107   Camelina sativa [gold-of-pleasure]
emb|CDP21572.1|  unnamed protein product                                323   4e-107   Coffea canephora [robusta coffee]
ref|XP_010041040.1|  PREDICTED: luminal-binding protein 5-like          336   4e-107   Eucalyptus grandis [rose gum]
ref|XP_010674036.1|  PREDICTED: luminal-binding protein 5               336   4e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_172382.4|  protein BIP3                                          336   6e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAB70400.1|  Similar to Arabidopsis luminal binding protein (g...    335   1e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088129.1|  PREDICTED: luminal-binding protein 5-like          335   1e-106   Sesamum indicum [beniseed]
ref|XP_007206318.1|  hypothetical protein PRUPE_ppa002572mg             334   1e-106   
ref|XP_008246412.1|  PREDICTED: luminal-binding protein 5               334   2e-106   Prunus mume [ume]
ref|XP_009118328.1|  PREDICTED: probable mediator of RNA polymera...    333   5e-106   Brassica rapa
emb|CDY22648.1|  BnaC08g42820D                                          331   1e-105   Brassica napus [oilseed rape]
emb|CDY06347.1|  BnaA09g48560D                                          332   1e-105   
ref|XP_012089020.1|  PREDICTED: mediator of RNA polymerase II tra...    332   1e-105   Jatropha curcas
ref|XP_011092073.1|  PREDICTED: luminal-binding protein 5-like          332   1e-105   Sesamum indicum [beniseed]
gb|KJB81015.1|  hypothetical protein B456_013G125300                    332   2e-105   Gossypium raimondii
ref|XP_006417615.1|  hypothetical protein EUTSA_v10009566mg             331   4e-105   Eutrema salsugineum [saltwater cress]
gb|KFK43208.1|  hypothetical protein AALP_AA1G094300                    329   1e-104   Arabis alpina [alpine rockcress]
gb|KFK43207.1|  hypothetical protein AALP_AA1G094300                    329   2e-104   Arabis alpina [alpine rockcress]
emb|CAC37635.1|  luminal binding protein, BiP                           328   3e-104   Scherffelia dubia
ref|XP_004302398.1|  PREDICTED: luminal-binding protein 4               328   3e-104   Fragaria vesca subsp. vesca
ref|XP_009766974.1|  PREDICTED: luminal-binding protein 5-like          328   4e-104   Nicotiana sylvestris
ref|XP_009622355.1|  PREDICTED: mediator of RNA polymerase II tra...    328   7e-104   Nicotiana tomentosiformis
ref|XP_005842772.1|  hypothetical protein CHLNCDRAFT_144025             316   1e-103   Chlorella variabilis
ref|XP_002318993.2|  heat shock protein 70 cognate                      326   3e-103   
ref|XP_006344666.1|  PREDICTED: mediator of RNA polymerase II tra...    324   1e-102   Solanum tuberosum [potatoes]
ref|XP_011023674.1|  PREDICTED: luminal-binding protein 4-like          324   1e-102   Populus euphratica
gb|KIY96078.1|  heat shock 70kDa protein 5                              314   2e-101   Monoraphidium neglectum
ref|XP_010553728.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    320   7e-101   
ref|XP_010027237.1|  PREDICTED: luminal-binding protein 5-like          319   1e-100   
ref|XP_004230233.1|  PREDICTED: mediator of RNA polymerase II tra...    318   4e-100   Solanum lycopersicum
ref|NP_001051048.1|  Os03g0710500                                       318   5e-100   
ref|XP_006650483.1|  PREDICTED: luminal-binding protein 4-like          318   5e-100   Oryza brachyantha
ref|XP_005651681.1|  binding protein 1                                  313   9e-99    Coccomyxa subellipsoidea C-169
gb|EEE59790.1|  hypothetical protein OsJ_12307                          315   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002949576.1|  luminal binding protein Bip1                       313   2e-98    Volvox carteri f. nagariensis
ref|XP_001701685.1|  binding protein 1                                  312   4e-98    Chlamydomonas reinhardtii
ref|XP_006472125.1|  PREDICTED: probable mediator of RNA polymera...    305   5e-98    
gb|EYU18532.1|  hypothetical protein MIMGU_mgv1a022234mg                311   5e-98    Erythranthe guttata [common monkey flower]
ref|XP_006472126.1|  PREDICTED: probable mediator of RNA polymera...    307   1e-97    Citrus sinensis [apfelsine]
ref|XP_002466589.1|  hypothetical protein SORBIDRAFT_01g010460          310   3e-97    Sorghum bicolor [broomcorn]
dbj|BAJ89190.1|  predicted protein                                      310   5e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007509232.1|  heat shock protein 70                              297   6e-97    Bathycoccus prasinos
ref|XP_002507118.1|  heat shock binding protein 70, ER luminal          309   9e-97    Micromonas commoda
emb|CEG00952.1|  Heat shock protein 70 family                           307   3e-96    Ostreococcus tauri
ref|XP_001701884.1|  binding protein 2                                  308   3e-96    Chlamydomonas reinhardtii
ref|XP_003074861.1|  Bip Luminal binding protein precursor, proba...    308   3e-96    
ref|XP_003055985.1|  luminal binding heat shock protein 70              307   4e-96    Micromonas pusilla CCMP1545
ref|XP_005829514.1|  heat shock protein 70, ER luminal                  307   6e-96    Guillardia theta CCMP2712
ref|NP_001055613.1|  Os05g0428600                                       307   7e-96    
ref|XP_004964075.1|  PREDICTED: luminal-binding protein 3-like          306   1e-95    Setaria italica
ref|XP_004971898.1|  PREDICTED: luminal-binding protein 3-like          306   2e-95    
ref|XP_004986284.1|  PREDICTED: luminal-binding protein 4-like          306   3e-95    Setaria italica
gb|EIE87053.1|  heat shock 70 kDa protein                               293   3e-95    Rhizopus delemar RA 99-880
ref|NP_001061194.1|  Os08g0197700                                       305   4e-95    
ref|XP_004971892.1|  PREDICTED: luminal-binding protein 3-like          304   6e-95    
ref|XP_002977324.1|  hypothetical protein SELMODRAFT_417280             304   6e-95    
ref|XP_002971962.1|  hypothetical protein SELMODRAFT_412732             304   6e-95    
ref|XP_005539525.1|  luminal binding protein BiP                        305   6e-95    Cyanidioschyzon merolae strain 10D
ref|XP_001416181.1|  Luminal binding protein precursor, probable        304   7e-95    Ostreococcus lucimarinus CCE9901
ref|XP_006644572.1|  PREDICTED: luminal-binding protein 5-like          304   1e-94    Oryza brachyantha
gb|KDD73887.1|  heat shock protein 70 Hsp70                             303   1e-94    Helicosporidium sp. ATCC 50920
dbj|BAC67670.1|  Heat shock 70 kDa protein                              306   2e-94    Cyanidioschyzon merolae strain 10D
ref|XP_003565461.1|  PREDICTED: luminal-binding protein 2-like          303   3e-94    Brachypodium distachyon [annual false brome]
dbj|BAK06498.1|  predicted protein                                      303   3e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003867956.1|  Ssa2 HSP70 chaperone                               288   3e-94    
ref|XP_006433443.1|  hypothetical protein CICLE_v10003511mg             298   4e-94    
ref|XP_002456746.1|  hypothetical protein SORBIDRAFT_03g041830          302   5e-94    Sorghum bicolor [broomcorn]
ref|XP_006433439.1|  hypothetical protein CICLE_v10003341mg             297   7e-94    
emb|CEI96781.1|  Putative Hsp70-like protein                            300   2e-93    Rhizopus microsporus
ref|XP_006655245.1|  PREDICTED: luminal-binding protein 4-like          300   2e-93    Oryza brachyantha
gb|EPB86036.1|  glucose-regulated protein                               300   2e-93    Mucor circinelloides f. circinelloides 1006PhL
dbj|BAG57068.1|  unnamed protein product                                288   3e-93    Homo sapiens [man]
dbj|GAN05474.1|  78 kDa glucose-regulated protein precursor             300   4e-93    Mucor ambiguus
ref|XP_006694812.1|  hypothetical protein CTHT_0044200                  300   4e-93    Chaetomium thermophilum var. thermophilum DSM 1495
emb|CDP15493.1|  unnamed protein product                                296   6e-93    Coffea canephora [robusta coffee]
gb|AER57864.1|  heat shock 70 family protein                            299   6e-93    Acytostelium subglobosum
emb|CEG66501.1|  Putative 70 kDa heat shock protein 3                   299   6e-93    Rhizopus microsporus
pdb|3LDL|A  Chain A, Crystal Structure Of Human Grp78 (70kda Heat...    290   8e-93    Homo sapiens [man]
gb|ELT89714.1|  hypothetical protein CAPTEDRAFT_18512                   298   9e-93    Capitella teleta
ref|XP_009854462.1|  hypothetical protein NEUTE1DRAFT_69229             298   9e-93    Neurospora tetrasperma FGSC 2508
ref|XP_956567.1|  glucose-regulated protein                             298   1e-92    Neurospora crassa OR74A
ref|XP_003870868.1|  Hsp70 hsp70 chaperone                              284   1e-92    
ref|XP_002892480.1|  hypothetical protein ARALYDRAFT_311954             298   1e-92    
ref|XP_008644508.1|  PREDICTED: luminal-binding protein 5-like is...    296   2e-92    Zea mays [maize]
ref|XP_008644507.1|  PREDICTED: luminal-binding protein 5-like is...    296   2e-92    Zea mays [maize]
ref|XP_007865808.1|  heat shock protein 70                              298   2e-92    Gloeophyllum trabeum ATCC 11539
pdb|3IUC|A  Chain A, Crystal Structure Of The Human 70kda Heat Sh...    290   4e-92    Homo sapiens [man]
emb|CEI88073.1|  Putative Hsp71-like protein                            285   4e-92    Rhizopus microsporus
ref|XP_003283993.1|  hypothetical protein DICPUDRAFT_52641              296   5e-92    Dictyostelium purpureum
ref|XP_004934153.1|  PREDICTED: major heat shock 70 kDa protein Ba      282   7e-92    
ref|XP_006220075.1|  PREDICTED: heat shock 70 kDa protein A-like        281   7e-92    Vicugna pacos
ref|XP_002977325.1|  hypothetical protein SELMODRAFT_12397              287   8e-92    
gb|ERS99131.1|  chaperone DnaK                                          296   1e-91    Sporothrix schenckii ATCC 58251
ref|XP_003709308.1|  glucose-regulated protein                          296   1e-91    Magnaporthe oryzae 70-15
gb|KIH94177.1|  heat shock 70kDa protein 5                              296   1e-91    Sporothrix brasiliensis 5110
gb|ABS87375.1|  Hsp70                                                   295   1e-91    Magnaporthe oryzae [rice blast fungus]
ref|XP_005838018.1|  heat shock protein 70                              295   2e-91    Guillardia theta CCMP2712
dbj|BAH97106.1|  luminal binding protein BiP                            287   2e-91    Cyanophora paradoxa
emb|CAA70214.1|  grp78 homologue                                        295   3e-91    Neurospora crassa
ref|XP_002615993.1|  heat shock protein SSA1                            295   3e-91    Clavispora lusitaniae ATCC 42720
dbj|BAE48210.1|  hypothetical protein                                   281   3e-91    Paralichthys olivaceus [bastard halibut]
ref|XP_008885842.1|  chaperonin protein BiP                             295   3e-91    
dbj|BAH97105.1|  luminal binding protein BiP                            286   3e-91    
gb|KKA26266.1|  hypothetical protein TD95_000026                        295   4e-91    
ref|XP_002787362.1|  heat shock protein,, putative                      284   4e-91    
gb|EIE83965.1|  heat shock 70 kDa protein                               294   5e-91    
gb|ESX02879.1|  Heat shock protein 70 2                                 294   5e-91    
dbj|BAE28883.1|  unnamed protein product                                290   5e-91    
ref|XP_005833236.1|  heat shock protein 70                              294   5e-91    
ref|XP_005833237.1|  heat shock protein 70                              293   6e-91    
ref|XP_002364404.1|  heat shock protein 70, putative                    294   6e-91    
ref|XP_005718499.1|  unnamed protein product                            294   6e-91    
ref|XP_010876087.1|  PREDICTED: 78 kDa glucose-regulated protein        293   7e-91    
gb|AAH63946.1|  Heat shock protein 5                                    293   8e-91    
gb|AAC15519.1|  heat shock protein 70                                   293   9e-91    
ref|NP_998223.1|  78 kDa glucose-regulated protein precursor            293   9e-91    
emb|CDP16233.1|  unnamed protein product                                291   1e-90    
ref|XP_004934068.1|  PREDICTED: heat shock protein 70 A2-like           278   1e-90    
ref|XP_003664039.1|  glucose-regulated protein                          293   1e-90    
ref|XP_008931816.1|  PREDICTED: heat shock cognate 71 kDa protein...    278   1e-90    
gb|AAM94003.1|  heat shock protein 70                                   279   1e-90    
gb|EPZ32455.1|  putative heat shock protein ssa1                        292   1e-90    
gb|EPS34018.1|  putative Hsp70 molecular chaperone                      293   1e-90    
gb|AAM02971.2|AF421538_1  BiP                                           293   2e-90    
ref|XP_628228.1|  heat shock protein, Hsp70                             292   2e-90    
ref|XP_001215218.1|  78 kDa glucose-regulated protein precursor         293   2e-90    
ref|XP_643155.1|  heat shock protein Hsp70 family protein               292   2e-90    
ref|XP_002949720.1|  luminal binding protein Bip2                       297   3e-90    
gb|EKC33663.1|  78 kDa glucose-regulated protein                        292   3e-90    
ref|XP_010108159.1|  Luminal-binding protein 5                          292   3e-90    
gb|ETE59912.1|  78 kDa glucose-regulated protein                        291   3e-90    
tpg|DAA24281.1|  TPA: 78 kDa glucose-regulated protein precursor        290   3e-90    
gb|KIL58290.1|  hypothetical protein M378DRAFT_170815                   292   3e-90    
ref|XP_007367087.1|  heat shock protein 70                              292   3e-90    
ref|XP_001227133.1|  hypothetical protein CHGG_09206                    292   3e-90    
ref|XP_011201513.1|  PREDICTED: heat shock 70 kDa protein cognate 3     292   3e-90    
gb|EDZ71254.1|  YJL034Wp-like protein                                   278   3e-90    
ref|XP_002743358.1|  PREDICTED: 78 kDa glucose-regulated protein        291   3e-90    
ref|XP_005998228.1|  PREDICTED: heat shock 70 kDa protein 1-like        279   3e-90    
dbj|BAO42678.1|  heat shock protein SSA3                                291   4e-90    
gb|KGK39738.1|  hypothetical protein JL09_g1001                         291   4e-90    
gb|ESA23479.1|  hypothetical protein GLOINDRAFT_342147                  291   4e-90    
ref|XP_003667561.1|  hypothetical protein NDAI_0A01600                  291   4e-90    
ref|XP_004613383.1|  PREDICTED: 78 kDa glucose-regulated protein        291   4e-90    
ref|XP_011181705.1|  PREDICTED: heat shock 70 kDa protein cognate 3     291   4e-90    
gb|AAB34280.1|  70 kda heat shock protein                               279   4e-90    
ref|XP_749594.1|  Hsp70 chaperone BiP/Kar2                              292   4e-90    
emb|CDH60531.1|  glucose-regulated protein                              292   4e-90    
ref|NP_001292291.1|  78 kDa glucose-regulated protein precursor         291   4e-90    
gb|ABE28012.1|  heat shock protein Hsp70-7                              288   5e-90    
ref|XP_003885152.1|  Heat shock protein 70 (Precursor), related         291   5e-90    
ref|XP_008040622.1|  heat shock protein 70                              292   5e-90    
ref|XP_004351156.1|  heat shock protein Hsp70 family protein            300   5e-90    
ref|XP_003940675.1|  PREDICTED: 78 kDa glucose-regulated protein        291   5e-90    
ref|XP_006744266.1|  PREDICTED: 78 kDa glucose-regulated protein ...    289   5e-90    
ref|XP_002971966.1|  hypothetical protein SELMODRAFT_96333              283   6e-90    
dbj|BAG62134.1|  unnamed protein product                                277   6e-90    
dbj|BAE31281.1|  unnamed protein product                                290   6e-90    
gb|AFM73649.1|  heat shock protein 70                                   280   6e-90    
dbj|BAK63666.1|  78 kDa glucose-regulated protein precursor             287   6e-90    
ref|XP_007395697.1|  hypothetical protein PHACADRAFT_255953             291   7e-90    
emb|CDO95025.1|  unnamed protein product                                291   7e-90    
emb|CCX06963.1|  Similar to Heat shock 70 kDa protein 2; acc. no....    291   7e-90    
ref|XP_006686275.1|  hypothetical protein CANTEDRAFT_104659             290   8e-90    
gb|KJX97885.1|  heat shock protein 70-like protein                      290   8e-90    
emb|CDS07402.1|  Putative Glucose-regulated protein                     291   9e-90    
ref|XP_008823042.1|  PREDICTED: 78 kDa glucose-regulated protein        291   9e-90    
ref|XP_004535076.1|  PREDICTED: heat shock 70 kDa protein cognate...    291   9e-90    
dbj|BAE39999.1|  unnamed protein product                                290   1e-89    
gb|EWC46399.1|  glucose-regulated-like protein                          291   1e-89    
dbj|BAE35314.1|  unnamed protein product                                290   1e-89    
dbj|BAE39187.1|  unnamed protein product                                290   1e-89    
gb|ERE71182.1|  glucose-regulated protein precursor                     290   1e-89    
ref|NP_071705.3|  78 kDa glucose-regulated protein precursor            290   1e-89    
ref|XP_005346064.1|  PREDICTED: 78 kDa glucose-regulated protein        290   1e-89    
ref|XP_003848822.1|  Hsp70 family protein                               290   1e-89    
dbj|BAE30705.1|  unnamed protein product                                290   1e-89    
emb|CAA05361.1|  BiP                                                    290   1e-89    
ref|XP_004641630.1|  PREDICTED: 78 kDa glucose-regulated protein        290   1e-89    
ref|NP_001233668.1|  78 kDa glucose-regulated protein precursor         290   1e-89    
dbj|BAB23387.1|  unnamed protein product                                290   1e-89    
gb|KFH42267.1|  78 kDa glucose-regulated protein-like protein           290   1e-89    
ref|NP_037215.1|  78 kDa glucose-regulated protein precursor            290   1e-89    
gb|ESA16542.1|  hypothetical protein GLOINDRAFT_345509                  290   1e-89    
ref|XP_004485131.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    289   2e-89    
emb|CDO70407.1|  hypothetical protein BN946_scf184999.g48               297   2e-89    
ref|XP_863385.2|  PREDICTED: 78 kDa glucose-regulated protein iso...    290   2e-89    
ref|XP_004662863.1|  PREDICTED: 78 kDa glucose-regulated protein        290   2e-89    
gb|EMD35028.1|  hypothetical protein CERSUDRAFT_116540                  290   2e-89    
gb|EPY34179.1|  heat shock 70 kDa protein                               275   2e-89    
ref|XP_007420669.1|  PREDICTED: 78 kDa glucose-regulated protein ...    290   2e-89    
ref|NP_001068616.1|  78 kDa glucose-regulated protein precursor         290   2e-89    
ref|XP_009216086.1|  glucose-regulated protein                          290   2e-89    
emb|CCG83891.1|  protein of unknown function                            290   2e-89    
ref|XP_004005686.1|  PREDICTED: 78 kDa glucose-regulated protein        290   2e-89    
gb|KGB79179.1|  glucose-regulated protein                               277   2e-89    
ref|XP_005953889.1|  PREDICTED: 78 kDa glucose-regulated protein        290   2e-89    
ref|XP_008640357.1|  PREDICTED: 78 kDa glucose-regulated protein ...    288   2e-89    
ref|XP_011127440.1|  hypothetical protein AOL_s00210g337                290   2e-89    
tpg|DAA34131.1|  TPA: heat shock protein                                276   3e-89    
ref|XP_008520162.1|  PREDICTED: 78 kDa glucose-regulated protein        289   3e-89    
gb|ESA04718.1|  hypothetical protein GLOINDRAFT_336076                  290   3e-89    
gb|ERG82498.1|  heat shock 70 kda protein c                             289   3e-89    
ref|XP_008271523.1|  PREDICTED: 78 kDa glucose-regulated protein        289   3e-89    
ref|XP_004716507.1|  PREDICTED: 78 kDa glucose-regulated protein        289   3e-89    
gb|AAA52614.1|  GRP78 precursor                                         289   3e-89    
gb|EHH24251.1|  hypothetical protein EGK_07878                          289   3e-89    
ref|NP_001269183.1|  78 kDa glucose-regulated protein precursor         289   3e-89    
ref|XP_005321021.1|  PREDICTED: 78 kDa glucose-regulated protein ...    289   3e-89    
pir||T43716  dnaK-type molecular chaperone BiP [imported] - Asper...    290   3e-89 
ref|XP_646617.1|  heat shock protein                                    289   3e-89    
ref|XP_001394413.1|  glucose-regulated protein                          290   3e-89    
ref|XP_005707456.1|  molecular chaperone DnaK                           289   3e-89    
emb|CDQ63065.1|  unnamed protein product                                289   3e-89    
gb|AAF13605.1|AF188611_1  BiP protein                                   289   3e-89    
ref|XP_008153515.1|  PREDICTED: 78 kDa glucose-regulated protein        289   3e-89    
ref|XP_002622883.1|  heat shock protein cognate 4                       289   3e-89    
ref|XP_008568189.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
ref|XP_003407784.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
ref|XP_001260092.1|  ER Hsp70 chaperone BiP, putative                   290   4e-89    
ref|XP_001272734.1|  ER Hsp70 chaperone BiP, putative                   290   4e-89    
ref|XP_002492443.1|  ATPase involved in protein folding and the r...    289   4e-89    
ref|NP_005338.1|  78 kDa glucose-regulated protein precursor            289   4e-89    
ref|XP_005881560.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
ref|XP_006834828.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
dbj|BAE31621.1|  unnamed protein product                                289   4e-89    
gb|EHH61921.1|  78 kDa glucose-regulated protein                        289   4e-89    
emb|CCE40659.1|  hypothetical protein CPAR2_106940                      289   4e-89    
ref|XP_008058392.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
ref|XP_003785350.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
gb|KFH67887.1|  glucose-regulated protein                               290   4e-89    
gb|AAW63770.1|  PPAT5                                                   289   4e-89    
gb|KIJ28212.1|  hypothetical protein M422DRAFT_270532                   290   4e-89    
ref|XP_002783461.1|  heat shock protein 70 precursor, putative          289   4e-89    
ref|XP_006892626.1|  PREDICTED: 78 kDa glucose-regulated protein        289   4e-89    
ref|XP_005082124.1|  PREDICTED: 78 kDa glucose-regulated protein ...    289   4e-89    
gb|AAW63769.1|  PPAT5                                                   289   4e-89    
ref|XP_005755726.1|  PREDICTED: 78 kDa glucose-regulated protein-...    288   4e-89    
ref|XP_004677392.1|  PREDICTED: 78 kDa glucose-regulated protein        289   5e-89    
ref|XP_001526841.1|  heat shock protein SSA2                            288   5e-89    
ref|XP_006918027.1|  PREDICTED: 78 kDa glucose-regulated protein ...    289   5e-89    
ref|XP_006158307.1|  PREDICTED: 78 kDa glucose-regulated protein        289   5e-89    
ref|XP_004593628.1|  PREDICTED: 78 kDa glucose-regulated protein        289   5e-89    
ref|XP_004392650.1|  PREDICTED: 78 kDa glucose-regulated protein        289   5e-89    
ref|XP_003470822.1|  PREDICTED: 78 kDa glucose-regulated protein        289   5e-89    
dbj|GAD97314.1|  molecular chaperone Hsp70                              288   5e-89    
ref|XP_006988789.1|  PREDICTED: 78 kDa glucose-regulated protein        289   5e-89    
gb|EFQ29972.1|  hsp70-like protein                                      288   5e-89    
ref|XP_445544.1|  hypothetical protein                                  289   5e-89    
ref|NP_001135114.1|  78 kDa glucose-regulated protein precursor         289   5e-89    
ref|XP_004888032.1|  PREDICTED: 78 kDa glucose-regulated protein        288   5e-89    
gb|KIJ60468.1|  hypothetical protein HYDPIDRAFT_160912                  289   5e-89    
ref|XP_001248723.1|  heat shock 70 kDa protein                          288   5e-89    
ref|XP_008731153.1|  chaperone DnaK                                     289   5e-89    
ref|XP_006187781.1|  PREDICTED: 78 kDa glucose-regulated protein        288   5e-89    
ref|XP_002778105.1|  heat shock protein 70 precursor, putative          288   6e-89    
ref|XP_001927830.3|  PREDICTED: 78 kDa glucose-regulated protein        289   6e-89    
ref|XP_003046172.1|  predicted protein                                  288   6e-89    
emb|CEG73733.1|  Putative KLLA0E20527p                                  288   6e-89    
dbj|BAF38391.1|  heat shock protein 70kDa                               288   6e-89    
ref|XP_007863054.1|  heat shock protein HSS1                            288   6e-89    
emb|CDJ57867.1|  heat shock protein 70, putative                        289   6e-89    
ref|NP_001274500.1|  heat shock 70kDa protein 5 (glucose-regulate...    288   6e-89    
ref|XP_003230508.1|  PREDICTED: 78 kDa glucose-regulated protein        288   6e-89    
ref|XP_007761842.1|  glucose-regulated protein                          289   6e-89    
ref|XP_004375722.1|  PREDICTED: 78 kDa glucose-regulated protein        288   6e-89    
ref|XP_011107506.1|  hypothetical protein H072_1514                     288   6e-89    
gb|AFP57558.1|  heat shock cognate protein 70                           277   6e-89    
gb|EFA80174.1|  heat shock protein Hsp70 family protein                 288   6e-89    
ref|XP_001906199.1|  hypothetical protein                               288   7e-89    
emb|CCX16990.1|  Similar to 78 kDa glucose-regulated protein homo...    288   7e-89    
gb|AHA36969.1|  heat shock protein 70b                                  288   7e-89    
ref|NP_990822.1|  78 kDa glucose-regulated protein precursor            288   7e-89    
gb|KIJ16846.1|  hypothetical protein PAXINDRAFT_162475                  288   7e-89    
gb|AER35070.1|  heat shock protein 70 family protein                    288   7e-89    
ref|XP_007194739.1|  PREDICTED: 78 kDa glucose-regulated protein ...    288   7e-89    
gb|KIW59179.1|  chaperone DnaK                                          289   7e-89    
gb|ENH61283.1|  Heat shock 70 kDa protein                               288   7e-89    
emb|CAA62478.1|  Heat shock 70 protein                                  288   7e-89    
ref|XP_002192655.1|  PREDICTED: 78 kDa glucose-regulated protein        288   8e-89    
ref|XP_004269273.1|  PREDICTED: 78 kDa glucose-regulated protein        288   8e-89    
gb|AAN52150.1|  70 kDa heat shock protein 1                             284   8e-89    
ref|XP_004313501.1|  PREDICTED: 78 kDa glucose-regulated protein        288   8e-89    
gb|EKG13266.1|  Heat shock protein Hsp70                                288   8e-89    
gb|KIV92759.1|  hsp72-like protein                                      289   8e-89    
gb|KIO06458.1|  hypothetical protein M404DRAFT_483417                   288   8e-89    
gb|EWG36868.1|  hsp70-like protein                                      288   8e-89    
ref|XP_007884368.1|  PREDICTED: heat shock 70 kDa protein 1-like        275   8e-89    
gb|EIE85693.1|  hsp71-like protein                                      288   8e-89    
gb|EPB88587.1|  heat shock protein HSS1                                 288   8e-89    
dbj|BAA11462.1|  78 kDa glucose-regulated protein                       288   9e-89    
ref|XP_005828584.1|  heat shock protein 70, ER luminal                  288   9e-89    
ref|XP_002144745.1|  Hsp70 chaperone BiP/Kar2, putative                 288   9e-89    
ref|XP_007006435.1|  hypothetical protein TREMEDRAFT_45220              289   9e-89    
ref|XP_005279468.1|  PREDICTED: 78 kDa glucose-regulated protein        288   9e-89    
gb|EMT61617.1|  Heat shock 70 kDa protein                               288   9e-89    
gb|KFX53237.1|  78 kDa glucose-regulated protein like                   288   9e-89    
gb|EGU81119.1|  hypothetical protein FOXB_08393                         288   1e-88    
ref|XP_008640356.1|  PREDICTED: 78 kDa glucose-regulated protein ...    288   1e-88    
gb|KHN87109.1|  Heat shock 70 kDa protein C                             288   1e-88    
gb|EPY25074.1|  heat-shock protein hsp70                                276   1e-88    
emb|CDQ79052.1|  unnamed protein product                                288   1e-88    
ref|XP_005146335.1|  PREDICTED: 78 kDa glucose-regulated protein        288   1e-88    
gb|KIK59750.1|  hypothetical protein GYMLUDRAFT_261751                  288   1e-88    
ref|XP_005055797.1|  PREDICTED: 78 kDa glucose-regulated protein ...    288   1e-88    
gb|KID92978.1|  78 Kda glucose-regulated protein                        288   1e-88    
gb|EIE76004.1|  hsp71-like protein                                      287   1e-88    
ref|XP_001365714.1|  PREDICTED: 78 kDa glucose-regulated protein        288   1e-88    
gb|KFO65501.1|  78 kDa glucose-regulated protein                        288   1e-88    
gb|KEQ98464.1|  hypothetical protein AUEXF2481DRAFT_46103               288   1e-88    
ref|NP_588421.1|  heat shock protein Ssa2 (predicted)                   288   1e-88    
dbj|BAD12571.1|  heat shock protein                                     288   1e-88    
gb|ACT46911.1|  heat shock 70kDa protein 5 isoform 2                    288   1e-88    
gb|AGC93283.1|  heat shock protein 70A                                  273   1e-88    
gb|KFA63583.1|  hypothetical protein S40285_04115                       288   1e-88    
ref|NP_001265730.1|  78 kDa glucose-regulated protein precursor         288   1e-88    
gb|EHN02772.1|  Ssa4p                                                   285   1e-88    
dbj|GAN04751.1|  70 kDa heat shock protein 3                            287   1e-88    
gb|KIW68420.1|  hsp72-like protein                                      288   1e-88    
dbj|BAM17830.1|  heat shock protein cognate 3                           288   1e-88    
gb|EFX88675.1|  hypothetical protein DAPPUDRAFT_304735                  288   1e-88    
ref|XP_007585452.1|  putative hsp70-like protein                        287   1e-88    



>ref|XP_009788736.1| PREDICTED: luminal-binding protein 4 [Nicotiana sylvestris]
Length=667

 Score =   414 bits (1065),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            MAGGAW RRTSLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERTIFDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKDGETK+FSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>sp|Q03684.1|BIP4_TOBAC RecName: Full=Luminal-binding protein 4; Short=BiP 4; AltName: 
Full=78 kDa glucose-regulated protein homolog 4; Short=GRP-78-4; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42659.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=667

 Score =   414 bits (1063),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            MAGGAW RRTSLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERT+FDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTVFDVKRLIGRKFDDKEVQRDM  120

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKDGETK+FSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>gb|ACK55195.1| ER luminal-binding protein [Nicotiana benthamiana]
Length=667

 Score =   412 bits (1060),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            MAGGAW RR SLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRASLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERTIFDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>ref|XP_009588550.1| PREDICTED: luminal-binding protein 4 [Nicotiana tomentosiformis]
Length=667

 Score =   412 bits (1060),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 207/218 (95%), Gaps = 0/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            MAGGAW RR SLIVFGIV+FG LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRASLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA NPERTIFDVKRLIGRKFDDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  180

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>ref|XP_009773333.1| PREDICTED: luminal-binding protein 5 [Nicotiana sylvestris]
 sp|Q03685.1|BIP5_TOBAC RecName: Full=Luminal-binding protein 5; Short=BiP 5; AltName: 
Full=78 kDa glucose-regulated protein homolog 5; Short=GRP-78-5; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42660.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=668

 Score =   407 bits (1046),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/215 (93%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW RR SLIVF IV+FGSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKRRASLIVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQRD KLV
Sbjct  63   NDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDKKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PY+IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYEIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|AGS42239.1| ER luminal-binding protein [Capsicum annuum]
Length=668

 Score =   406 bits (1043),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/214 (93%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            AW  R SL VF IV+FGSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    AWKTRASLTVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVK+KDGETKVFSPEEISAMILTKMKETAEA+LGKTIKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKVKDGETKVFSPEEISAMILTKMKETAEAYLGKTIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>emb|CDP05035.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   405 bits (1040),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW RR SLIVFGI+ FGS FAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWARRASLIVFGILFFGSFFAFSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYI+VKIKDGE KVFSPEEISAM+LTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIEVKIKDGEKKVFSPEEISAMVLTKMKETAEAYLGKPIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_009592769.1| PREDICTED: luminal-binding protein 5 [Nicotiana tomentosiformis]
Length=668

 Score =   404 bits (1038),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW RR SLIVF I++FGSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKRRASLIVFAILLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRD KLV
Sbjct  63   NDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDRKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PY+IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYEIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB39586.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=439

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_011075955.1| PREDICTED: luminal-binding protein 5 [Sesamum indicum]
Length=665

 Score =   402 bits (1032),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 204/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW  R S +VFGIV+ GSLFAFSIAKEEA+K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKTRVSTVVFGIVLIGSLFAFSIAKEEAAKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTDNERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDNERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYI+VKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIEVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYG  217



>ref|XP_004234985.1| PREDICTED: luminal-binding protein 5 [Solanum lycopersicum]
Length=668

 Score =   401 bits (1031),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 203/214 (95%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            A TRR S IVF IV+ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALTRRASSIVFAIVLLGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMKETAEAFLGKTIKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILVKMKETAEAFLGKTIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_007211088.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
 gb|EMJ12287.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
Length=667

 Score =   401 bits (1030),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB39579.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=526

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KGN50013.1| hypothetical protein Csa_5G149330 [Cucumis sativus]
Length=665

 Score =   397 bits (1021),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/214 (91%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKFDDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_006350519.1| PREDICTED: luminal-binding protein 5-like [Solanum tuberosum]
Length=668

 Score =   397 bits (1021),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            A  RR S IVF IV+ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALKRRASSIVFAIVLLGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVN+DGKPYIQVKIKDGETKVFSPEE+SAMIL KMKETAEAFLGKTIKDAVVTVPAYF
Sbjct  124  YKIVNRDGKPYIQVKIKDGETKVFSPEEVSAMILIKMKETAEAFLGKTIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_008437399.1| PREDICTED: luminal-binding protein 5 [Cucumis melo]
Length=665

 Score =   397 bits (1020),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 196/214 (92%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>emb|CAC14168.1| putative luminal binding protein [Corylus avellana]
Length=668

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILIKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|AAK21920.1|AF338252_1 BiP-isoform D [Glycine max]
Length=495

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|KJB39584.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=667

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|AAW55475.1| ER-binding protein [Malus pumila]
Length=667

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 203/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SLIV  IV FG LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_008390320.1| PREDICTED: luminal-binding protein 5 [Malus domestica]
 ref|XP_009344042.1| PREDICTED: luminal-binding protein 5 [Pyrus x bretschneideri]
Length=667

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 203/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SLIV  IV FG LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB39580.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=667

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_008239207.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=667

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|NP_001292703.1| luminal-binding protein 5 [Cucumis sativus]
 emb|CAB72128.1| heat shock protein 70 [Cucumis sativus]
Length=665

 Score =   395 bits (1014),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 200/214 (93%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKFDDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAE FLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEDFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_010266594.1| PREDICTED: luminal-binding protein 5 [Nelumbo nucifera]
Length=666

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G W +R SLIV GIV+FG L AF+IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GVWKKRGSLIVLGIVLFGCLSAFAIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLXKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KHN16716.1| Luminal-binding protein 5 [Glycine soja]
Length=726

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/221 (89%), Positives = 205/221 (93%), Gaps = 2/221 (1%)
 Frame = +2

Query  119  HRAMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQ  298
             RAMAG +W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+ 
Sbjct  57   ERAMAG-SWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNG  114

Query  299  RVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQ  478
             VEIIANDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ
Sbjct  115  HVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQ  174

Query  479  RDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAV  658
            +DMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAV
Sbjct  175  KDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAV  234

Query  659  VTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VTVPAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  235  VTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  275



>ref|XP_011084527.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=665

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GA  RR S  V GIV+ G LFAFSIAKEEA+K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GARKRRASSTVLGIVLLGCLFAFSIAKEEAAKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYI+VKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIEVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYG  217



>gb|KHG04866.1| Luminal-binding 5 [Gossypium arboreum]
Length=733

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 205/219 (94%), Gaps = 1/219 (0%)
 Frame = +2

Query  125  AMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  304
            AMAG +W  R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  66   AMAG-SWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  124

Query  305  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  484
            EIIANDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+D
Sbjct  125  EIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKD  184

Query  485  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  664
            MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVT
Sbjct  185  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVT  244

Query  665  VPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VPAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  245  VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  283



>ref|XP_009770477.1| PREDICTED: luminal-binding protein 4-like [Nicotiana sylvestris]
Length=666

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/218 (89%), Positives = 200/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            M GG W R +SL V  IV+FG L A SIAKEEA+KL TVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MGGGYWRRSSSLAVLAIVLFGCLSALSIAKEEATKLRTVIGIDLGTTYSCVGVYKNGHVE  60

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  61   IIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDM  120

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKDGE KVFSPEEISAMIL KMKETAEAFLGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMILIKMKETAEAFLGKKIKDAVVTV  180

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>ref|XP_009619852.1| PREDICTED: luminal-binding protein 4-like [Nicotiana tomentosiformis]
Length=666

 Score =   394 bits (1011),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/218 (89%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            M GG W R +SL+V  IV+FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MGGGYWRRSSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DM
Sbjct  61   IIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDM  120

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKD E KVFSPEEISAMIL KMKETAEAFLGK IKDAVVTV
Sbjct  121  KLVPYKIVNKDGKPYIQVKIKDVEVKVFSPEEISAMILIKMKETAEAFLGKKIKDAVVTV  180

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>ref|XP_008337565.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=667

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|AAA99920.1| glucose-regulated protein 78, partial [Solanum lycopersicum]
Length=375

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 199/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  140  AWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            A +RR  SL+V  IV+ G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    ACSRRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTDNERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIV+KDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PYKIVSKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KHM99873.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   393 bits (1010),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_006476337.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=667

 Score =   393 bits (1009),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NP+RTIFDVKRLIGRKFDDKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFDDKEVQRDMKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            P+KIVNKDGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_012074649.1| PREDICTED: luminal-binding protein 5 [Jatropha curcas]
 gb|KDP35832.1| hypothetical protein JCGZ_10646 [Jatropha curcas]
Length=666

 Score =   393 bits (1009),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            A  R+ SLIV  IV+FGSL A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALRRQASLIVLAIVLFGSLLAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTDNERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDNERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKI+DGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_012086670.1| PREDICTED: luminal-binding protein 5-like [Jatropha curcas]
 gb|KDP25255.1| hypothetical protein JCGZ_20411 [Jatropha curcas]
Length=665

 Score =   392 bits (1008),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R  L+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRAR-GLVVLAIVFFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_003530453.1| PREDICTED: luminal-binding protein 5 [Glycine max]
Length=667

 Score =   392 bits (1008),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_009802727.1| PREDICTED: luminal-binding protein [Nicotiana sylvestris]
Length=666

 Score =   392 bits (1007),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 205/219 (94%), Gaps = 3/219 (1%)
 Frame = +2

Query  128  MAGGAWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  304
            MAG  + RR +SL+V  IV+FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  1    MAG--YLRRGSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  58

Query  305  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  484
            EIIANDQGNRITPSWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRD
Sbjct  59   EIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRD  118

Query  485  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  664
            MKLVPYKIVNKD KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVT
Sbjct  119  MKLVPYKIVNKDSKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVT  178

Query  665  VPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VPAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  179  VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_006439283.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
 gb|ESR52523.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
Length=667

 Score =   392 bits (1007),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLA  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVN+DGKPYIQV+I+DGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNRDGKPYIQVQIRDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_009593820.1| PREDICTED: luminal-binding protein [Nicotiana tomentosiformis]
Length=668

 Score =   392 bits (1007),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 205/219 (94%), Gaps = 3/219 (1%)
 Frame = +2

Query  128  MAGGAWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  304
            MAG  + RR +SL+V  IV+FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  1    MAG--YLRRGSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  58

Query  305  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  484
            EIIANDQGNRITPSWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRD
Sbjct  59   EIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRD  118

Query  485  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  664
            MKLVPYKIVNKD KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVT
Sbjct  119  MKLVPYKIVNKDSKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVT  178

Query  665  VPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VPAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  179  VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18908.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18912.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18914.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18916.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=423

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_009358650.1| PREDICTED: luminal-binding protein 5-like [Pyrus x bretschneideri]
Length=667

 Score =   392 bits (1006),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W  R SL+V  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLVVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV F+D+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVN+DGKPYIQV+IKDGETKVFSPEE+SAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNRDGKPYIQVRIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18909.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=427

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_010107258.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC14452.1| Luminal-binding protein 5 [Morus notabilis]
Length=667

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SLIV  IV FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDDKEVQ+D+KL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDIKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            P+KIVNKDGKPYIQV IKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVNIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|AJF19166.1| endoplasmic reticulum chaperone binding protein [Lycium chinense]
Length=664

 Score =   391 bits (1005),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/218 (89%), Positives = 201/218 (92%), Gaps = 4/218 (2%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            MAGGA  R  SLIV     FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGALKRSASLIVL----FGCLFALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  56

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  57   IIANDQGNRITPSWVAFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDM  116

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTV
Sbjct  117  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTV  176

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  177  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>gb|KHG09348.1| Luminal-binding 5 [Gossypium arboreum]
Length=667

 Score =   391 bits (1005),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+   R SL+V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSGRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|AAB86942.1| endoplasmic reticulum HSC70-cognate binding protein precursor 
[Glycine max]
Length=668

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 201/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            N+QGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NNQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_007040596.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY25097.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=665

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W    SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRASGSLVVLAIVLSGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTDNERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KJB24175.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=518

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G++  R SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMK+TAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILGKMKDTAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18915.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=458

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18910.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=482

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>sp|Q42434.1|BIP_SPIOL RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Spinacia oleracea]
 gb|AAA21808.1| ER-lumenal protein [Spinacia oleracea]
 gb|AAA21806.1| ER-lumenal protein [Spinacia oleracea]
Length=668

 Score =   390 bits (1002),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 201/214 (94%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            AW  R S I FGIV+ GSLFAF  AK+EA KLGTVIGIDLGTTYSCVGVYKD +VEIIAN
Sbjct  4    AWKSRASSIAFGIVLLGSLFAFVSAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FT++ERLIGEAAKNQAA+NPERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVN+DGKPYIQVK+++GETKVFSPEEISAMILTKMKETAE FLGK IKDAVVTVPAYF
Sbjct  124  YKIVNRDGKPYIQVKVQEGETKVFSPEEISAMILTKMKETAETFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_010671405.1| PREDICTED: luminal-binding protein [Beta vulgaris subsp. vulgaris]
Length=665

 Score =   390 bits (1001),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 203/215 (94%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW  R S IV GIV+ G+LFA +IAK+EA KLGTVIGIDLGTTYSCVGVYKD +VEIIA
Sbjct  3    GAWNSRAS-IVLGIVLCGTLFALTIAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FT++ERLIGEAAKNQAA+NPERT+FDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTVFDVKRLIGRKFEDKEVQRDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQV+++DGETKVFSPEEISAMILTKMKETAE FLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVQVQDGETKVFSPEEISAMILTKMKETAETFLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_009396163.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   390 bits (1001),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = +2

Query  134  GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  313
            G +   R S+I+ G++V GSLFAFS+AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    GSSSRNRGSMILLGLLVAGSLFAFSVAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  314  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  493
            ANDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKL
Sbjct  62   ANDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  121

Query  494  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  673
            VPYKIVNKDGKPYIQVKIKDGE KVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPA
Sbjct  122  VPYKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPA  181

Query  674  YFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            YFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  182  YFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18911.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=526

 Score =   385 bits (988),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_006286332.1| hypothetical protein CARUB_v100044651mg, partial [Capsella rubella]
 gb|EOA19230.1| hypothetical protein CARUB_v100044651mg, partial [Capsella rubella]
Length=415

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|EYU19660.1| hypothetical protein MIMGU_mgv1a002500mg [Erythranthe guttata]
Length=666

 Score =   389 bits (999),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GA  RR S IVFGIV+ GSLFAF+IAKEEA K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GALKRRESSIVFGIVLIGSLFAFAIAKEEAPKIGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            P+KIVN+DGKPYI+VKIKDGETKVFSPEE+SAMIL KMKETAEA+LGK IKDAVVTVPAY
Sbjct  123  PFKIVNRDGKPYIEVKIKDGETKVFSPEEVSAMILIKMKETAEAYLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNV RIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVVRIINEPTAAAIAYG  217



>emb|CBI34546.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W RR SLIV  IV FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRRGSLIVAAIVCFGFLAAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            Y IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YNIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18913.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=505

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_002518865.1| heat shock protein, putative [Ricinus communis]
 gb|EEF43398.1| heat shock protein, putative [Ricinus communis]
Length=664

 Score =   389 bits (998),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 202/215 (94%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R + +V  IV+FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGA-VVSAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_007160200.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
 gb|ESW32194.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
Length=666

 Score =   388 bits (997),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/218 (88%), Positives = 201/218 (92%), Gaps = 2/218 (1%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            MAG   +R  SLIV  IV FG +FA SIAKEEA+KLGTVIGIDLGTTYSCVGVY++  VE
Sbjct  1    MAGSLASR--SLIVLAIVTFGCVFAISIAKEEATKLGTVIGIDLGTTYSCVGVYRNGHVE  58

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDM
Sbjct  59   IIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDM  118

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVNKDGKPYI+VKIKDGETKVFSPEE+SAMILTKMKETAEAFLGK I DAVVTV
Sbjct  119  KLVPYKIVNKDGKPYIEVKIKDGETKVFSPEEVSAMILTKMKETAEAFLGKKINDAVVTV  178

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  179  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>emb|CBI23034.3| unnamed protein product [Vitis vinifera]
Length=648

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW  R S +V GI++ G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDDKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            P+KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_002263323.1| PREDICTED: luminal-binding protein 5 [Vitis vinifera]
Length=667

 Score =   387 bits (995),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 192/214 (90%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W RR SLIV  IV FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRRGSLIVAAIVCFGFLAAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            Y IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YNIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_002276268.2| PREDICTED: luminal-binding protein 5-like isoform X2 [Vitis vinifera]
Length=667

 Score =   387 bits (995),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 199/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW  R S +V GI++ G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDDKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            P+KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PFKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KHG07305.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   387 bits (994),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G++  R SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMK+TAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILGKMKDTAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_006286341.1| hypothetical protein CARUB_v100065121mg, partial [Capsella rubella]
 gb|EOA19239.1| hypothetical protein CARUB_v100065121mg, partial [Capsella rubella]
Length=484

 Score =   381 bits (978),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|KJB24174.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=666

 Score =   387 bits (993),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G++  R SL+V  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWVGFTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL KMK+TAEAFLGK IKDAVVTVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILGKMKDTAEAFLGKKIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_004503582.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   387 bits (993),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W +  SL V  I+ FG LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSW-KCGSLFVLAIISFGCLFAISIAKEEGTKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTI+DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIRDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_011026831.1| PREDICTED: luminal-binding protein 5 [Populus euphratica]
Length=666

 Score =   386 bits (991),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G WT R  ++V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWTAR-GVVVSAIILFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNSERTIFDVKRLIGRKFEDKEVQKDMKLF  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  216



>ref|XP_002299448.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE84253.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   385 bits (990),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G WT R  ++V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWTAR-GVVVSAIILFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLF  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  216



>ref|XP_010055986.1| PREDICTED: luminal-binding protein [Eucalyptus grandis]
Length=667

 Score =   385 bits (990),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    S +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSFVVLSILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNAERTVFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>emb|CDP12195.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   385 bits (989),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 190/214 (89%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W R  S I   IV FG L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRSGSFIALAIVFFGCLSAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGE KVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KCW72555.1| hypothetical protein EUGRSUZ_E01024 [Eucalyptus grandis]
Length=719

 Score =   386 bits (992),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    S +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  56   SWRASGSFVVLSILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  115

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  116  DQGNRITPSWVAFTDGERLIGEAAKNQAAVNAERTVFDVKRLIGRKFEDKEVQKDMKLVP  175

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  176  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYF  235

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  236  NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  269



>gb|ACJ11746.1| luminal binding protein [Gossypium hirsutum]
Length=666

 Score =   384 bits (987),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>gb|KJB18907.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=666

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 189/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_006343810.1| PREDICTED: luminal-binding protein-like [Solanum tuberosum]
Length=667

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G   R  SL+V  IV+ G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GCLRRGNSLVVLTIVLLGCLSALSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTDNERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKI++KDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PYKIISKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_002303672.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE78651.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G W  R + +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWRARGA-VVSAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_011022455.1| PREDICTED: luminal-binding protein 5-like [Populus euphratica]
Length=666

 Score =   384 bits (985),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 200/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G W  R + +V  I++FG LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWRARGA-VVSAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|EYU25251.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=667

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/216 (87%), Positives = 200/216 (93%), Gaps = 2/216 (1%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIA--KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  313
            AW RR S I+F  V+ GSLFAFSIA  +EEA K+GTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  4    AWKRRASSIIFAFVLIGSLFAFSIAAEEEEAPKVGTVIGIDLGTTYSCVGVYKNGHVEII  63

Query  314  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  493
            ANDQGNRITPSWVGFTD+ERLIGEAAKNQ A NPERT+FDVKRLIGRKF+DKEVQ+DMKL
Sbjct  64   ANDQGNRITPSWVGFTDSERLIGEAAKNQFAVNPERTVFDVKRLIGRKFEDKEVQKDMKL  123

Query  494  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  673
            VPYKIVN+DGKPYIQVKI+DGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPA
Sbjct  124  VPYKIVNRDGKPYIQVKIRDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPA  183

Query  674  YFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            YFNDAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  184  YFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYG  219



>ref|XP_006405286.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
 dbj|BAJ34315.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46739.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
Length=669

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDKKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|NP_001234636.1| luminal-binding protein precursor [Solanum lycopersicum]
 sp|P49118.1|BIP_SOLLC RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34139.1| glucose-regulated protein 78 [Solanum lycopersicum]
Length=666

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 199/215 (93%), Gaps = 1/215 (0%)
 Frame = +2

Query  140  AWTRR-TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            A +RR  SL+V  IV+ G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    ACSRRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTDNERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIV+KDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY
Sbjct  123  PYKIVSKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|NP_199017.2| Luminal-binding protein 2 [Arabidopsis thaliana]
 gb|AED94756.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=613

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +2

Query  158  SLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  9    STVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  68

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNK
Sbjct  69   TPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNK  128

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
            DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  129  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  188

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  189  ATKDAGVIAGLNVARIINEPTAAAIAYG  216



>dbj|BAA12348.1| luminal binding protein (BiP) [Arabidopsis thaliana]
Length=668

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = +2

Query  155  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
             S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  695  QATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  QATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|NP_851119.1| Luminal-binding protein 2 [Arabidopsis thaliana]
 sp|Q39043.2|MD37F_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37f; AltName: Full=Heat shock 70 kDa protein 12; AltName: 
Full=Heat shock protein 70-12; Short=AtHsp70-12; AltName: 
Full=Luminal-binding protein 2; Short=AtBP2; Short=BiP2; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB08435.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAO00752.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAP37765.1| At5g42020 [Arabidopsis thaliana]
 gb|AED94755.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=668

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = +2

Query  155  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
             S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  695  QATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  QATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_004300491.1| PREDICTED: luminal-binding protein [Fragaria vesca subsp. vesca]
Length=667

 Score =   383 bits (983),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 197/215 (92%), Gaps = 0/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W  R SLIV  IV  G LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARNSLIVLAIVTLGCLFAISIAKEETAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA N ERT+FDVKRLIGRKF DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNHERTVFDVKRLIGRKFADKEVQRDMKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            P+KIVN+DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I++AVVTVPAY
Sbjct  123  PFKIVNQDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKIQNAVVTVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_010918502.1| PREDICTED: luminal-binding protein 4-like [Elaeis guineensis]
Length=664

 Score =   382 bits (982),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R+S I+ G+++ G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  8    RSSGIMLGLLLTGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  67

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV F D ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDDKEVQRD+KLVPYKIV
Sbjct  68   RITPSWVAFADTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDKEVQRDIKLVPYKIV  127

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKI+DGE KVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQ
Sbjct  128  NKDGKPYIQVKIRDGEVKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQ  187

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  188  RQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_006401475.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
 gb|ESQ42928.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
Length=668

 Score =   382 bits (980),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEANKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRK++DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKYEDKEVQKDKKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>emb|CDX79726.1| BnaC03g20620D [Brassica napus]
Length=642

 Score =   381 bits (978),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|KFK32162.1| hypothetical protein AALP_AA6G205800 [Arabis alpina]
Length=663

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  167  VFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  346
            V   +  G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  7    VLAFIFLGCLFAISIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  66

Query  347  WVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGK  526
            WVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVPYKIVNKDGK
Sbjct  67   WVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKDGK  126

Query  527  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATK  706
            PYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATK
Sbjct  127  PYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATK  186

Query  707  DAGIIAGLNVARIINEPTAAAIAYG  781
            DAG+IAGLNVARIINEPTAAAIAYG
Sbjct  187  DAGVIAGLNVARIINEPTAAAIAYG  211



>gb|KEH21274.1| heat shock 70 kDa protein [Medicago truncatula]
Length=668

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 199/218 (91%), Gaps = 1/218 (0%)
 Frame = +2

Query  128  MAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  307
            M  G+W +R SL V  I+  G LFA S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MMAGSW-KRGSLFVLAIISIGCLFACSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  59

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIANDQGNRITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  60   IIANDQGNRITPSWVSFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDM  119

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KLVPYKIVN+DGKPYIQV++KDGETKVFSPEEISAMIL KMKETAE FLGKTI+DAVVTV
Sbjct  120  KLVPYKIVNRDGKPYIQVRVKDGETKVFSPEEISAMILGKMKETAEGFLGKTIRDAVVTV  179

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  180  PAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>dbj|BAA13948.1| luminal binding protein [Arabidopsis thaliana]
Length=668

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = +2

Query  155  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
             S +V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKET EA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETTEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  695  QATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  QATKDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_009132761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=669

 Score =   381 bits (978),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>emb|CDY23972.1| BnaC03g17190D [Brassica napus]
 emb|CDX84809.1| BnaA03g14210D [Brassica napus]
Length=642

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|AAA81953.1| BiP isoform C, partial [Glycine max]
Length=455

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGT+  IDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTLSAIDLGTTYSCVGVYKNGHVEIIA  61

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM+L KMKETAEAFLGK I DAVVTVPAY
Sbjct  122  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMVLIKMKETAEAFLGKKINDAVVTVPAY  181

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIIN P AAA A G
Sbjct  182  FNDAQRQATKDAGVIAGLNVARIINNPLAAADAIG  216



>ref|XP_002887878.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64137.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   380 bits (976),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I + G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  6    LVLAIFLLGCLFAISIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  65

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVPYKIVNK+G
Sbjct  66   SWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKEG  125

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  126  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  185

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  186  KDAGVIAGLNVARIINEPTAAAIAYG  211



>ref|XP_002868566.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44825.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_010436161.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X2 [Camelina sativa]
Length=668

 Score =   380 bits (977),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  167  VFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  346
            V  I+ FG LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  12   VLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  71

Query  347  WVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGK  526
            WVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDGK
Sbjct  72   WVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGK  131

Query  527  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATK  706
            PYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATK
Sbjct  132  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATK  191

Query  707  DAGIIAGLNVARIINEPTAAAIAYG  781
            DAG+IAGLNVARIINEPTAAAIAYG
Sbjct  192  DAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_008796727.1| PREDICTED: luminal-binding protein 5 [Phoenix dactylifera]
Length=664

 Score =   380 bits (976),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = +2

Query  158  SLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            S I+ GI++ G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  10   SAILLGILLSGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  69

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRD+KLVPYKIVNK
Sbjct  70   TPSWVAFTDSERLIGEAAKNQAALNAERTIFDVKRLIGRKFEDKEVQRDIKLVPYKIVNK  129

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
            DGKPYIQVKI+DGE KVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  130  DGKPYIQVKIRDGEVKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  189

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  190  ATKDAGIIAGLNVARIINEPTAAAIAYG  217



>emb|CDY63497.1| BnaC07g48050D [Brassica napus]
Length=642

 Score =   379 bits (974),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FGSLFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGSLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD+ERLIGEAAKNQA  NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_010473721.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   380 bits (975),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/211 (88%), Positives = 199/211 (94%), Gaps = 2/211 (1%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            R T L+ F  V+ G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RNTVLLAF--VLLGCLFAASIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQG  60

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+DMKLVPYKI
Sbjct  61   NRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKI  120

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNK+GKPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  121  VNKEGKPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDA  180

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  QRQATKDAGVIAGLNVARIINEPTAAAIAYG  211



>ref|XP_010430591.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   379 bits (974),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 199/211 (94%), Gaps = 2/211 (1%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            R T L+ F  ++ G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RDTVLLAF--ILLGCLFAVSIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQG  60

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWVGFTD+ERLIGEAAKNQAA NP+RT+FDVKRLIGRKFDDKEVQ+DMKLVPYKI
Sbjct  61   NRITPSWVGFTDSERLIGEAAKNQAAVNPDRTVFDVKRLIGRKFDDKEVQKDMKLVPYKI  120

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNK+GKPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  121  VNKEGKPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDA  180

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  181  QRQATKDAGVIAGLNVARIINEPTAAAIAYG  211



>ref|XP_004503579.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   379 bits (974),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = +2

Query  176  IVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  355
            I+ FG LFAFS AKEE SKLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV 
Sbjct  15   IISFGCLFAFSAAKEEGSKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVA  74

Query  356  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  535
            FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYI
Sbjct  75   FTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYI  134

Query  536  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  715
            QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTI+DAVVTVPAYFNDAQRQATKDAG
Sbjct  135  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIRDAVVTVPAYFNDAQRQATKDAG  194

Query  716  IIAGLNVARIINEPTAAAIAYG  781
            +IAGLNVARIINEPTAAAIAYG
Sbjct  195  VIAGLNVARIINEPTAAAIAYG  216



>gb|AAZ95244.1| putative luminal-binding protein [Isatis tinctoria]
Length=668

 Score =   379 bits (974),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LFA   AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFALCTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_010446984.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010447007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010436160.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X1 [Camelina sativa]
Length=668

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  167  VFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  346
            V  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  12   VLAIIFLGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  71

Query  347  WVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGK  526
            WVGFTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDGK
Sbjct  72   WVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGK  131

Query  527  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATK  706
            PYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATK
Sbjct  132  PYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATK  191

Query  707  DAGIIAGLNVARIINEPTAAAIAYG  781
            DAG+IAGLNVARIINEPTAAAIAYG
Sbjct  192  DAGVIAGLNVARIINEPTAAAIAYG  216



>gb|KDO76632.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=409

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  734  VARIINEPTAAAIAYG  781
            VARIINEPTAAAIAYG
Sbjct  182  VARIINEPTAAAIAYG  197



>dbj|BAD95470.1| BiP [Glycine max]
Length=668

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = +2

Query  152  RTSLIVFGIVV-FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            R SL+   I+V  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  7    RGSLLPLAIIVSLGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  66

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD+ERLIGEAAKN AA NPER IFDVKRLIGRKF+DKEVQRDMKLVPYKI
Sbjct  67   NRITPSWVAFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKLVPYKI  126

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDA
Sbjct  127  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDA  186

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  187  QRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KHN16714.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 195/211 (92%), Gaps = 1/211 (0%)
 Frame = +2

Query  152  RTSLIVFGIVV-FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            R SL+   I+V  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  7    RGSLLPLAIIVSLGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  66

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD+ERLIGEAAKN AA NPER IFDVKRLIGRKF+DKEVQRDMKLVPYKI
Sbjct  67   NRITPSWVAFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKLVPYKI  126

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDA
Sbjct  127  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDA  186

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  187  QRQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>emb|CDY46766.1| BnaA03g17100D [Brassica napus]
Length=642

 Score =   377 bits (968),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            IV  I+  G +FAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   IVLAIIFVGCVFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWVGFTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KDG
Sbjct  71   SWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|KHM99871.1| Luminal-binding protein 4 [Glycine soja]
Length=668

 Score =   377 bits (969),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R SL+   IV    LF  SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  9    RGSLLPLAIVSLVCLFVISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  68

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  69   RITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  128

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDAQ
Sbjct  129  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDAQ  188

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  189  RQATKDAGVIAGLNVARIINEPTAAAIAYG  218



>gb|ACF86491.1| unknown [Zea mays]
 gb|AFW66784.1| luminal-binding protein 3 Precursor [Zea mays]
Length=663

 Score =   377 bits (968),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>ref|NP_001045675.1| Os02g0115900 [Oryza sativa Japonica Group]
 dbj|BAD07938.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAD07713.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAF07589.1| Os02g0115900 [Oryza sativa Japonica Group]
 gb|EAY84196.1| hypothetical protein OsI_05577 [Oryza sativa Indica Group]
 gb|EAZ21491.1| hypothetical protein OsJ_05115 [Oryza sativa Japonica Group]
 gb|ACA50500.1| dnak-type molecular chaperone Bip [Oryza sativa Japonica Group]
Length=665

 Score =   377 bits (968),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R    + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>ref|NP_001105894.1| luminal-binding protein 3 precursor [Zea mays]
 sp|O24581.1|BIP3_MAIZE RecName: Full=Luminal-binding protein 3; Short=BiP3; Flags: Precursor 
[Zea mays]
 gb|AAC49900.1| lumenal binding protein cBiPe3 [Zea mays]
Length=663

 Score =   377 bits (968),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>gb|AGT16206.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   377 bits (967),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKITDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>gb|AGT15890.1| luminal-binding protein [Saccharum hybrid cultivar R570]
 gb|AGT16047.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   377 bits (967),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKITDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>ref|NP_198206.1| Luminal-binding protein 1 [Arabidopsis thaliana]
 sp|Q9LKR3.1|MD37A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37a; AltName: Full=Heat shock 70 kDa protein 11; AltName: 
Full=Heat shock protein 70-11; Short=AtHsp70-11; AltName: 
Full=Luminal-binding protein 1; Short=AtBP1; Short=BiP1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF88019.1| Hypothetical protein T26D3.10 [Arabidopsis thaliana]
 gb|AAN17430.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN65099.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93812.1| Luminal-binding protein 1 [Arabidopsis thaliana]
Length=669

 Score =   377 bits (968),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = +2

Query  155  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
             S +V  I+ FG LFA S A EEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  695  QATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  QATKDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|AGT16055.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
 gb|AGT16312.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
Length=664

 Score =   377 bits (967),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKITDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>gb|KDO76630.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=494

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  734  VARIINEPTAAAIAYG  781
            VARIINEPTAAAIAYG
Sbjct  182  VARIINEPTAAAIAYG  197



>ref|XP_003525327.2| PREDICTED: luminal-binding protein [Glycine max]
Length=701

 Score =   377 bits (969),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R SL+   IV    LF  SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  42   RGSLLPLAIVSLVCLFVISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  101

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  102  RITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  161

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDAQ
Sbjct  162  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDAQ  221

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  222  RQATKDAGVIAGLNVARIINEPTAAAIAYG  251



>ref|NP_001105893.1| luminal-binding protein 2 precursor [Zea mays]
 ref|NP_001278725.1| NHP2-like protein 1 precursor [Zea mays]
 sp|P24067.3|BIP2_MAIZE RecName: Full=Luminal-binding protein 2; Short=BiP2; AltName: 
Full=B-70; Short=B70; AltName: Full=Heat shock protein 70 homolog 
2; Flags: Precursor [Zea mays]
 gb|AAC49899.1| lumenal binding protein cBiPe2 [Zea mays]
 gb|ACF86383.1| unknown [Zea mays]
 gb|AEW66883.1| ER luminal binding protein [Zea mays]
 gb|AFW69798.1| binding protein-like protein [Zea mays]
Length=663

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKII  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>emb|CDX77423.1| BnaA07g05610D [Brassica napus]
Length=642

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LF FS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFTFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD+ERLIGEAAKNQA  NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>ref|XP_006827760.1| PREDICTED: luminal-binding protein [Amborella trichopoda]
 gb|ERM95176.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
Length=665

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 194/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R SL+V  ++  G LFAF +AKEEA+KLGTVIGIDLGTTYSCVGVYK   VEIIANDQGN
Sbjct  8    RGSLMVLALIASGCLFAFVVAKEEATKLGTVIGIDLGTTYSCVGVYKSGHVEIIANDQGN  67

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIV
Sbjct  68   RITPSWVAFTDTERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  127

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPY+QVK+KDG+TKVFSPEEISAM+L KMKETAE+FLGK IKDAVVTVPAYFNDAQ
Sbjct  128  NKDGKPYVQVKMKDGDTKVFSPEEISAMVLIKMKETAESFLGKDIKDAVVTVPAYFNDAQ  187

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  RQATKDAGVIAGLNVARIINEPTAAAIAYG  217



>gb|KDO76631.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=487

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  734  VARIINEPTAAAIAYG  781
            VARIINEPTAAAIAYG
Sbjct  182  VARIINEPTAAAIAYG  197



>ref|XP_009102505.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Brassica rapa]
Length=666

 Score =   375 bits (963),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V  I+ FG LF FS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VVLAIIFFGCLFTFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  70

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD+ERLIGEAAKNQA  NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDG  130

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVKIKDGETKVFSPEE+SAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  131  KPYIQVKIKDGETKVFSPEEVSAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  190

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  191  KDAGVIAGLNVARIINEPTAAAIAYG  216



>gb|EPS69483.1| luminal-binding protein 5, partial [Genlisea aurea]
Length=661

 Score =   374 bits (959),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            A   RTS IV GIV+ G   A SIA +EA KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  2    ALKMRTSTIVLGIVLIGCFLATSIAVDEAPKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  61

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  62   DQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  121

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNK+GKPYI+V+IKDGE KVFSPEEISAM+L KMKETAEA+LGK IKDAVVTVPAYF
Sbjct  122  YKIVNKEGKPYIEVQIKDGERKVFSPEEISAMVLIKMKETAEAYLGKKIKDAVVTVPAYF  181

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAG+IAGLNV RIINEPTAAAIAYG
Sbjct  182  NDAQRQATKDAGVIAGLNVVRIINEPTAAAIAYG  215



>ref|XP_004952156.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=665

 Score =   374 bits (959),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPY IV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYNIV  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NK+GKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKEGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>ref|XP_006648229.1| PREDICTED: luminal-binding protein 2-like [Oryza brachyantha]
Length=665

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R    + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF DKEVQRDMKLVPY+IV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYQIV  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKI+DGE KVFSPEEISAMIL KMK+TAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKDGKPYIQVKIRDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>dbj|BAA13947.1| luminal binding protein [Arabidopsis thaliana]
Length=669

 Score =   372 bits (954),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +2

Query  155  TSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
             S +V  I+ FG LFA S A EEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPSWVGFTD+ERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQR
Sbjct  128  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQR  187

Query  695  QATKDAGIIAGLNVARIINEPTAAAIA  775
            QATKDAG+IAGLNVARIINEPTAAAIA
Sbjct  188  QATKDAGVIAGLNVARIINEPTAAAIA  214



>ref|XP_010662895.1| PREDICTED: luminal-binding protein 5-like isoform X1 [Vitis vinifera]
Length=697

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 199/245 (81%), Gaps = 30/245 (12%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GAW  R S +V GI++ G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDDKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP--  670
            P+KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  
Sbjct  123  PFKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPGN  182

Query  671  ----------------------------AYFNDAQRQATKDAGIIAGLNVARIINEPTAA  766
                                        AYFNDAQRQATKDAGIIAGLNVARIINEPTAA
Sbjct  183  VKQFDLMDEVNCCFSVEMTYVSILTTSTAYFNDAQRQATKDAGIIAGLNVARIINEPTAA  242

Query  767  AIAYG  781
            AIAYG
Sbjct  243  AIAYG  247



>ref|XP_010545034.1| PREDICTED: luminal-binding protein 4 [Tarenaya hassleriana]
Length=665

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +   IV FG L+A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITP
Sbjct  11   VALAIVFFGCLYA-SIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITP  69

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGR+F DKEVQRDMKL+PYKIVNKDG
Sbjct  70   SWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRQFTDKEVQRDMKLMPYKIVNKDG  129

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQV  KDGETK+FSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQAT
Sbjct  130  KPYIQVNFKDGETKIFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQAT  189

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  190  KDAGVIAGLNVARIINEPTAAAIAYG  215



>gb|KDO76629.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=647

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIGEAAKNQAA NP+RTIFDVKRLIGRKF+DKEVQRDMKL PYKIVN+DGKPYIQV+I+D
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIRD  121

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GETKVFSPEEISAMILTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  122  GETKVFSPEEISAMILTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  181

Query  734  VARIINEPTAAAIAYG  781
            VARIINEPTAAAIAYG
Sbjct  182  VARIINEPTAAAIAYG  197



>ref|XP_009392825.1| PREDICTED: luminal-binding protein 2 [Musa acuminata subsp. malaccensis]
Length=668

 Score =   370 bits (951),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S+I+ G+++ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  8    RGSVILLGLLLAGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  67

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGR+F+DKEVQRDMKLVPYKIV
Sbjct  68   RITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRRFEDKEVQRDMKLVPYKIV  127

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVKIKDGE KVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAYFNDAQ
Sbjct  128  NKDGKPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAYFNDAQ  187

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  188  RQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>ref|XP_009418642.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FAFSIAKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERL
Sbjct  22   FAFSIAKEEAIKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERL  81

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+NKDGKPYIQVKIKDG
Sbjct  82   IGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIINKDGKPYIQVKIKDG  141

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            E KVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAGIIAGLNV
Sbjct  142  EVKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  201

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  202  ARIINEPTAAAIAYG  216



>gb|AAB63469.1| endosperm lumenal binding protein [Oryza sativa]
Length=663

 Score =   370 bits (949),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R S  + G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTD+ERLIGEAAKNQAA NPERTIFDVKR IGRKF++KEVQRDMKLVPYKIV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRDIGRKFEEKEVQRDMKLVPYKIV  124

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NK GKPYIQVKIKDGE KVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQ
Sbjct  125  NKIGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQ  184

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  185  RQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>ref|XP_002317789.2| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE96009.2| BiP isoform A family protein [Populus trichocarpa]
Length=668

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            R  S +V  I + GSL   SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  8    RAGSFMVVAIFLLGSLLTVSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  67

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD+ERLIGEAAKNQAA+NPERTIFDVKRLIGR + DKEVQ+DMKL PYKI
Sbjct  68   NRITPSWVAFTDSERLIGEAAKNQAAANPERTIFDVKRLIGRVYGDKEVQKDMKLFPYKI  127

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNKDGKPYI+VKIKDGETKVFSPEEISAM++TKMKETAEAFLGK IKDAV+TVPAYFNDA
Sbjct  128  VNKDGKPYIEVKIKDGETKVFSPEEISAMVITKMKETAEAFLGKKIKDAVITVPAYFNDA  187

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAG+ VARIINEPTAAAIAYG
Sbjct  188  QRQATKDAGVIAGVRVARIINEPTAAAIAYG  218



>ref|NP_001238736.1| BiP isoform B precursor [Glycine max]
 gb|AAA81954.1| BiP isoform B [Glycine max]
Length=666

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/215 (88%), Positives = 195/215 (91%), Gaps = 4/215 (2%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            G+W RR SLIV  I+ FG LFA SIAKEEA+KLGTVIGIDL TTYSCVGV     VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDL-TTYSCVGVT--DAVEIIA  58

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAK  AA NP RTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  59   NDQGNRITPSWVAFTDSERLIGEAAKIVAAVNPVRTIFDVKRLIGRKFEDKEVQRDMKLV  118

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAVVTVPAY
Sbjct  119  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAVVTVPAY  178

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  179  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  213



>ref|XP_003573226.1| PREDICTED: luminal-binding protein 3 [Brachypodium distachyon]
Length=665

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FAFS AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD+ERL
Sbjct  20   FAFSAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKLVPYKIVN+DGKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNRDGKPYIQVKIKDG  139

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            E KVFSPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ENKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  200  ARIINEPTAAAIAYG  214



>gb|KFK32977.1| hypothetical protein AALP_AA6G313600 [Arabis alpina]
Length=662

 Score =   367 bits (943),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 192/202 (95%), Gaps = 1/202 (0%)
 Frame = +2

Query  179  VVFGSLFAFSIAKEE-ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  355
            +VF   FAFS AKEE A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVG
Sbjct  12   IVFFLGFAFSNAKEEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVG  71

Query  356  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  535
            FTD+ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNKDGKPYI
Sbjct  72   FTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYEIVNKDGKPYI  131

Query  536  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  715
            QVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAG
Sbjct  132  QVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAG  191

Query  716  IIAGLNVARIINEPTAAAIAYG  781
            +IAGLNVARIINEPTAAAIAYG
Sbjct  192  VIAGLNVARIINEPTAAAIAYG  213



>emb|CDX67525.1| BnaA07g15650D [Brassica napus]
Length=577

 Score =   364 bits (935),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 192/208 (92%), Gaps = 3/208 (1%)
 Frame = +2

Query  167  VFGIVVFGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            V  I+ FG LFA FS AKEE   +KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  8    VLAIIFFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  67

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPSWV FTD+ RLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNK
Sbjct  68   TPSWVAFTDSARLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNK  127

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
            DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  128  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  187

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  ATKDAGVIAGLNVARIINEPTAAAIAYG  215



>gb|KEH21282.1| heat shock cognate 70 kDa-like protein [Medicago truncatula]
Length=669

 Score =   367 bits (942),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = +2

Query  158  SLIVFGIVVFGSLFAFSIAKEEAS-KLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
            S+++  I+    LFA S AKEE + KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  9    SVLLLTIISLVCLFATSAAKEEGTTKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  68

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPSWV FTD+ERLIGEAAKN AA NPERTIFDVKRLIGRKF DKEVQRDMKLVPYKIVN
Sbjct  69   ITPSWVSFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKIVN  128

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            KDGKPYIQV++KDGETKVFSPEE+SAMILTKMKETAEAFLGKTI+DAVVTVPAYFNDAQR
Sbjct  129  KDGKPYIQVRVKDGETKVFSPEEVSAMILTKMKETAEAFLGKTIRDAVVTVPAYFNDAQR  188

Query  695  QATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  189  QATKDAGVIAGLNVARIINEPTAAAIAYG  217



>ref|XP_010934830.1| PREDICTED: luminal-binding protein 4 [Elaeis guineensis]
Length=661

 Score =   366 bits (940),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/211 (89%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            R  S+I+ G+ + G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RSRSVILLGLFITGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  62

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD+ERLIGEAAKNQAA+N ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI
Sbjct  63   NRITPSWVAFTDSERLIGEAAKNQAAANAERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  122

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNKDGKPYIQVKIK+GE KVFSPEE+SAM+LTKMKETAEAFLGK IKDAVVTVPAYFNDA
Sbjct  123  VNKDGKPYIQVKIKEGEVKVFSPEEVSAMVLTKMKETAEAFLGKKIKDAVVTVPAYFNDA  182

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  213



>gb|AAA62325.1| HSP70 [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   363 bits (931),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDM+LVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMRLVPYKIVNKEGKPYIQVKIKDG  139

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            ETKVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  200  ARIINEPTAAAIAYG  214



>gb|EMT16454.1| Luminal-binding protein 4 [Aegilops tauschii]
 gb|AGN94840.1| ER molecular chaperone [Triticum aestivum]
 gb|AGN94842.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   364 bits (934),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            ETKVFSPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  200  ARIINEPTAAAIAYG  214



>gb|KHG03675.1| Luminal-binding 5 [Gossypium arboreum]
 gb|KHG17377.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   363 bits (933),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 188/214 (88%), Positives = 197/214 (92%), Gaps = 0/214 (0%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +W    SL+V  IV+ G  FA +IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVVLAIVLSGCFFAIAIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YKIVNKD KPYIQVKIKDGETKVFSPEEISAM+LTKMKETAEAFLGK IKDAVVTVPAYF
Sbjct  124  YKIVNKDDKPYIQVKIKDGETKVFSPEEISAMVLTKMKETAEAFLGKKIKDAVVTVPAYF  183

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  217



>dbj|BAJ85675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   363 bits (933),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            ETKVFSPEE+SAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  200  ARIINEPTAAAIAYG  214



>gb|EMS58484.1| Luminal-binding protein 3 [Triticum urartu]
Length=709

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            ETKVFSPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEISAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNV  199

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  200  ARIINEPTAAAIAYG  214



>ref|XP_009125214.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=665

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 191/208 (92%), Gaps = 3/208 (1%)
 Frame = +2

Query  167  VFGIVVFGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            V  I+ FG LFA FS AKEE   +KLGTVIGIDLGTTYSCVG YK+  VEIIANDQGNRI
Sbjct  8    VLAIIFFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGAYKNGHVEIIANDQGNRI  67

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPSWV FTD+ RLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+D KLVPY+IVNK
Sbjct  68   TPSWVDFTDSARLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNK  127

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
            DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAVVTVPAYFNDAQRQ
Sbjct  128  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQ  187

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  188  ATKDAGVIAGLNVARIINEPTAAAIAYG  215



>gb|AGN94841.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVGFTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQRDMKLVPYKIVNK+GKPYIQVKIKDG
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIKDG  139

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            ETKVFSPEEISAMIL KMKETAEA+LGK I D VVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  140  ETKVFSPEEISAMILGKMKETAEAYLGKKINDTVVTVPAYFNDAQRQATKDAGVIAGLNV  199

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  200  ARIINEPTAAAIAYG  214



>ref|XP_001774724.1| predicted protein [Physcomitrella patens]
 gb|EDQ60395.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R +L+V G++    +     A EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RHTLLVLGLLFAAGVAGSFGAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  62

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FTDNERLIGEAAKNQAA NPERT+FDVKRLIGRKF+DKEVQ+D+KL PYKIV
Sbjct  63   RITPSWVAFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDIKLFPYKIV  122

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKP+IQVK+KDGE KVF+PEEISAM+L KMKETAEA+LGK IKDAVVTVPAYFNDAQ
Sbjct  123  NKDGKPHIQVKVKDGEVKVFTPEEISAMVLVKMKETAEAYLGKKIKDAVVTVPAYFNDAQ  182

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  RQATKDAGVIAGLNVARIINEPTAAAIAYG  212



>ref|XP_010259649.1| PREDICTED: luminal-binding protein 4-like [Nelumbo nucifera]
Length=661

 Score =   358 bits (918),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 192/215 (89%), Gaps = 2/215 (1%)
 Frame = +2

Query  137  GAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            GA  R T+L+V   + F  L   ++A EE+ KLGTVIGIDLGTTYSCVGVY++  VEIIA
Sbjct  2    GAKYRATALLVLFAMEF--LLGLAVASEESPKLGTVIGIDLGTTYSCVGVYRNGHVEIIA  59

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD+ERLIGEAAKNQA+ N ERTIFDVKRLIGRKFDD EVQRD+K +
Sbjct  60   NDQGNRITPSWVAFTDSERLIGEAAKNQASLNAERTIFDVKRLIGRKFDDPEVQRDIKFL  119

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYK+VNKDGKPYIQVKI+DGETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAY
Sbjct  120  PYKVVNKDGKPYIQVKIRDGETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAY  179

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  180  FNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>emb|CAA89834.2| luminal binding protein [Pseudotsuga menziesii]
Length=675

 Score =   356 bits (913),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +2

Query  161  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  340
            + +   +  G LF+  IA EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  21   MFLAAFITAGFLFSSVIAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  80

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRK++DKEVQ+D+KL+PYKIVNKD
Sbjct  81   PSWVAFTDTERLIGEAAKNQAAMNPERTVFDVKRLIGRKYEDKEVQKDIKLLPYKIVNKD  140

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
            GKPYIQVKI+DGE KVFSPEEISAMIL KMKETAE++LG+ IKDAVVTVPAYFNDAQRQA
Sbjct  141  GKPYIQVKIRDGEIKVFSPEEISAMILLKMKETAESYLGRKIKDAVVTVPAYFNDAQRQA  200

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  201  TKDAGVIAGLNVARIINEPTAAAIAYG  227



>gb|ABR18447.1| unknown [Picea sitchensis]
Length=687

 Score =   354 bits (908),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +2

Query  161  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  340
            + +   ++ G L +  IA EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  31   MFLAAFIIAGFLVSSVIAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  90

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PSWV FTD ERLIGEAAKNQAA NPERT+FDVKRLIGRK++DKEVQRD+KL+PYKIVNKD
Sbjct  91   PSWVAFTDTERLIGEAAKNQAAMNPERTVFDVKRLIGRKYEDKEVQRDVKLLPYKIVNKD  150

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
            GKPYIQVKI+D E KVFSPEEISAMIL KMKETAE++LGK IKDAVVTVPAYFNDAQRQA
Sbjct  151  GKPYIQVKIRDDEIKVFSPEEISAMILLKMKETAESYLGKKIKDAVVTVPAYFNDAQRQA  210

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  211  TKDAGVIAGLNVARIINEPTAAAIAYG  237



>ref|XP_006838409.1| PREDICTED: luminal-binding protein [Amborella trichopoda]
 gb|ERN00978.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
Length=671

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 189/211 (90%), Gaps = 1/211 (0%)
 Frame = +2

Query  152  RTSLIVFGIVVF-GSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            ++S+++  ++   G +F   +  EEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  13   KSSILILSVIFLSGFVFESFVKAEEAPKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  72

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD ERL+GEAAKNQAA NPERTIFDVKRLIGR+F DKEVQRDMK +PYK+
Sbjct  73   NRITPSWVAFTDTERLVGEAAKNQAALNPERTIFDVKRLIGRRFSDKEVQRDMKFLPYKV  132

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNKDGKPYI+VKI++ E KVFSPEEISAMIL KMKETAE++LGKTIKDAVVTVPAYFNDA
Sbjct  133  VNKDGKPYIEVKIRENEVKVFSPEEISAMILGKMKETAESYLGKTIKDAVVTVPAYFNDA  192

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  193  QRQATKDAGVIAGLNVARIINEPTAAAIAYG  223



>ref|NP_001290009.1| mediator of RNA polymerase II transcription subunit 37a precursor 
[Vitis vinifera]
 gb|AFJ20202.1| putative luminal-binding protein [Vitis vinifera]
Length=660

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            +  ++++  + V   LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNRAVMILQLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIANDQG  63

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKV  123

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNK+GKPYIQVKI+DGE KVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  124  VNKEGKPYIQVKIRDGEIKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDA  183

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  214



>ref|NP_001234941.1| BiP isoform A [Glycine max]
 gb|AAA81956.1| BiP isoform A [Glycine max]
Length=664

 Score =   351 bits (901),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 191/216 (88%), Gaps = 7/216 (3%)
 Frame = +2

Query  140  AWTRRTSLIVFGIVV-FGSLFA-FSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  313
            +++R +S     I+V  G LF  FSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  4    SFSRGSSCFPLAIIVSLGCLFRDFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  63

Query  314  ANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKL  493
            ANDQGNRITPSW  FTD+ERLIGEAAKN AA NPER IFDVKRLIGRKF+DKEVQRDMKL
Sbjct  64   ANDQGNRITPSW-SFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKL  122

Query  494  VPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPA  673
            VPYKIVNKDGKPYIQ KIKDGETKVFSPEEISAMILTKMKETAEAFLGK I DAV    A
Sbjct  123  VPYKIVNKDGKPYIQEKIKDGETKVFSPEEISAMILTKMKETAEAFLGKKINDAV----A  178

Query  674  YFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            YFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  179  YFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  214



>emb|CDY13371.1| BnaC06g13860D [Brassica napus]
Length=673

 Score =   351 bits (900),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 192/221 (87%), Gaps = 10/221 (5%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            R    +V  I++FG LFA FS AKEE   +KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  3    RSFGAVVLAIILFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  62

Query  320  DQGNRITPSWVGFTDNERLIG-------EAAKNQAASNPERTIFDVKRLIGRKFDDKEVQ  478
            DQGNRITPSWV FTD+ERLIG        A  N+AA NPERTIF VKRLIGRKF+DKEVQ
Sbjct  63   DQGNRITPSWVAFTDSERLIGSLYSKLFHAYLNKAAVNPERTIFGVKRLIGRKFEDKEVQ  122

Query  479  RDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAV  658
            +D KLVPY+IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEA+LGK IKDAV
Sbjct  123  KDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAV  182

Query  659  VTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VTVPAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  VTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  223



>emb|CBI39503.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            +  ++++  + V   LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNRAVMILQLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIANDQG  63

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKV  123

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNK+GKPYIQV I+DGE KVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  124  VNKEGKPYIQVTIRDGEIKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDA  183

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  214



>ref|XP_010659633.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Vitis vinifera]
Length=649

 Score =   348 bits (893),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            +  ++++  + V   LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNRAVMILQLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIANDQG  63

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKV  123

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNK+GKPYIQV I+DGE KVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDA
Sbjct  124  VNKEGKPYIQVTIRDGEIKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDA  183

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  184  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  214



>ref|XP_002969949.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
 gb|EFJ29073.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
Length=660

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R+ +++F +++ G+          A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RSVILLFALLIAGAAVVAKEE---AAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  59

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQRDMKL P+KIV
Sbjct  60   RITPSWVAFTETERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLFPFKIV  119

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVK+KDGETKVFSPEEISAMILT+MKETAE++LGK IKDAVVTVPAYFNDAQ
Sbjct  120  NKDGKPYIQVKVKDGETKVFSPEEISAMILTRMKETAESYLGKKIKDAVVTVPAYFNDAQ  179

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG IAGLNVARIINEPTAAAIAYG
Sbjct  180  RQATKDAGAIAGLNVARIINEPTAAAIAYG  209



>emb|CDP15491.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   345 bits (886),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 187/215 (87%), Gaps = 2/215 (1%)
 Frame = +2

Query  143  WTRRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIA  316
            + +  +L +F + V   L   ++A EE+ K  LGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    YKKSKALWIFFLFVSEFLLGITLAAEESQKKNLGTVIGIDLGTTYSCVGVYKNGNVEIIA  62

Query  317  NDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLV  496
            NDQGNRITPSWV FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDD EVQRDMK++
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAINAERTIFDVKRLIGRKFDDPEVQRDMKML  122

Query  497  PYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAY  676
            PYKIVNKDGKPYIQVKIKDGE KVFSPEEISAMIL KMK+TAE++LGK I+ AV+TVPAY
Sbjct  123  PYKIVNKDGKPYIQVKIKDGEVKVFSPEEISAMILQKMKQTAESYLGKEIRSAVITVPAY  182

Query  677  FNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            FNDAQRQATKDAG IAGLNVARIINEPTAAAIAYG
Sbjct  183  FNDAQRQATKDAGTIAGLNVARIINEPTAAAIAYG  217



>ref|XP_002981419.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
 gb|EFJ17607.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
Length=660

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R+ +++F +++ G+          A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RSVILLFALLIAGAAVVAKEE---AAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  59

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPSWV FT+ ERLIGEAAKNQAA NPERTIFDVKRLIGRKF+DKEVQ+DMKL P+KIV
Sbjct  60   RITPSWVAFTETERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLFPFKIV  119

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKDGKPYIQVK+KDGETKVFSPEEISAMILT+MKETAE++LGK IKDAVVTVPAYFNDAQ
Sbjct  120  NKDGKPYIQVKVKDGETKVFSPEEISAMILTRMKETAESYLGKKIKDAVVTVPAYFNDAQ  179

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG IAGLNVARIINEPTAAAIAYG
Sbjct  180  RQATKDAGAIAGLNVARIINEPTAAAIAYG  209



>ref|XP_006433401.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
 ref|XP_006472078.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
 gb|ESR46641.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
Length=657

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +2

Query  176  IVVFGSLFAFSIAK-EEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  352
            +++F   F+ ++A  ++ +KLGTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV
Sbjct  11   LLLFAFEFSLALAAADDTTKLGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWV  70

Query  353  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  532
             FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDD EVQRD+K +PYKIVNKDGKPY
Sbjct  71   AFTDTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDPEVQRDIKFLPYKIVNKDGKPY  130

Query  533  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  712
            IQVK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDA
Sbjct  131  IQVKVK-GETKVFSPEEISAMILQKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDA  189

Query  713  GIIAGLNVARIINEPTAAAIAYG  781
            GIIAGLNVARIINEPTAAAIAYG
Sbjct  190  GIIAGLNVARIINEPTAAAIAYG  212



>ref|XP_001780840.1| predicted protein [Physcomitrella patens]
 gb|EDQ54319.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +2

Query  212  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  391
            A EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERLIGEAA
Sbjct  23   AAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAA  82

Query  392  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  571
            KNQAA NPERT+FDVKRLIGRKF+DKEVQ+D+KL PYKI+NKDGKP+IQV++KD E KVF
Sbjct  83   KNQAAVNPERTVFDVKRLIGRKFEDKEVQKDIKLFPYKIINKDGKPHIQVQVKDDEAKVF  142

Query  572  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIIN  751
            +PEEISAM+L KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNVARIIN
Sbjct  143  TPEEISAMVLLKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIIN  202

Query  752  EPTAAAIAYG  781
            EPTAAAIAYG
Sbjct  203  EPTAAAIAYG  212



>ref|XP_006479343.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   343 bits (881),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 178/195 (91%), Gaps = 1/195 (1%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
               + A +  +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   LGLAAADDTTTKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERL  79

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K G
Sbjct  80   IGEAAKNQAAFNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-G  138

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            ETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNV
Sbjct  139  ETKVFSPEEISAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV  198

Query  737  ARIINEPTAAAIAYG  781
            ARIINEPTAAAIAYG
Sbjct  199  ARIINEPTAAAIAYG  213



>ref|XP_006423175.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
 gb|ESR36415.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
Length=655

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = +2

Query  227  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAA  406
            +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA
Sbjct  24   TKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAA  83

Query  407  SNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEI  586
             NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSPEEI
Sbjct  84   FNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-GETKVFSPEEI  142

Query  587  SAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAA  766
            SAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNVARIINEPTAA
Sbjct  143  SAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAA  202

Query  767  AIAYG  781
            AIAYG
Sbjct  203  AIAYG  207



>ref|XP_006423179.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
 gb|ESR36419.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
Length=655

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 175/185 (95%), Gaps = 1/185 (1%)
 Frame = +2

Query  227  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAA  406
            +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA
Sbjct  24   TKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAA  83

Query  407  SNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEI  586
             NPERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSPEEI
Sbjct  84   FNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-GETKVFSPEEI  142

Query  587  SAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAA  766
            SAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAGLNVARIINEPTAA
Sbjct  143  SAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAA  202

Query  767  AIAYG  781
            AIAYG
Sbjct  203  AIAYG  207



>ref|XP_006405378.1| hypothetical protein EUTSA_v10028192mg, partial [Eutrema salsugineum]
 gb|ESQ46831.1| hypothetical protein EUTSA_v10028192mg, partial [Eutrema salsugineum]
Length=415

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  212  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  391
            AKE+A+K GT+IGIDLGT YSCVGVYK+  VEIIANDQGNRITPSWVGFTD+E LIGEAA
Sbjct  26   AKEDATKFGTLIGIDLGTAYSCVGVYKNDHVEIIANDQGNRITPSWVGFTDSESLIGEAA  85

Query  392  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  571
            KNQAA NPERTIFDVKRLIGRKF+DK+VQ+D KLVPY+IVNKDGKPYIQVKIK GETKVF
Sbjct  86   KNQAAVNPERTIFDVKRLIGRKFEDKQVQKDRKLVPYQIVNKDGKPYIQVKIKAGETKVF  145

Query  572  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIIN  751
            SPEEISAMIL KMKETAEA+LGK I DAVVTVPAYFND QRQA K+AG+IAGLNVARII 
Sbjct  146  SPEEISAMILIKMKETAEAYLGKKITDAVVTVPAYFNDDQRQAIKNAGVIAGLNVARIIK  205

Query  752  EPTAAAIAYG  781
            EP AAAIAYG
Sbjct  206  EPIAAAIAYG  215



>gb|AFC88846.1| putative luminal binding protein 7B4, partial [Tetragonia tetragonioides]
Length=699

 Score =   342 bits (878),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 191/222 (86%), Gaps = 2/222 (1%)
 Frame = +2

Query  122  RAMAGGAWTRRTSLIVFGIVVFGSLF--AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKD  295
            + MA    TR   L +  +++F + F    ++A ++ +  GTVIGIDLGTTYSCVGVYKD
Sbjct  32   QTMAKKLSTRSRDLSLMFLILFVTEFLAGVTLAADDQALKGTVIGIDLGTTYSCVGVYKD  91

Query  296  QRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEV  475
              VEII NDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIGR+FDD EV
Sbjct  92   GHVEIIPNDQGNRITPSWVAFTDTERLIGEAAKNQAALNPERTIFDVKRLIGRRFDDPEV  151

Query  476  QRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDA  655
            QRD+K++PYK+VN+DGKPYI+VKIK+G+ KVFSPEEISAMIL KMKETAE+FLG+ IK+A
Sbjct  152  QRDIKMLPYKVVNRDGKPYIEVKIKEGDVKVFSPEEISAMILQKMKETAESFLGRKIKNA  211

Query  656  VVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VVTVPAYFNDAQRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  212  VVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYG  253



>ref|XP_010458176.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=664

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 180/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  179  VVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  355
            +VF +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV 
Sbjct  19   LVFLTALMSSVAVEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVA  78

Query  356  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  535
            FTD ERLIGEAAKNQAA NPERTIFD KRL+GRKFDD +VQRD+K +PYK+VNKDGKPYI
Sbjct  79   FTDTERLIGEAAKNQAAKNPERTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYI  138

Query  536  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  715
            QVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG
Sbjct  139  QVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAG  197

Query  716  IIAGLNVARIINEPTAAAIAYG  781
            +IAGLNV RIINEPT AAIAYG
Sbjct  198  VIAGLNVVRIINEPTGAAIAYG  219



>ref|XP_011092383.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=658

 Score =   339 bits (870),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +2

Query  176  IVVFGSLFAFSIAKEEASK-LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  352
            +++F S F   IA   A +  GTVIGIDLGTTYSCVGVY++ +VEIIANDQGNRITPSWV
Sbjct  11   LLLFVSEFFMGIAPAAARENSGTVIGIDLGTTYSCVGVYRNGKVEIIANDQGNRITPSWV  70

Query  353  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  532
             FTD ERLIGEAAKNQAA NPERTIFDVKRLIGRKFDD EVQRDMK++PYK+V+KDGKPY
Sbjct  71   AFTDTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDMKMLPYKVVDKDGKPY  130

Query  533  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  712
            IQVKI+DGE KVFSPEEISAMIL KMKETAE++LGK IK AV+TVPAYFNDAQRQATKDA
Sbjct  131  IQVKIRDGEIKVFSPEEISAMILQKMKETAESYLGKKIKSAVITVPAYFNDAQRQATKDA  190

Query  713  GIIAGLNVARIINEPTAAAIAYG  781
            G IAGLNVARIINEPTAAAIAYG
Sbjct  191  GTIAGLNVARIINEPTAAAIAYG  213



>ref|XP_010458175.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=665

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V+ + +  +L +    + E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITP
Sbjct  16   LVYLVFLTAALMSSVAVEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITP  75

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD ERLIGEAAKNQAA NPERTIFD KRL+GRKFDD +VQRD+K +PYK+VNKDG
Sbjct  76   SWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDG  135

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQAT
Sbjct  136  KPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQAT  194

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG+IAGLNV RIINEPT AAIAYG
Sbjct  195  KDAGVIAGLNVVRIINEPTGAAIAYG  220



>ref|XP_006306953.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
 gb|EOA39851.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
Length=665

 Score =   338 bits (867),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = +2

Query  146  TRRTSLIVFGIVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
            T  T+  +  +V   +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIAND
Sbjct  9    TNMTNRALVCLVFLMTALMSSVAIEGEDQKLGTVIGIDLGTTYSCVGVYHNKHVEIIAND  68

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QGNRITPSWV FTD ERLIGEAAKNQAA NPERTIFD KRLIGRKFDD +VQRD+K +PY
Sbjct  69   QGNRITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPY  128

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
            K+VNKDGKPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFN
Sbjct  129  KVVNKDGKPYIQVKVK-GEVKVFSPEEISAMILTKMKETAEAFLGKNIKDAVITVPAYFN  187

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAG IAGLNV RIINEPT AAIAYG
Sbjct  188  DAQRQATKDAGAIAGLNVVRIINEPTGAAIAYG  220



>ref|XP_008388543.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=662

 Score =   338 bits (867),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 187/214 (87%), Gaps = 4/214 (2%)
 Frame = +2

Query  149  RRTSLIVFG-IVVFGSLF--AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  319
            +R   + F  +++F S F    ++A E++ K+GTVIGIDLGTTYSCV VYK+  VEIIAN
Sbjct  4    KRIHALSFAFLLLFVSEFLCGIAVAAEDSPKVGTVIGIDLGTTYSCVAVYKNGHVEIIAN  63

Query  320  DQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  499
            DQGNRITPSWV FTD ERLIGEAAKNQA  N ERTIFDVKRLIGRKFDD EVQRD+K +P
Sbjct  64   DQGNRITPSWVAFTDTERLIGEAAKNQAPLNAERTIFDVKRLIGRKFDDPEVQRDIKYLP  123

Query  500  YKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYF  679
            YK+VNKDGKPYIQVK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYF
Sbjct  124  YKVVNKDGKPYIQVKVK-GETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYF  182

Query  680  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  183  NDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  216



>gb|KDO56235.1| hypothetical protein CISIN_1g006194mg [Citrus sinensis]
Length=657

 Score =   338 bits (866),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 180/201 (90%), Gaps = 6/201 (3%)
 Frame = +2

Query  194  LFAFSIAKEEA-----SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGF  358
            LFAF  +   A     +KLGTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV F
Sbjct  13   LFAFEFSLALAAADDATKLGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAF  72

Query  359  TDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQ  538
            TD ERLIGEAAKNQAA N ERT+FDVKRLIGRKFDD EVQRD+K +PYKIVNK GKPYIQ
Sbjct  73   TDTERLIGEAAKNQAALNAERTVFDVKRLIGRKFDDPEVQRDIKFLPYKIVNKGGKPYIQ  132

Query  539  VKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGI  718
            VK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAGI
Sbjct  133  VKVK-GETKVFSPEEISAMILQKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGI  191

Query  719  IAGLNVARIINEPTAAAIAYG  781
            IAGLNVARIINEPTAAAIAYG
Sbjct  192  IAGLNVARIINEPTAAAIAYG  212



>ref|XP_007030985.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY11487.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=659

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = +2

Query  176  IVVFGSLFAFSIA-KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  352
            + +F S F   IA   + +K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV
Sbjct  11   LFLFISEFFLGIAVAADETKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWV  70

Query  353  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  532
             FTD ERLIGEAAKNQAA N ERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPY
Sbjct  71   AFTDTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPY  130

Query  533  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  712
            IQ+K+K GETKVFSPEEISAM+LTKMKETAEA+LGK IKDAV+TVPAYFNDAQRQATKDA
Sbjct  131  IQIKVK-GETKVFSPEEISAMVLTKMKETAEAYLGKKIKDAVITVPAYFNDAQRQATKDA  189

Query  713  GIIAGLNVARIINEPTAAAIAYG  781
            G IAGLNVARIINEPTAAAIAYG
Sbjct  190  GTIAGLNVARIINEPTAAAIAYG  212



>ref|NP_001184944.1| protein BIP3 [Arabidopsis thaliana]
 gb|AEE28393.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=665

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  179  VVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  355
            +VF +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV 
Sbjct  20   LVFLTALMSSLAIEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVA  79

Query  356  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  535
            FTD ERLIGEAAKNQAA NPERTIFD KRLIGRKFDD +VQRD+K +PYK+VNKDGKPYI
Sbjct  80   FTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYI  139

Query  536  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  715
            QVK+K GE K+FSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG
Sbjct  140  QVKVK-GEEKLFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAG  198

Query  716  IIAGLNVARIINEPTAAAIAYG  781
             IAGLNV RIINEPT AAIAYG
Sbjct  199  AIAGLNVVRIINEPTGAAIAYG  220



>ref|XP_006423186.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
 gb|ESR36426.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
Length=639

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 178/198 (90%), Gaps = 3/198 (2%)
 Frame = +2

Query  194  LFAFSIA--KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN  367
            LFA  +A   +  +KL TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD 
Sbjct  13   LFALRLAAADDTTTKLKTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDT  72

Query  368  ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKI  547
            ERLIGEAAKNQAA NPERTIFDVKRLIG KFDD EVQRD+K +PYK+VNK GKPYIQVK+
Sbjct  73   ERLIGEAAKNQAALNPERTIFDVKRLIGGKFDDPEVQRDIKFLPYKVVNKGGKPYIQVKV  132

Query  548  KDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAG  727
            K GETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAYFNDAQRQATKDAG+IAG
Sbjct  133  K-GETKVFSPEEISAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAG  191

Query  728  LNVARIINEPTAAAIAYG  781
            LNVARIINEPTAAAIAYG
Sbjct  192  LNVARIINEPTAAAIAYG  209



>ref|XP_010475731.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=666

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  343
            +V+ + +  +L +    + E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITP
Sbjct  16   LVYLVFLTAALMSIVAIEAEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITP  75

Query  344  SWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDG  523
            SWV FTD ERLIGEAAKNQAA NPERT+FD KRL+GRKFDD +VQRD+K +PYK+VNKDG
Sbjct  76   SWVAFTDTERLIGEAAKNQAAKNPERTVFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDG  135

Query  524  KPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQAT  703
            KPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQAT
Sbjct  136  KPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQAT  194

Query  704  KDAGIIAGLNVARIINEPTAAAIAYG  781
            KDAG IAGLNV RIINEPT AAIAYG
Sbjct  195  KDAGAIAGLNVVRIINEPTGAAIAYG  220



>ref|XP_006480058.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 181/211 (86%), Gaps = 1/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            +  +L +F +         + A +  +KL TVIGIDLGTTYSCVGVY++  VEIIANDQG
Sbjct  4    KNKALAIFFLFALHFSSGLAAADDTTTKLKTVIGIDLGTTYSCVGVYRNDHVEIIANDQG  63

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD ERLIGEAAKNQAA NPERTIFDVKRLIG KFDD EVQRD+K +PYK+
Sbjct  64   NRITPSWVAFTDTERLIGEAAKNQAALNPERTIFDVKRLIGGKFDDPEVQRDIKFLPYKV  123

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNK GKPYIQVK+K GETKVFSPEEISAM+L KMKETAEAFLGK IKDAVVTVPAYFNDA
Sbjct  124  VNKGGKPYIQVKVK-GETKVFSPEEISAMVLQKMKETAEAFLGKKIKDAVVTVPAYFNDA  182

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  183  QRQATKDAGVIAGLNVARIINEPTAAAIAYG  213



>ref|XP_010475732.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=665

 Score =   336 bits (862),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = +2

Query  146  TRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  325
            T  T+  +  +V   +L +    + E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQ
Sbjct  9    TNMTNKALVYLVFLTALMSIVAIEAEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQ  68

Query  326  GNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYK  505
            GNRITPSWV FTD ERLIGEAAKNQAA NPERT+FD KRL+GRKFDD +VQRD+K +PYK
Sbjct  69   GNRITPSWVAFTDTERLIGEAAKNQAAKNPERTVFDPKRLMGRKFDDPDVQRDIKFLPYK  128

Query  506  IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFND  685
            +VNKDGKPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFND
Sbjct  129  VVNKDGKPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFND  187

Query  686  AQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            AQRQATKDAG IAGLNV RIINEPT AAIAYG
Sbjct  188  AQRQATKDAGAIAGLNVVRIINEPTGAAIAYG  219



>emb|CDP21572.1| unnamed protein product, partial [Coffea canephora]
Length=286

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = +2

Query  161  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  340
            L++  +  F +  A +    +   LGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRIT
Sbjct  14   LLLLFVSEFLAGIALAAEGTQKQNLGTVIGIDLGTTYSCVGVYRNGNVEIIANDQGNRIT  73

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PSWV FTD ERLIGEAAKNQAA NPE T+FDVKR IGRKFDD EVQRDMKL+PYK+VNKD
Sbjct  74   PSWVAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRKFDDPEVQRDMKLLPYKVVNKD  133

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
            GKPYI VK+K+GE K+ SPEE+SAM+L +MK+TAE++LGK +K+AVVTVPAYFNDAQRQA
Sbjct  134  GKPYIDVKMKNGEMKLLSPEEVSAMVLQRMKQTAESYLGKEVKNAVVTVPAYFNDAQRQA  193

Query  701  TKDAGIIAGLNVARIINEPTAAAIAY  778
            TKDAG IAGLNV RIINEPTAAAIAY
Sbjct  194  TKDAGTIAGLNVVRIINEPTAAAIAY  219



>ref|XP_010041040.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=665

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 175/186 (94%), Gaps = 1/186 (1%)
 Frame = +2

Query  224  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQA  403
            + K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERLIGEAAKNQA
Sbjct  33   SPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQA  92

Query  404  ASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEE  583
            A N ERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSPEE
Sbjct  93   AMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVKVK-GETKVFSPEE  151

Query  584  ISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTA  763
            ISAMIL KMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG+IAGLNVARIINEPTA
Sbjct  152  ISAMILGKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGVIAGLNVARIINEPTA  211

Query  764  AAIAYG  781
            AAIAYG
Sbjct  212  AAIAYG  217



>ref|XP_010674036.1| PREDICTED: luminal-binding protein 5 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 183/211 (87%), Gaps = 3/211 (1%)
 Frame = +2

Query  158  SLIVFGIVVFGSLFAFSI---AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            +L ++ +++F S F   +   A ++ +  GTVIGIDLGTTYSCVGVYKD  VEIIANDQG
Sbjct  7    NLALYFLLLFVSEFLLGVTVLAADDQTIKGTVIGIDLGTTYSCVGVYKDGHVEIIANDQG  66

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD+ERL GEAAKNQAA NPERTIFDVKRLIGRKF D EVQRDMK++PYK+
Sbjct  67   NRITPSWVAFTDSERLTGEAAKNQAAINPERTIFDVKRLIGRKFSDPEVQRDMKMLPYKV  126

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VN+DGKPYIQVK K+GE KVFSPEE+SAMIL KMKETAE++LG T+K AVVTVPAYFNDA
Sbjct  127  VNRDGKPYIQVKTKEGEVKVFSPEEVSAMILQKMKETAESYLGSTVKHAVVTVPAYFNDA  186

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  187  QRQATKDAGTIAGLNVVRIINEPTAAAIAYG  217



>ref|NP_172382.4| protein BIP3 [Arabidopsis thaliana]
 sp|Q8H1B3.1|MD37B_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37b; AltName: Full=BiP chaperone BIP-L; AltName: 
Full=Heat shock 70 kDa protein 13; AltName: Full=Heat shock 
protein 70-13; Short=AtHsp70-13; AltName: Full=Hsp70 protein 
BiP chaperone BIP-L; AltName: Full=Luminal-binding protein 
3; Short=AtBP3; Short=BiP3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAN60163.1| BiP chaperone BIP-L [Arabidopsis thaliana]
 gb|AEE28392.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=675

 Score =   336 bits (861),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 179/203 (88%), Gaps = 2/203 (1%)
 Frame = +2

Query  176  IVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  352
            ++  G+    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV
Sbjct  29   LMNIGAALMSSLAIEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWV  88

Query  353  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  532
             FTD ERLIGEAAKNQAA NPERTIFD KRLIGRKFDD +VQRD+K +PYK+VNKDGKPY
Sbjct  89   AFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPY  148

Query  533  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  712
            IQVK+K GE K+FSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDA
Sbjct  149  IQVKVK-GEEKLFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDA  207

Query  713  GIIAGLNVARIINEPTAAAIAYG  781
            G IAGLNV RIINEPT AAIAYG
Sbjct  208  GAIAGLNVVRIINEPTGAAIAYG  230



>gb|AAB70400.1| Similar to Arabidopsis luminal binding protein (gb|D89342) [Arabidopsis 
thaliana]
Length=655

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 171/187 (91%), Gaps = 1/187 (1%)
 Frame = +2

Query  221  EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQ  400
            E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWV FTD ERLIGEAAKNQ
Sbjct  9    EEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQ  68

Query  401  AASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPE  580
            AA NPERTIFD KRLIGRKFDD +VQRD+K +PYK+VNKDGKPYIQVK+K GE K+FSPE
Sbjct  69   AAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVK-GEEKLFSPE  127

Query  581  EISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPT  760
            EISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG IAGLNV RIINEPT
Sbjct  128  EISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAGLNVVRIINEPT  187

Query  761  AAAIAYG  781
             AAIAYG
Sbjct  188  GAAIAYG  194



>ref|XP_011088129.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=656

 Score =   335 bits (858),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 179/203 (88%), Gaps = 1/203 (0%)
 Frame = +2

Query  176  IVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  352
            +++F S F   IA   E+S+  TVIGIDLGTTYSCVGVY+  +++IIANDQGNRITPSWV
Sbjct  11   LLLFASEFLIGIAAAAESSQSQTVIGIDLGTTYSCVGVYRHGKLDIIANDQGNRITPSWV  70

Query  353  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  532
             FTD ERLIGEAAKNQA  NPERTIFDVKRLIGRKFDD EVQRDMK++PYK+V KDGKPY
Sbjct  71   AFTDTERLIGEAAKNQATLNPERTIFDVKRLIGRKFDDPEVQRDMKMLPYKVVVKDGKPY  130

Query  533  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  712
            IQVKIKDGE KVFSPEE+SAMIL KMKETAEA+LGK IK AV+TVPAYFNDAQRQATKDA
Sbjct  131  IQVKIKDGEVKVFSPEEVSAMILQKMKETAEAYLGKKIKRAVITVPAYFNDAQRQATKDA  190

Query  713  GIIAGLNVARIINEPTAAAIAYG  781
            G IAGL+V RIINEPTAAAIAYG
Sbjct  191  GTIAGLHVERIINEPTAAAIAYG  213



>ref|XP_007206318.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
 gb|EMJ07517.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
Length=657

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = +2

Query  185  FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTD  364
            F  LF  + A   +SK+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD
Sbjct  13   FLLLFISASAAGGSSKVGTVIGIDLGTTYSCVGVYKNGNVEIIANDQGNRITPSWVAFTD  72

Query  365  NERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVK  544
             ERLIGEAAKNQA  N ERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK
Sbjct  73   TERLIGEAAKNQAPLNAERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVK  132

Query  545  IKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIA  724
            +K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAGIIA
Sbjct  133  VK-GETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGIIA  191

Query  725  GLNVARIINEPTAAAIAYG  781
            GLNVARIINEPTAAAIAYG
Sbjct  192  GLNVARIINEPTAAAIAYG  210



>ref|XP_008246412.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=664

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 181/204 (89%), Gaps = 3/204 (1%)
 Frame = +2

Query  176  IVVFGSLFAFSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSW  349
            +++F S F   IA     +SK+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSW
Sbjct  14   LLLFISEFLCGIASAAGGSSKVGTVIGIDLGTTYSCVGVYKNGNVEIIANDQGNRITPSW  73

Query  350  VGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKP  529
            V FTD ERLIGEAAKNQA  N ERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGKP
Sbjct  74   VAFTDTERLIGEAAKNQAPLNAERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKP  133

Query  530  YIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKD  709
            YIQVK+K GETKVFSPEEISAMIL KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKD
Sbjct  134  YIQVKVK-GETKVFSPEEISAMILGKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKD  192

Query  710  AGIIAGLNVARIINEPTAAAIAYG  781
            AGIIAGLNVARIINEPTAAAIAYG
Sbjct  193  AGIIAGLNVARIINEPTAAAIAYG  216



>ref|XP_009118328.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b [Brassica rapa]
Length=653

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 179/207 (86%), Gaps = 2/207 (1%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  340
            + + + +   +F  S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRIT
Sbjct  6    LAYLVFMMTLVFMSSVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRIT  65

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PSWV FTD ERLIGEAAKNQAA NPE TIFD KRL+GRKFDD +VQRD+K +PYK+VNKD
Sbjct  66   PSWVAFTDTERLIGEAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKD  125

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
            GKPYIQVK+K GE KVFSPEEISAMIL+KMKETAEAFLGK IKDAV+TVPAYFNDAQRQA
Sbjct  126  GKPYIQVKVK-GEVKVFSPEEISAMILSKMKETAEAFLGKKIKDAVITVPAYFNDAQRQA  184

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG IAGLNV RIINEPT AAIAYG
Sbjct  185  TKDAGAIAGLNVVRIINEPTGAAIAYG  211



>emb|CDY22648.1| BnaC08g42820D [Brassica napus]
Length=605

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 173/193 (90%), Gaps = 2/193 (1%)
 Frame = +2

Query  206  SIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIG  382
            S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRITPSWV FTD ERLIG
Sbjct  3    SVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRITPSWVAFTDTERLIG  62

Query  383  EAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGET  562
            EAAKNQAA NPE TIFD KRL+GRKFDD +VQRD+K +PYK+VNKDGKPYIQVK+K GE 
Sbjct  63   EAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVK-GEV  121

Query  563  KVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVAR  742
            KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG IAGLNV R
Sbjct  122  KVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAGLNVVR  181

Query  743  IINEPTAAAIAYG  781
            IINEPT AAIAYG
Sbjct  182  IINEPTGAAIAYG  194



>emb|CDY06347.1| BnaA09g48560D [Brassica napus]
Length=642

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 176/198 (89%), Gaps = 2/198 (1%)
 Frame = +2

Query  191  SLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN  367
            ++F  S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRITPSWV FTD 
Sbjct  35   AVFMSSVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRITPSWVAFTDT  94

Query  368  ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKI  547
            ERLIGEAAKNQAA NPE TIFD KRL+GRKFDD +VQRD+K +PYK+VNKDGKPYIQVK+
Sbjct  95   ERLIGEAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKV  154

Query  548  KDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAG  727
            K GE KVFSPEEISAMIL+KMKETAEAFLGK IKDAV+TVPAYFNDAQRQATKDAG IAG
Sbjct  155  K-GEVKVFSPEEISAMILSKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAG  213

Query  728  LNVARIINEPTAAAIAYG  781
            LNV RIINEPT AAIAYG
Sbjct  214  LNVVRIINEPTGAAIAYG  231



>ref|XP_012089020.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Jatropha curcas]
 gb|KDP23486.1| hypothetical protein JCGZ_23319 [Jatropha curcas]
Length=662

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 177/192 (92%), Gaps = 1/192 (1%)
 Frame = +2

Query  206  SIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGE  385
            ++A +++ KLGTVIGIDLGTTYSCVGV ++  +EIIANDQGNRITPSWV FTD ERLIGE
Sbjct  23   AVAADDSPKLGTVIGIDLGTTYSCVGVSRNGHIEIIANDQGNRITPSWVAFTDTERLIGE  82

Query  386  AAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETK  565
            AAKNQAA NPE T+FDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETK
Sbjct  83   AAKNQAAFNPENTVFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK-GETK  141

Query  566  VFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARI  745
            +FSPEEISAM+L KMKETAEA+LGK IKDAVVTVPAYFNDAQRQATKDAG IAGLNVARI
Sbjct  142  LFSPEEISAMVLGKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGAIAGLNVARI  201

Query  746  INEPTAAAIAYG  781
            INEPTAAAIAYG
Sbjct  202  INEPTAAAIAYG  213



>ref|XP_011092073.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=657

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = +2

Query  176  IVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVG  355
            +++F S  A +    +   LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNRITPSWV 
Sbjct  11   LLLFVSGIAIAAQDSQNRDLGTVIGIDLGTTYSCVGVYTNGKVEIIANDQGNRITPSWVA  70

Query  356  FTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYI  535
            FT+ +RLIGEAAKNQAA NPERT+FDVKRLIGRKFDD +VQRDMK++PY++V+KDGKPY+
Sbjct  71   FTNTDRLIGEAAKNQAALNPERTVFDVKRLIGRKFDDPDVQRDMKMLPYQVVDKDGKPYV  130

Query  536  QVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAG  715
            QVK KDGE KVFSPEEISAM+L KMKETAE++LGK + DAVVTVPAYFNDAQRQATKDAG
Sbjct  131  QVKTKDGEVKVFSPEEISAMVLRKMKETAESYLGKKVHDAVVTVPAYFNDAQRQATKDAG  190

Query  716  IIAGLNVARIINEPTAAAIAYG  781
             IAGLNV RIINEPTAAAIAYG
Sbjct  191  AIAGLNVVRIINEPTAAAIAYG  212



>gb|KJB81015.1| hypothetical protein B456_013G125300 [Gossypium raimondii]
Length=656

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = +2

Query  176  IVVFGSLFAFSIA-KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  352
            + +F S F   IA     SK+G VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV
Sbjct  11   LFLFISEFLLGIAVASNDSKVGAVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWV  70

Query  353  GFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPY  532
             FTD+ERLIGEAAKNQAA N ERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPY
Sbjct  71   AFTDSERLIGEAAKNQAALNAERTIFDVKRLIGRKFNDPEVQRDVKFLPYKVVNKDGKPY  130

Query  533  IQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDA  712
            IQVK+K GETKVFS EEISAM+LTKMKETAEA+LGK IKDAV+TVPAYFNDAQRQATKDA
Sbjct  131  IQVKVK-GETKVFSAEEISAMVLTKMKETAEAYLGKKIKDAVITVPAYFNDAQRQATKDA  189

Query  713  GIIAGLNVARIINEPTAAAIAYG  781
            G IAGLNVARIINEPTAAAIAYG
Sbjct  190  GTIAGLNVARIINEPTAAAIAYG  212



>ref|XP_006417615.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
 gb|ESQ35968.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
Length=657

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 179/208 (86%), Gaps = 3/208 (1%)
 Frame = +2

Query  164  IVFGIVVFGSLFAFS-IAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            + + + V  SL   S +A E E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRI
Sbjct  6    LAYLVFVTASLVLISSVATEGEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRI  65

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPSWV FTD ERLIGEAAKNQAA NPERTI D KRL+GRKFDD +VQRD+K +PYK+VNK
Sbjct  66   TPSWVAFTDTERLIGEAAKNQAAKNPERTIHDPKRLMGRKFDDPDVQRDIKFLPYKVVNK  125

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
            DGKPYIQVK+K GE KVFSPEEISAMILTKMKETAEAFLGK IKDAV+TVPAYFNDAQRQ
Sbjct  126  DGKPYIQVKVK-GEDKVFSPEEISAMILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQ  184

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAG IAGLNV  IINEPT AAIAYG
Sbjct  185  ATKDAGAIAGLNVVHIINEPTGAAIAYG  212



>gb|KFK43208.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=659

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = +2

Query  143  WTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
             T ++   +F ++   +L +  + K E   LGTVIGIDLGTTYSCVGVY+++ VEIIAND
Sbjct  3    MTNKSLAYLFFMIAISALMSSEVTKAEEQTLGTVIGIDLGTTYSCVGVYRNKHVEIIAND  62

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QGNRITPSWV FTD+ERLIGEAAKNQA  NPE TI D KR IGR+FDD EVQRD+K +PY
Sbjct  63   QGNRITPSWVAFTDSERLIGEAAKNQATKNPEGTICDPKRFIGRQFDDPEVQRDIKFLPY  122

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
            K+VNKDGKPY QVK+K GE KVFSPEEISAMILTKMKETAEA+LG  IKDAV+TVPAYFN
Sbjct  123  KVVNKDGKPYFQVKVK-GEKKVFSPEEISAMILTKMKETAEAYLGHKIKDAVITVPAYFN  181

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAG IAGLNV RIINEPT AAIAYG
Sbjct  182  DAQRQATKDAGAIAGLNVVRIINEPTGAAIAYG  214



>gb|KFK43207.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=660

 Score =   329 bits (843),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 177/211 (84%), Gaps = 1/211 (0%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  328
            +  + + F I +  +L +  + K E   LGTVIGIDLGTTYSCVGVY+++ VEIIANDQG
Sbjct  6    KSLAYLFFMIAISAALMSSEVTKAEEQTLGTVIGIDLGTTYSCVGVYRNKHVEIIANDQG  65

Query  329  NRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  508
            NRITPSWV FTD+ERLIGEAAKNQA  NPE TI D KR IGR+FDD EVQRD+K +PYK+
Sbjct  66   NRITPSWVAFTDSERLIGEAAKNQATKNPEGTICDPKRFIGRQFDDPEVQRDIKFLPYKV  125

Query  509  VNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDA  688
            VNKDGKPY QVK+K GE KVFSPEEISAMILTKMKETAEA+LG  IKDAV+TVPAYFNDA
Sbjct  126  VNKDGKPYFQVKVK-GEKKVFSPEEISAMILTKMKETAEAYLGHKIKDAVITVPAYFNDA  184

Query  689  QRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QRQATKDAG IAGLNV RIINEPT AAIAYG
Sbjct  185  QRQATKDAGAIAGLNVVRIINEPTGAAIAYG  215



>emb|CAC37635.1| luminal binding protein, BiP, partial [Scherffelia dubia]
Length=665

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 183/219 (84%), Gaps = 5/219 (2%)
 Frame = +2

Query  125  AMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  304
            AMAG    R  + +V  +     L A   A+EEA K+GTVIGIDLGTTYSCVGVYK+ RV
Sbjct  5    AMAG----RGRAFVVSAVCALALLCAVVRAEEEAKKIGTVIGIDLGTTYSCVGVYKNGRV  60

Query  305  EIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRD  484
            EIIANDQGNRITPS+V FTDNERLIG+AAKNQA SNPER ++DVKRLIGRKF DK+VQRD
Sbjct  61   EIIANDQGNRITPSYVAFTDNERLIGDAAKNQATSNPERPVYDVKRLIGRKFTDKDVQRD  120

Query  485  MKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVT  664
            MKLV Y I++ +GKPYIQV +K GE K FSPEE+SAMIL KMKETAEAFLGKT+K AV T
Sbjct  121  MKLVSYTIIDHNGKPYIQVDVK-GEKKSFSPEEVSAMILVKMKETAEAFLGKTVKHAVXT  179

Query  665  VPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            VPAYFNDAQRQATKDAG+IAGL V RIINEPTAAAIAYG
Sbjct  180  VPAYFNDAQRQATKDAGVIAGLAVERIINEPTAAAIAYG  218



>ref|XP_004302398.1| PREDICTED: luminal-binding protein 4 [Fragaria vesca subsp. vesca]
Length=662

 Score =   328 bits (842),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = +2

Query  146  TRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  325
            TR  SL    + V   L   ++A E +S  GTVIGIDLGTTYSCVGVY++  VEII NDQ
Sbjct  4    TRALSLTFLLLFVSEFLCGIALAAEGSSTPGTVIGIDLGTTYSCVGVYRNGNVEIIVNDQ  63

Query  326  GNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYK  505
            GNRITPSWV FTD ERLIGEAAKNQA  N ERTIFDVKRLIGRKF+D EVQRD+K +PYK
Sbjct  64   GNRITPSWVAFTDTERLIGEAAKNQAPQNAERTIFDVKRLIGRKFNDPEVQRDIKFLPYK  123

Query  506  IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFND  685
            +VNK+GKPYIQVK+K GE KVFSPEEISAMIL+KMKETAEA+LGK I +AVVTVPAYFND
Sbjct  124  VVNKEGKPYIQVKVK-GEDKVFSPEEISAMILSKMKETAEAYLGKKITNAVVTVPAYFND  182

Query  686  AQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            AQRQATKDAGIIAGLNV RIINEPTAAAIAYG
Sbjct  183  AQRQATKDAGIIAGLNVQRIINEPTAAAIAYG  214



>ref|XP_009766974.1| PREDICTED: luminal-binding protein 5-like [Nicotiana sylvestris]
Length=667

 Score =   328 bits (841),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  176  IVVFGSLFAFSIA----KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRIT  340
            +++F S F   +     K +   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRIT
Sbjct  16   LLLFVSEFCLEVTLAAEKNQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRIT  75

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PSWV FTD ERLIGEAAKNQAA NPERTI+DVKRLIGRKFDD EVQ+ +K++P+++VNKD
Sbjct  76   PSWVAFTDTERLIGEAAKNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFEVVNKD  135

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
            GKPY+QVKIKDGE K FSPEEISAMIL KMKETAEA+LGK+IK AV+TVPAYFNDAQRQA
Sbjct  136  GKPYVQVKIKDGEVKKFSPEEISAMILQKMKETAEAYLGKSIKHAVITVPAYFNDAQRQA  195

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  196  TKDAGAIAGLNVVRIINEPTAAAIAYG  222



>ref|XP_009622355.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Nicotiana tomentosiformis]
Length=668

 Score =   328 bits (840),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +2

Query  176  IVVFGSLFAFSIA----KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRIT  340
            +++F S F   +     K +   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRIT
Sbjct  16   LLLFVSEFCLEVTLAAEKNQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRIT  75

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PSWV FTD ERLIGEAAKNQAA NPERTI+DVKRLIGRKFDD EVQ+ +K++P+++VNKD
Sbjct  76   PSWVAFTDTERLIGEAAKNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFEVVNKD  135

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
            GKPY+QVKIKDGE K FSPEEISAMIL KMKETAEA+LGK+IK AV+TVPAYFNDAQRQA
Sbjct  136  GKPYVQVKIKDGEVKKFSPEEISAMILQKMKETAEAYLGKSIKHAVITVPAYFNDAQRQA  195

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  196  TKDAGAIAGLNVVRIINEPTAAAIAYG  222



>ref|XP_005842772.1| hypothetical protein CHLNCDRAFT_144025, partial [Chlorella variabilis]
 gb|EFN50655.1| hypothetical protein CHLNCDRAFT_144025, partial [Chlorella variabilis]
Length=310

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 168/187 (90%), Gaps = 1/187 (1%)
 Frame = +2

Query  221  EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQ  400
            E  KLGTVIGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPS+V FTD ERLIG+AAKNQ
Sbjct  30   EQEKLGTVIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSYVAFTDTERLIGDAAKNQ  89

Query  401  AASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPE  580
            A  NP+RT++DVKRLIGRKF D EVQRD KLV Y IV+K  KPYIQV++  GE+K FSPE
Sbjct  90   ATVNPKRTVYDVKRLIGRKFSDAEVQRDAKLVSYNIVDKQSKPYIQVEVA-GESKSFSPE  148

Query  581  EISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPT  760
            EISAMILTKMK+TAEAFLGKT+K AVVTVPAYFNDAQRQATKDAG+IAGLNV RIINEPT
Sbjct  149  EISAMILTKMKDTAEAFLGKTVKHAVVTVPAYFNDAQRQATKDAGVIAGLNVVRIINEPT  208

Query  761  AAAIAYG  781
            AAAIAYG
Sbjct  209  AAAIAYG  215



>ref|XP_002318993.2| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE94916.2| heat shock protein 70 cognate [Populus trichocarpa]
Length=660

 Score =   326 bits (835),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 172/196 (88%), Gaps = 1/196 (1%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
                 +A ++  KLGTVIGIDLGTTYSCV V +D  VEIIANDQGNR+TPSWV FTD ER
Sbjct  21   FLGLVVAADDGPKLGTVIGIDLGTTYSCVAVSRDGHVEIIANDQGNRVTPSWVAFTDTER  80

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIGEAAKNQA  NPERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGK YIQVK+K 
Sbjct  81   LIGEAAKNQAPMNPERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKSYIQVKVK-  139

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GETKVFSPEEISAMIL KMKETAE++LGK IK+AVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  140  GETKVFSPEEISAMILGKMKETAESYLGKKIKNAVVTVPAYFNDAQRQATKDAGIIAGLN  199

Query  734  VARIINEPTAAAIAYG  781
            V RIINEPTAAAIAYG
Sbjct  200  VPRIINEPTAAAIAYG  215



>ref|XP_006344666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Solanum tuberosum]
Length=669

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 184/229 (80%), Gaps = 8/229 (3%)
 Frame = +2

Query  98   RTRAQSDHRAMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSC  277
            R R   D + +A        S    G+ V       +  K++   LGTVIGIDLGTTYSC
Sbjct  2    RMRRSKDFKNLAFLILLLFASEFCLGVTV-------AAEKKQKQNLGTVIGIDLGTTYSC  54

Query  278  VGVYK-DQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGR  454
            VGVYK +  VEIIANDQGNRITPSWV FTD ERLIGEAAKNQAA NPERTI+DVKRLIGR
Sbjct  55   VGVYKGENNVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAALNPERTIYDVKRLIGR  114

Query  455  KFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFL  634
            KFDD EVQ+ +K++P+ IVNKDGKPY++VKIK+G+ KVFSPEEISAMIL KMKETAEA+L
Sbjct  115  KFDDPEVQKIIKMLPFNIVNKDGKPYVEVKIKEGDVKVFSPEEISAMILQKMKETAEAYL  174

Query  635  GKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            GK+IK AV+TVPAYFNDAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  175  GKSIKHAVITVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYG  223



>ref|XP_011023674.1| PREDICTED: luminal-binding protein 4-like [Populus euphratica]
Length=660

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
                 +A +   KLGTVIGIDLGTTYSCV V +D  VEIIANDQGNR+TPSWV FTD ER
Sbjct  21   FLGLVVAADGGPKLGTVIGIDLGTTYSCVAVSRDGHVEIIANDQGNRVTPSWVAFTDTER  80

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIGEAAKNQA  NPERTIF VKRLIGRKFDD EVQRD+K +PYK+VNKDGK YIQVK+K 
Sbjct  81   LIGEAAKNQAPMNPERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKSYIQVKVK-  139

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GETKVFSPEEISAMIL KMKETAE++LGK IK+AVVTVPAYFNDAQRQATKDAGIIAGLN
Sbjct  140  GETKVFSPEEISAMILGKMKETAESYLGKKIKNAVVTVPAYFNDAQRQATKDAGIIAGLN  199

Query  734  VARIINEPTAAAIAYG  781
            V RIINEPTAAAIAYG
Sbjct  200  VPRIINEPTAAAIAYG  215



>gb|KIY96078.1| heat shock 70kDa protein 5 [Monoraphidium neglectum]
Length=433

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = +2

Query  194  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNER  373
            +F  ++  +E  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD+ER
Sbjct  18   VFGMAVQAKEEEKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSER  77

Query  374  LIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKD  553
            LIG+AAKNQA  NP+RTI+DVKRLIGRKF+DKEVQRD KL+ Y IV+K GKP +QV +  
Sbjct  78   LIGDAAKNQATVNPKRTIYDVKRLIGRKFEDKEVQRDKKLMSYDIVDKAGKPMVQVDVA-  136

Query  554  GETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLN  733
            GE KVFSPEEISAMIL KMK+TAEAFLGK++K AVVTVPAYFNDAQRQATKDAG I+GLN
Sbjct  137  GEKKVFSPEEISAMILQKMKDTAEAFLGKSVKHAVVTVPAYFNDAQRQATKDAGTISGLN  196

Query  734  VARIINEPTAAAIAYG  781
            V RIINEPTAAAIAYG
Sbjct  197  VVRIINEPTAAAIAYG  212



>ref|XP_010553728.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37b [Tarenaya hassleriana]
Length=658

 Score =   320 bits (819),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  143  WTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
             TRR  L     V   +  +  +   E  KLGTVIGIDLGTTYSCVGV+++  VEIIAND
Sbjct  3    MTRRVFLYFLLFVAASAFMSNLMIDGEEQKLGTVIGIDLGTTYSCVGVFRNGHVEIIAND  62

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QGNRITPSWV FTD+ERLIGEAAKNQAA NPERT+ D KRLIGR+FDD EVQ ++K + Y
Sbjct  63   QGNRITPSWVAFTDSERLIGEAAKNQAAMNPERTVSDAKRLIGRRFDDPEVQGNVKYLSY  122

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
            K+VNKDGKPYIQ+K+K GE K+FSPEEISAMIL KMKETAEA+LGK IKDAV+TVPAYFN
Sbjct  123  KVVNKDGKPYIQMKVK-GEEKLFSPEEISAMILGKMKETAEAYLGKKIKDAVITVPAYFN  181

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  182  DAQRQATKDAGTIAGLNVPRIINEPTAAAIAYG  214



>ref|XP_010027237.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=667

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = +2

Query  218  EEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKN  397
            +++ K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD+ERLIGEAAKN
Sbjct  32   DDSPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKN  91

Query  398  QAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSP  577
            QAA N ERTIFDVKRLIGRKFDD EVQRD+K +PYK+VNKDGKPYIQVK+K GETKVFSP
Sbjct  92   QAAMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVKVK-GETKVFSP  150

Query  578  EEISAMILTKMKETAEAFLGKTIKDAVV-TVPAYFNDAQRQATKDAGIIAGLNVARIINE  754
            EEISAMIL KMKETAEAFLGK IK  ++  V  YFNDAQRQATKDAGIIAGLNVARIINE
Sbjct  151  EEISAMILGKMKETAEAFLGKKIKGCLLGAVANYFNDAQRQATKDAGIIAGLNVARIINE  210

Query  755  PTAAAIAYG  781
            PTAAAIAYG
Sbjct  211  PTAAAIAYG  219



>ref|XP_004230233.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Solanum lycopersicum]
Length=669

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = +2

Query  215  KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRITPSWVGFTDNERLIGEAA  391
            K++   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRITPSWV FTD ERLIGEAA
Sbjct  34   KKQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRITPSWVAFTDTERLIGEAA  93

Query  392  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  571
            KNQAA NPERTI+DVKRLIGRKFDD EVQ+ +K++P+ +VNK GKP+++VKIK+G+ KVF
Sbjct  94   KNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFNVVNKAGKPHVEVKIKEGDVKVF  153

Query  572  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIIN  751
            SPEEISAMIL KMKETAEA+LGK+IK AV+TVPAYFNDAQRQATKDAG IAGLNV RIIN
Sbjct  154  SPEEISAMILQKMKETAEAYLGKSIKHAVITVPAYFNDAQRQATKDAGTIAGLNVVRIIN  213

Query  752  EPTAAAIAYG  781
            EPTAAAIAYG
Sbjct  214  EPTAAAIAYG  223



>ref|NP_001051048.1| Os03g0710500 [Oryza sativa Japonica Group]
 gb|AAX95660.1| dnaK protein [Oryza sativa Japonica Group]
 gb|ABF98501.1| Luminal binding protein 5 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12962.1| Os03g0710500 [Oryza sativa Japonica Group]
Length=669

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 184/217 (85%), Gaps = 3/217 (1%)
 Frame = +2

Query  140  AWTRRTSLIV--FGIVVFGSLFAFSIAKEEASKL-GTVIGIDLGTTYSCVGVYKDQRVEI  310
            A  ++++LIV  F ++  G L   +   +   K  G VIGIDLGTTYSCVGVY++  V+I
Sbjct  2    ARDKQSALIVAAFVLLCSGCLCGVADGAKGGRKTKGPVIGIDLGTTYSCVGVYRNGHVDI  61

Query  311  IANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMK  490
            +ANDQGNRITPSWV FTD+ERL+GEAAKNQAA NP+RTIFD+KRLIGR+FDD+EVQRD+K
Sbjct  62   VANDQGNRITPSWVAFTDDERLVGEAAKNQAALNPDRTIFDIKRLIGRRFDDEEVQRDVK  121

Query  491  LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  670
             +PYK+V+K GKPY++V++K GE KVFSPEEISAMIL KMKETAE++LG+ + DAVVTVP
Sbjct  122  YLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEISAMILAKMKETAESYLGQRVTDAVVTVP  181

Query  671  AYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            AYFNDAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  182  AYFNDAQRQATKDAGTIAGLNVPRIINEPTAAAIAYG  218



>ref|XP_006650483.1| PREDICTED: luminal-binding protein 4-like [Oryza brachyantha]
Length=665

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +2

Query  242  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPER  421
            VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWV FTD+ERL+GEAAKNQAA NP+R
Sbjct  39   VIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNPDR  98

Query  422  TIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL  601
            TIFD+KRLIGR+FDD+EVQRD+K +PYK+V+KDGKPY++V++K GE KVFSPEEISAMIL
Sbjct  99   TIFDIKRLIGRRFDDEEVQRDVKYLPYKVVSKDGKPYVEVRVKGGERKVFSPEEISAMIL  158

Query  602  TKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKMKETAE++LG+ + DAVVTVPAYFNDAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  159  TKMKETAESYLGQRVTDAVVTVPAYFNDAQRQATKDAGTIAGLNVPRIINEPTAAAIAYG  218



>ref|XP_005651681.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE27137.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
Length=639

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 169/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  233  LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASN  412
            LGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD+ERLIG+AAKNQA +N
Sbjct  11   LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSERLIGDAAKNQATTN  70

Query  413  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  592
            P+RT++DVKRLIGRKF DKEVQRD K+V YK+V+K  KPY++V I D E K FSPEEISA
Sbjct  71   PDRTVYDVKRLIGRKFKDKEVQRDAKMVSYKVVDKAAKPYVEVTISD-EKKTFSPEEISA  129

Query  593  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAI  772
            MILTKMK+TAEA+LGKTIK+AVVTVPAYFNDAQRQATKDAG+IAGLNV RIINEPTAAAI
Sbjct  130  MILTKMKDTAEAYLGKTIKNAVVTVPAYFNDAQRQATKDAGVIAGLNVVRIINEPTAAAI  189

Query  773  AYG  781
            AYG
Sbjct  190  AYG  192



>gb|EEE59790.1| hypothetical protein OsJ_12307 [Oryza sativa Japonica Group]
Length=726

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  415
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWV FTD+ERL+GEAAKNQAA NP
Sbjct  94   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNP  153

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
            +RTIFD+KRLIGR+FDD+EVQRD+K +PYK+V+K GKPY++V++K GE KVFSPEEISAM
Sbjct  154  DRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVKAGEVKVFSPEEISAM  213

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            IL KMKETAE++LG+ + DAVVTVPAYFNDAQRQATKDAG IAGLNV RIINEPTAAAIA
Sbjct  214  ILAKMKETAESYLGQRVTDAVVTVPAYFNDAQRQATKDAGTIAGLNVPRIINEPTAAAIA  273

Query  776  YG  781
            YG
Sbjct  274  YG  275



>ref|XP_002949576.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
 gb|EFJ49128.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
Length=653

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  230  KLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAAS  409
            KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD+ERLIG+AAKNQA  
Sbjct  26   KLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSERLIGDAAKNQATV  85

Query  410  NPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEIS  589
            NP+RTI+DVKRLIGR+F+DKEVQRD KLV Y IV+K GKPY+ V + +GET+VFSPEEIS
Sbjct  86   NPKRTIYDVKRLIGRRFEDKEVQRDKKLVSYDIVDKSGKPYVSVDV-NGETRVFSPEEIS  144

Query  590  AMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAA  769
            AMIL KMKETAEA+LGKT+K AVVTVPAYFNDAQRQATKDAG I+GLNV RIINEPTAAA
Sbjct  145  AMILQKMKETAEAYLGKTVKHAVVTVPAYFNDAQRQATKDAGTISGLNVVRIINEPTAAA  204

Query  770  IAYG  781
            IAYG
Sbjct  205  IAYG  208



>ref|XP_001701685.1| binding protein 1 [Chlamydomonas reinhardtii]
 gb|EDP06660.1| binding protein 1 [Chlamydomonas reinhardtii]
Length=656

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 172/195 (88%), Gaps = 2/195 (1%)
 Frame = +2

Query  197  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERL  376
            + F +  EE  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD ERL
Sbjct  18   YGFGVWAEE-EKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDEERL  76

Query  377  IGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDG  556
            IG+AAKNQA  NP+RT++DVKRLIGRK++DKEVQRD KLV Y IV++ GKPY+ V +K G
Sbjct  77   IGDAAKNQATVNPKRTVYDVKRLIGRKYEDKEVQRDKKLVSYDIVDRQGKPYVAVDVK-G  135

Query  557  ETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNV  736
            E KVFSPEEISAMIL KMK+TAEA+LGKT+K AVVTVPAYFNDAQRQATKDAG I+GLNV
Sbjct  136  EQKVFSPEEISAMILQKMKDTAEAYLGKTVKHAVVTVPAYFNDAQRQATKDAGTISGLNV  195

Query  737  ARIINEPTAAAIAYG  781
             RIINEPTAAAIAYG
Sbjct  196  VRIINEPTAAAIAYG  210



>ref|XP_006472125.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like, partial [Citrus sinensis]
Length=435

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +2

Query  242  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPER  421
            VIGID+GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PER
Sbjct  33   VIGIDMGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPER  92

Query  422  TIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL  601
            TIFDVKRLIG++FDD EVQRD+K +PYK+VNKDGKPY+QV +K GETKVFSPEEISAMIL
Sbjct  93   TIFDVKRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVNVK-GETKVFSPEEISAMIL  151

Query  602  TKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
             KMKETAE FLG  IK+AV+TVPAYFNDAQ+QATKDAGIIAGLNVA+IINEP AAAIA+G
Sbjct  152  QKMKETAETFLGMKIKNAVLTVPAYFNDAQKQATKDAGIIAGLNVAQIINEPAAAAIAHG  211



>gb|EYU18532.1| hypothetical protein MIMGU_mgv1a022234mg, partial [Erythranthe 
guttata]
Length=625

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +2

Query  239  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPE  418
            T+IGIDLGTTYSCVGVY+  ++EIIANDQGNRITPSWV FTD ERLIGEAAKNQA+ NPE
Sbjct  1    TIIGIDLGTTYSCVGVYRQGKLEIIANDQGNRITPSWVAFTDTERLIGEAAKNQASLNPE  60

Query  419  RTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKI-KDGETKVFSPEEISAM  595
            RTIFDVKRLIGRKFDD EVQRDMK++PYK+V+KDGK YI+VKI K+GE +VFSPEEISAM
Sbjct  61   RTIFDVKRLIGRKFDDVEVQRDMKMLPYKVVDKDGKAYIEVKINKEGEIRVFSPEEISAM  120

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            ILTKMK+TAEA+LG  +  AV+TVPAYFNDAQRQATKDAG IAGL V RIINEPT AAIA
Sbjct  121  ILTKMKQTAEAYLGNKVNRAVITVPAYFNDAQRQATKDAGTIAGLQVERIINEPTTAAIA  180

Query  776  YG  781
            YG
Sbjct  181  YG  182



>ref|XP_006472126.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
 ref|XP_006472127.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
Length=503

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +2

Query  242  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPER  421
            VIGID+GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PER
Sbjct  41   VIGIDMGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPER  100

Query  422  TIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL  601
            TIFDVKRLIG++FDD EVQRD+K +PYK+VNKDGKPY+QVK+K GETKVFSPEEISAM+L
Sbjct  101  TIFDVKRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVKVK-GETKVFSPEEISAMML  159

Query  602  TKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
             KMKETAE FLG  IK+AV+TVPAYFNDAQ+QATKDAGIIAGLNVA+IINEP AAAIA+G
Sbjct  160  QKMKETAETFLGMKIKNAVLTVPAYFNDAQKQATKDAGIIAGLNVAQIINEPAAAAIAHG  219



>ref|XP_002466589.1| hypothetical protein SORBIDRAFT_01g010460 [Sorghum bicolor]
 gb|EER93587.1| hypothetical protein SORBIDRAFT_01g010460 [Sorghum bicolor]
Length=676

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  415
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWV FTD ERL+GEAAKNQA  NP
Sbjct  43   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDEERLVGEAAKNQAPLNP  102

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
            +RTIFD+KRLIGR+FDD+EVQRD++ +PYK+VNK GKPY++V +K GE K FSPEEISAM
Sbjct  103  QRTIFDIKRLIGRRFDDEEVQRDVRYLPYKVVNKGGKPYVEVPMKGGERKTFSPEEISAM  162

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            IL+KM+ETAE++LG  + DAVVTVPAYFNDAQRQATKDAG IAGLNV RIINEPTAAAIA
Sbjct  163  ILSKMRETAESYLGHRVADAVVTVPAYFNDAQRQATKDAGTIAGLNVPRIINEPTAAAIA  222

Query  776  YG  781
            YG
Sbjct  223  YG  224



>dbj|BAJ89190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = +2

Query  212  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEA  388
            A  E    GTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEA
Sbjct  30   APAEGGSTGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAFTDGGERLIGEA  89

Query  389  AKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKV  568
            AKNQAA+NPERTI+D KRLIGR F D  VQRD+KL+PY +V+++GKP+IQV++KDG+ +V
Sbjct  90   AKNQAAANPERTIYDAKRLIGRDFADAVVQRDIKLLPYSVVDRNGKPHIQVQVKDGDVRV  149

Query  569  FSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARII  748
            FSPEE+SAM+LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGLNV RI+
Sbjct  150  FSPEEVSAMVLTRMKETAEAYLGEKVTHAVVTVPAYFNDAQRQATKDAGVIAGLNVIRIV  209

Query  749  NEPTAAAIAYG  781
            NEPTAAAIAYG
Sbjct  210  NEPTAAAIAYG  220



>ref|XP_007509232.1| heat shock protein 70 [Bathycoccus prasinos]
 emb|CCO19689.1| heat shock protein 70 [Bathycoccus prasinos]
Length=263

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 170/207 (82%), Gaps = 7/207 (3%)
 Frame = +2

Query  179  VVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGF  358
            V F  L   + A +   KLGTVIGIDLGTTYSCVG Y + +VEIIANDQGNRITPS+V F
Sbjct  9    VSFVLLLLSAFADDSGEKLGTVIGIDLGTTYSCVGAYVNGKVEIIANDQGNRITPSYVAF  68

Query  359  TDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQ  538
            TD ERLIG+AAKNQA SNP RT+FD KRLIGRK+ DK+VQRD+K+ P+K+VNK+ KP I+
Sbjct  69   TDTERLIGDAAKNQATSNPTRTVFDAKRLIGRKYSDKDVQRDLKMFPFKVVNKESKPCIE  128

Query  539  VKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP------AYFNDAQRQA  700
            V +K+G+ KVF  EEISAM+L KMKETAE +LGK IK+AVVTVP      AYFNDAQRQA
Sbjct  129  VDLKEGK-KVFQAEEISAMVLVKMKETAEGYLGKQIKNAVVTVPAYFSFLAYFNDAQRQA  187

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG IAGLNVARIINEPTAAAIAYG
Sbjct  188  TKDAGTIAGLNVARIINEPTAAAIAYG  214



>ref|XP_002507118.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
 gb|ACO68376.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
Length=660

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 177/207 (86%), Gaps = 4/207 (2%)
 Frame = +2

Query  161  LIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  340
            +  F  VV   L   + A+E + +LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNRIT
Sbjct  11   IYAFATVV---LLQGTKAEESSEQLGTVIGIDLGTTYSCVGVYVNGKVEIIANDQGNRIT  67

Query  341  PSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKD  520
            PS+V FTD ERLIG+AAKNQA +NP RT+FD KRLIGRK+ DKEVQRDMK+ P+K+VNKD
Sbjct  68   PSYVAFTDGERLIGDAAKNQATANPTRTVFDAKRLIGRKYTDKEVQRDMKMFPFKVVNKD  127

Query  521  GKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQA  700
             KP I+V++K+G+ K F  EEISAM+LTKMKETAEA+LGK IK+AVVTVPAYFNDAQRQA
Sbjct  128  SKPCIEVELKEGK-KTFQAEEISAMVLTKMKETAEAYLGKDIKNAVVTVPAYFNDAQRQA  186

Query  701  TKDAGIIAGLNVARIINEPTAAAIAYG  781
            TKDAG I+GLNVARIINEPTAAAIAYG
Sbjct  187  TKDAGTISGLNVARIINEPTAAAIAYG  213



>emb|CEG00952.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=656

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 178/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
            RR +L     V+F +  A     E  +    GTVIGIDLGTTYSCVG Y + +VEIIAND
Sbjct  2    RRLTLCTLLAVIFAAACAPQGRAESTTSEITGTVIGIDLGTTYSCVGAYVNGKVEIIAND  61

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QGNRITPS+V FTD ERLIG++AKNQA++NP RT+FD KRLIGRKF DKEVQRD+K+ P+
Sbjct  62   QGNRITPSYVAFTDTERLIGDSAKNQASANPTRTVFDAKRLIGRKFTDKEVQRDLKMFPF  121

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
            KIV+KD KP I++++KDG+ K+F  EEISAM+LTKMKETAEA+LGK IK+AVVTVPAYFN
Sbjct  122  KIVDKDSKPCIEIELKDGK-KIFQAEEISAMVLTKMKETAEAYLGKDIKNAVVTVPAYFN  180

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  181  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  213



>ref|XP_001701884.1| binding protein 2 [Chlamydomonas reinhardtii]
 gb|EDP06859.1| binding protein 2 [Chlamydomonas reinhardtii]
Length=662

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 165/184 (90%), Gaps = 1/184 (1%)
 Frame = +2

Query  230  KLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAAS  409
            KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+V FTD ERLIG+AAKNQA  
Sbjct  31   KLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDEERLIGDAAKNQATV  90

Query  410  NPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEIS  589
            NP+RTI+DVKRLIGRKF D +VQRD KLV Y IV++ GKPY+ V +K GE KVFSPEEIS
Sbjct  91   NPKRTIYDVKRLIGRKFSDADVQRDRKLVSYDIVDRQGKPYVAVDVK-GEQKVFSPEEIS  149

Query  590  AMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAA  769
            AMIL KMK+TAEA+LGKT+K AVVTVPAYFNDAQRQATKDAG I+GLNV RIINEPTAAA
Sbjct  150  AMILQKMKDTAEAYLGKTVKHAVVTVPAYFNDAQRQATKDAGTISGLNVVRIINEPTAAA  209

Query  770  IAYG  781
            IAYG
Sbjct  210  IAYG  213



>ref|XP_003074861.1| Bip Luminal binding protein precursor, probable (IC) [Ostreococcus 
tauri]
Length=663

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 178/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
            RR +L     V+F +  A     E  +    GTVIGIDLGTTYSCVG Y + +VEIIAND
Sbjct  9    RRLTLCTLLAVIFAAACAPQGRAESTTSEITGTVIGIDLGTTYSCVGAYVNGKVEIIAND  68

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QGNRITPS+V FTD ERLIG++AKNQA++NP RT+FD KRLIGRKF DKEVQRD+K+ P+
Sbjct  69   QGNRITPSYVAFTDTERLIGDSAKNQASANPTRTVFDAKRLIGRKFTDKEVQRDLKMFPF  128

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
            KIV+KD KP I++++KDG+ K+F  EEISAM+LTKMKETAEA+LGK IK+AVVTVPAYFN
Sbjct  129  KIVDKDSKPCIEIELKDGK-KIFQAEEISAMVLTKMKETAEAYLGKDIKNAVVTVPAYFN  187

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG
Sbjct  188  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  220



>ref|XP_003055985.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH59361.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=659

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 178/210 (85%), Gaps = 5/210 (2%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  331
            R+ L++F      +L   +  +E   +LGTVIGIDLGTTYSCVGVY + +VEIIANDQGN
Sbjct  7    RSLLVIF----LATLVGAANGQEATEQLGTVIGIDLGTTYSCVGVYVNGKVEIIANDQGN  62

Query  332  RITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIV  511
            RITPS+V FTD+ERLIG+AAKNQA +NP RT+FD KRLIGRKF DKEVQRD+K+ P+K+V
Sbjct  63   RITPSYVAFTDSERLIGDAAKNQATANPTRTVFDAKRLIGRKFTDKEVQRDVKMFPFKVV  122

Query  512  NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQ  691
            NKD KP I+V +K+G+ KVF  EEISAM+L KMKETAEA+LGK IK+AVVTVPAYFNDAQ
Sbjct  123  NKDSKPCIEVDLKEGK-KVFQAEEISAMVLVKMKETAEAYLGKEIKNAVVTVPAYFNDAQ  181

Query  692  RQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            RQATKDAG I+G+NVARIINEPTAAAIAYG
Sbjct  182  RQATKDAGTISGMNVARIINEPTAAAIAYG  211



>ref|XP_005829514.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
 gb|EKX42534.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
Length=662

 Score =   307 bits (786),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 174/213 (82%), Gaps = 4/213 (2%)
 Frame = +2

Query  143  WTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
            +TRR+  + F      +L    +   E  ++ T IGIDLGTTYSCVGVYK+ +VEIIAND
Sbjct  2    FTRRS--VAF-FAACAALVCLGVRAAEEGQVDTTIGIDLGTTYSCVGVYKNGKVEIIAND  58

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QGNRITPSWV FTD+ERLIG+AAKNQ A NPE T+FDVKRLIGRK+ D  VQ D KL+PY
Sbjct  59   QGNRITPSWVAFTDDERLIGDAAKNQGALNPENTVFDVKRLIGRKYTDTTVQHDKKLLPY  118

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
             IV++ GKPY+QVK + GE K +SPEEISAM+LTKMKETAEAFLGK IK+AVVTVPAYFN
Sbjct  119  DIVDQGGKPYVQVKFR-GEKKTYSPEEISAMVLTKMKETAEAFLGKEIKNAVVTVPAYFN  177

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAG I+GLNV RIINEPTAAAIAYG
Sbjct  178  DAQRQATKDAGTISGLNVLRIINEPTAAAIAYG  210



>ref|NP_001055613.1| Os05g0428600 [Oryza sativa Japonica Group]
 gb|AAS90667.1| putative Luminal binding protein [Oryza sativa Japonica Group]
 gb|AAV59416.1| putative luminal binding protein 5 [Oryza sativa Japonica Group]
 dbj|BAF17527.1| Os05g0428600 [Oryza sativa Japonica Group]
Length=687

 Score =   307 bits (787),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  239  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  415
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  57   TVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  116

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  117  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  176

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V RIINEPTAAAIA
Sbjct  177  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTVDRIINEPTAAAIA  236

Query  776  YG  781
            YG
Sbjct  237  YG  238



>ref|XP_004964075.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = +2

Query  134  GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  313
            G  WT   +L+V  +V      A           GTVIGIDLGTTYSCVGVY++  VEII
Sbjct  4    GRVWTLLFALLVADLVAPIHAAAPPHGGGGDKNTGTVIGIDLGTTYSCVGVYRNGHVEII  63

Query  314  ANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMK  490
            ANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NPERTI+D KRLIGR+FDD  VQRDMK
Sbjct  64   ANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANPERTIYDAKRLIGRQFDDAVVQRDMK  123

Query  491  LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  670
            L+PY +V+++GKP+++V+++DG+ + FSPEE+SAM+LTKMKETAEA+LG+ +  AVVTVP
Sbjct  124  LLPYAVVDRNGKPHVRVQVRDGDVREFSPEEVSAMVLTKMKETAEAYLGEKVTHAVVTVP  183

Query  671  AYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            AYFNDAQRQATKDAG+IAGL V RI+NEPTAAAIAYG
Sbjct  184  AYFNDAQRQATKDAGVIAGLTVLRIVNEPTAAAIAYG  220



>ref|XP_004971898.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = +2

Query  134  GGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  313
            G  WT   +L+V  +V      A           GTVIGIDLGTTYSCVGVY++  VEII
Sbjct  4    GRVWTLLFALLVADLVAPIHAAAPPHGGGGDKNTGTVIGIDLGTTYSCVGVYRNGHVEII  63

Query  314  ANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMK  490
            ANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NPERTI+D KRLIGR+FDD  VQRDMK
Sbjct  64   ANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANPERTIYDAKRLIGRQFDDAVVQRDMK  123

Query  491  LVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVP  670
            L+PY +V+++GKP+++V+++DG+ + FSPEE+SAM+LTKMKETAEA+LG+ +  AVVTVP
Sbjct  124  LLPYAVVDRNGKPHMRVQVRDGDVREFSPEEVSAMVLTKMKETAEAYLGEKVTHAVVTVP  183

Query  671  AYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            AYFNDAQRQATKDAG+IAGL V RI+NEPTAAAIAYG
Sbjct  184  AYFNDAQRQATKDAGVIAGLTVLRIVNEPTAAAIAYG  220



>ref|XP_004986284.1| PREDICTED: luminal-binding protein 4-like [Setaria italica]
Length=679

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = +2

Query  224  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQA  403
            AS  G VIGIDLGTTYSCVG Y++  V+IIANDQGNRITPSWV FTD+ERL+GEAAKNQA
Sbjct  38   ASASGPVIGIDLGTTYSCVGAYQNGHVDIIANDQGNRITPSWVAFTDDERLVGEAAKNQA  97

Query  404  ASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEE  583
              NP+RTIFD+KRLIGR+FDD+EVQRD++ +PYK+VN+ GKPY++V +K GE K FSPEE
Sbjct  98   PLNPQRTIFDIKRLIGRRFDDEEVQRDIRYLPYKVVNRGGKPYVEVPMKGGERKAFSPEE  157

Query  584  ISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTA  763
            ISAMIL+KM+ETAE++LG+ +  AVVTVPAYFNDAQRQATKDAG IAGL V RIINEPTA
Sbjct  158  ISAMILSKMRETAESYLGRRVAGAVVTVPAYFNDAQRQATKDAGTIAGLTVPRIINEPTA  217

Query  764  AAIAYG  781
            AAIAYG
Sbjct  218  AAIAYG  223



>gb|EIE87053.1| heat shock 70 kDa protein, partial [Rhizopus delemar RA 99-880]
Length=271

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 3/212 (1%)
 Frame = +2

Query  152  RTSLIVFGIVVFGSLFAFSI--AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  325
            + SL+     +F    A ++  A E+    GTVIGIDLGTTYSCV V K+ RVEIIANDQ
Sbjct  4    KASLLALFAFIFTLFIASNVVEAAEDKESYGTVIGIDLGTTYSCVAVQKNGRVEIIANDQ  63

Query  326  GNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYK  505
            G+RITPS+V FTD+ERLIG+AAKNQ ++NP RT+FD KRLIGR+++DKEVQ+DMK  P+ 
Sbjct  64   GHRITPSYVAFTDDERLIGDAAKNQYSANPRRTVFDAKRLIGRRYEDKEVQQDMKHFPFD  123

Query  506  IVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFND  685
            +V+++G P+IQV +K GE +VF+PEEIS M+LTKMKETAEA+LGK +  AVVTVPAYFND
Sbjct  124  VVSRNGAPHIQVPVK-GEDRVFTPEEISGMVLTKMKETAEAYLGKPVTHAVVTVPAYFND  182

Query  686  AQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            AQRQATKDAG IAGL + RIINEPTAAAIAYG
Sbjct  183  AQRQATKDAGTIAGLTILRIINEPTAAAIAYG  214



>ref|NP_001061194.1| Os08g0197700 [Oryza sativa Japonica Group]
 dbj|BAD03698.1| putative Luminal binding protein 5 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF23108.1| Os08g0197700 [Oryza sativa Japonica Group]
Length=676

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  239  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  415
            TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  45   TVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  104

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  105  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  164

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V RIINEPTAAAIA
Sbjct  165  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLTVDRIINEPTAAAIA  224

Query  776  YG  781
            YG
Sbjct  225  YG  226



>ref|XP_004971892.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   304 bits (779),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 167/183 (91%), Gaps = 1/183 (1%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASN  412
            GTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+N
Sbjct  38   GTVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAAN  97

Query  413  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  592
            PERTI+D KRLIGR+FDD  VQRDMKL+PY +V+++GKP+++V+++DG+ + FSPEE+SA
Sbjct  98   PERTIYDAKRLIGRQFDDAVVQRDMKLLPYAVVDRNGKPHMRVQVRDGDVREFSPEEVSA  157

Query  593  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAI  772
            M+LTKMKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V RI+NEPTAAAI
Sbjct  158  MVLTKMKETAEAYLGEKVTHAVVTVPAYFNDAQRQATKDAGVIAGLTVLRIVNEPTAAAI  217

Query  773  AYG  781
            AYG
Sbjct  218  AYG  220



>ref|XP_002977324.1| hypothetical protein SELMODRAFT_417280 [Selaginella moellendorffii]
 gb|EFJ21328.1| hypothetical protein SELMODRAFT_417280 [Selaginella moellendorffii]
Length=654

 Score =   304 bits (779),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  415
             T IGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPSWV FT+NERLIGEAAKNQA SNP
Sbjct  24   ATSIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSWVAFTENERLIGEAAKNQATSNP  83

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
             RTI DVKRLIG K+DDKEVQRDMK + +KIVNKDGKPYI+V++  G+TK++SPEEISAM
Sbjct  84   TRTIHDVKRLIGMKYDDKEVQRDMKHLGFKIVNKDGKPYIEVEVS-GKTKIYSPEEISAM  142

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            +LTKMKETAEA+LG+ + DAV+TVPAYFNDAQR AT DAG IAGLNV RIINEPTAAA+A
Sbjct  143  VLTKMKETAEAYLGEKVTDAVITVPAYFNDAQRGATSDAGRIAGLNVMRIINEPTAAALA  202

Query  776  YG  781
            YG
Sbjct  203  YG  204



>ref|XP_002971962.1| hypothetical protein SELMODRAFT_412732 [Selaginella moellendorffii]
 gb|EFJ26879.1| hypothetical protein SELMODRAFT_412732 [Selaginella moellendorffii]
Length=654

 Score =   304 bits (778),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNP  415
             T IGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPSWV FT+NERLIGEAAKNQA SNP
Sbjct  24   ATSIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSWVAFTENERLIGEAAKNQATSNP  83

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
             RTI DVKRLIG K+DDKEVQRDMK + +KIVNKDGKPYI+V++  G+TK++SPEEISAM
Sbjct  84   TRTIHDVKRLIGMKYDDKEVQRDMKHLGFKIVNKDGKPYIEVEVS-GKTKIYSPEEISAM  142

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            +LTKMKETAEA+LG+ + DAV+TVPAYFNDAQR AT DAG IAGLNV RIINEPTAAA+A
Sbjct  143  VLTKMKETAEAYLGEKVTDAVITVPAYFNDAQRGATSDAGRIAGLNVMRIINEPTAAALA  202

Query  776  YG  781
            YG
Sbjct  203  YG  204



>ref|XP_005539525.1| luminal binding protein BiP [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83489.1| luminal binding protein BiP [Cyanidioschyzon merolae strain 10D]
Length=687

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 182/226 (81%), Gaps = 7/226 (3%)
 Frame = +2

Query  119  HRAMAGGAWTRRTSLIVFGIVVFGSLFAFSIAKEEASK-----LGTVIGIDLGTTYSCVG  283
            +R ++   W     L+     +FG   A  +  ++AS       G VIGIDLGTTYSCVG
Sbjct  8    YRRVSIWNWALVAVLVHVCCCLFGR--AVLVGAKDASSGGGKIEGPVIGIDLGTTYSCVG  65

Query  284  VYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFD  463
            V+K+ +VEIIAN+QGNRITPS+V FTD ERLIG+AAKNQ A NPERTIFDVKRLIGR+FD
Sbjct  66   VFKNGKVEIIANEQGNRITPSYVAFTDKERLIGDAAKNQLALNPERTIFDVKRLIGRRFD  125

Query  464  DKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKT  643
            ++ VQ+D+KL+PYK+VNKDGKPYI+V+++DGE K FSPEEISAMIL KMK+ AE +LGK 
Sbjct  126  EETVQKDIKLLPYKVVNKDGKPYIRVEVRDGEVKTFSPEEISAMILGKMKKIAEDYLGKP  185

Query  644  IKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            +K+AVVTVPAYFNDAQRQATKDAG IAGL V RIINEPTAAAIAYG
Sbjct  186  VKNAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIAYG  231



>ref|XP_001416181.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94474.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
Length=662

 Score =   304 bits (779),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 176/208 (85%), Gaps = 7/208 (3%)
 Frame = +2

Query  176  IVVFGSLFAFSI------AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            +    SLF F++      A+      GTVIGIDLGTTYSCVG Y + +VEIIANDQGNRI
Sbjct  13   VCACASLFLFAVCALPINAENPTEITGTVIGIDLGTTYSCVGAYVNGKVEIIANDQGNRI  72

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPS+V FTD+ERLIG++AKNQA++NP RT+FD KRLIGRKF DKEVQRD+K+ P+K+V+K
Sbjct  73   TPSYVAFTDSERLIGDSAKNQASANPTRTVFDAKRLIGRKFTDKEVQRDLKMFPFKVVDK  132

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
            D KP I+V++K+G+ KVF  EEISAM+LTKMKETAEA+LGK IK AVVTVPAYFNDAQRQ
Sbjct  133  DSKPCIEVELKEGK-KVFQAEEISAMVLTKMKETAEAYLGKDIKHAVVTVPAYFNDAQRQ  191

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAG+IAGLNVARIINEPTAAAIAYG
Sbjct  192  ATKDAGVIAGLNVARIINEPTAAAIAYG  219



>ref|XP_006644572.1| PREDICTED: luminal-binding protein 5-like [Oryza brachyantha]
Length=679

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +2

Query  239  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNP  415
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  52   TVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  111

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
            ERTI+D KRLIGR+F D EVQ+DMKL+P+ +V+++GKP+++V++KDG+ +VFSPEE+SAM
Sbjct  112  ERTIYDAKRLIGRQFADAEVQQDMKLLPFAVVDRNGKPHVRVEVKDGDVRVFSPEEVSAM  171

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            +LT+MKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V RIINEPTAAAIA
Sbjct  172  VLTRMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLRVDRIINEPTAAAIA  231

Query  776  YG  781
            YG
Sbjct  232  YG  233



>gb|KDD73887.1| heat shock protein 70 Hsp70 [Helicosporidium sp. ATCC 50920]
Length=651

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +2

Query  158  SLIVFGIVVFGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  337
            +     +V   +  AF+  +E+   +GTVIGIDLGTTYSCVGVYK+ +VEII NDQGNRI
Sbjct  2    AFFCLAVVALCAGTAFAKEEEKKENVGTVIGIDLGTTYSCVGVYKNGKVEIIPNDQGNRI  61

Query  338  TPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNK  517
            TPS+V FTD ERLIG+AAKNQA SNP+RTI+DVKRLIGR F+D  VQRDMKLV Y +VN 
Sbjct  62   TPSYVAFTDGERLIGDAAKNQATSNPKRTIYDVKRLIGRDFNDANVQRDMKLVSYDLVNN  121

Query  518  DGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQ  697
             GKPY+ V++ + E K+FSPEE+SAMILTKMK+TAE +LGK +  AVVTVPAYFNDAQRQ
Sbjct  122  GGKPYVSVEV-NKEVKMFSPEEVSAMILTKMKQTAEDYLGKAVTHAVVTVPAYFNDAQRQ  180

Query  698  ATKDAGIIAGLNVARIINEPTAAAIAYG  781
            ATKDAG+IAGLN+ RIINEPTAAAIAYG
Sbjct  181  ATKDAGVIAGLNIMRIINEPTAAAIAYG  208



>dbj|BAC67670.1| Heat shock 70 kDa protein [Cyanidioschyzon merolae]
Length=775

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 178/218 (82%), Gaps = 7/218 (3%)
 Frame = +2

Query  143  WTRRTSLIVFGIVVFGSLFAFSIAKEEASK-----LGTVIGIDLGTTYSCVGVYKDQRVE  307
            W     L+     +FG   A  +  ++AS       G VIGIDLGTTYSCVGV+K+ +VE
Sbjct  104  WALVAVLVHVCCCLFGR--AVLVGAKDASSGGGKIEGPVIGIDLGTTYSCVGVFKNGKVE  161

Query  308  IIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDM  487
            IIAN+QGNRITPS+V FTD ERLIG+AAKNQ A NPERTIFDVKRLIGR+FD++ VQ+D+
Sbjct  162  IIANEQGNRITPSYVAFTDKERLIGDAAKNQLALNPERTIFDVKRLIGRRFDEETVQKDI  221

Query  488  KLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTV  667
            KL+PYK+VNKDGKPYI+V+++DGE K FSPEEISAMIL KMK+ AE +LGK +K+AVVTV
Sbjct  222  KLLPYKVVNKDGKPYIRVEVRDGEVKTFSPEEISAMILGKMKKIAEDYLGKPVKNAVVTV  281

Query  668  PAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            PAYFNDAQRQATKDAG IAGL V RIINEPTAAAIAYG
Sbjct  282  PAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIAYG  319



>ref|XP_003565461.1| PREDICTED: luminal-binding protein 2-like [Brachypodium distachyon]
Length=671

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 164/183 (90%), Gaps = 1/183 (1%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASN  412
            G VIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWV FTD+ ERLIGEAAKNQAASN
Sbjct  43   GPVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDSGERLIGEAAKNQAASN  102

Query  413  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  592
            P RTI+D KRLIGR++ D EV +DMK +PYKIV K GKP+++V++KDG+ +  SPEE+SA
Sbjct  103  PLRTIYDAKRLIGRQYGDAEVHKDMKHLPYKIVEKRGKPHMEVEVKDGDVRTLSPEEVSA  162

Query  593  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAI  772
            M+LT+MKETAEAFLG+ +KDAV+T+PAYFNDAQRQATKDAG IAGLNV R+INEPTAAAI
Sbjct  163  MVLTRMKETAEAFLGEPVKDAVITIPAYFNDAQRQATKDAGAIAGLNVVRLINEPTAAAI  222

Query  773  AYG  781
            AYG
Sbjct  223  AYG  225



>dbj|BAK06498.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +2

Query  236  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASN  412
            G VIGIDLGTTYSCV VY++ RVEIIANDQGNRITPSWV FTD+ ERLIGEAAKNQAA+N
Sbjct  39   GPVIGIDLGTTYSCVAVYRNGRVEIIANDQGNRITPSWVAFTDSGERLIGEAAKNQAAAN  98

Query  413  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  592
            P RT++D KRLIGR+F D EVQRDMKL+P+K+V+K+GKP+++V++K G+ + FSPEE+SA
Sbjct  99   PLRTVYDAKRLIGRQFIDAEVQRDMKLLPFKVVDKNGKPHVEVEVKAGDVRTFSPEEVSA  158

Query  593  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAI  772
            M+LT+MKETAEA+LG+ ++DAV+T+PAYFNDAQRQATKDAG IAGLNV R+INEPTAAAI
Sbjct  159  MVLTRMKETAEAYLGEKVRDAVITIPAYFNDAQRQATKDAGAIAGLNVVRLINEPTAAAI  218

Query  773  AYG  781
            AYG
Sbjct  219  AYG  221



>ref|XP_003867956.1| Ssa2 HSP70 chaperone, partial [Candida orthopsilosis Co 90-125]
 emb|CCG22520.1| Ssa2 HSP70 chaperone, partial [Candida orthopsilosis]
Length=211

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = +2

Query  233  LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASN  412
            +   +GIDLGTTYSCV  Y + RVEIIANDQGNR TPS+V FTD ERLIG+AAKNQAA N
Sbjct  1    MSKAVGIDLGTTYSCVAHYANDRVEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAIN  60

Query  413  PERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISA  592
            P  T+FD KRLIGRKFDD EVQ D+K  P+KIV+K GKP IQV+ K GETKVF+PEEIS+
Sbjct  61   PANTVFDAKRLIGRKFDDAEVQNDLKHFPFKIVDKGGKPNIQVEYK-GETKVFTPEEISS  119

Query  593  MILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAI  772
            M+L KMKETAE +LG T+KDAVVTVPAYFND+QRQATKDAG+IAGLNV RIINEPTAAAI
Sbjct  120  MVLGKMKETAEGYLGGTVKDAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAI  179

Query  773  AYG  781
            AYG
Sbjct  180  AYG  182



>ref|XP_006433443.1| hypothetical protein CICLE_v10003511mg, partial [Citrus clementina]
 gb|ESR46683.1| hypothetical protein CICLE_v10003511mg, partial [Citrus clementina]
Length=521

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 160/175 (91%), Gaps = 1/175 (1%)
 Frame = +2

Query  257  LGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDV  436
            +GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PERTIFDV
Sbjct  1    MGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPERTIFDV  60

Query  437  KRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKE  616
            KRLIG++FDD EVQRD+K +PYKIVNKDGKPY+QVK+K GETKVFSPEEISAM+L KMKE
Sbjct  61   KRLIGKRFDDAEVQRDIKFLPYKIVNKDGKPYVQVKVK-GETKVFSPEEISAMMLQKMKE  119

Query  617  TAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            TAE FLG  IK+AV+TVPAYFNDAQ+QATKDAGIIAGLNVA+IINEP AAAIA+G
Sbjct  120  TAETFLGMKIKNAVLTVPAYFNDAQKQATKDAGIIAGLNVAQIINEPAAAAIAHG  174



>ref|XP_002456746.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
 gb|EES01866.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
Length=667

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 182/225 (81%), Gaps = 12/225 (5%)
 Frame = +2

Query  131  AGGAWTRRTSLIVFGIVVFGSLFAFSIAK-------EEASKLGTVIGIDLGTTYSCVGVY  289
            A G WT+    ++F ++V G L   +  +       E     GTVIGIDLGTTYSCVGVY
Sbjct  3    ARGGWTK----LLFALLVAGLLPVVAPTRTYAAAAAEGGGARGTVIGIDLGTTYSCVGVY  58

Query  290  KDQRVEIIANDQGNRITPSWVGFTDN-ERLIGEAAKNQAASNPERTIFDVKRLIGRKFDD  466
            ++ RVEIIANDQGNRITPSWV FTD  ERLIGEAAKNQAA+NPERTI+D KRLIGR+FDD
Sbjct  59   RNGRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANPERTIYDAKRLIGRQFDD  118

Query  467  KEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTI  646
              VQRDMKL+ Y +V ++GKP+++V++++G+ +  SPEE+SAM+LTKMKETAEA+LG+ +
Sbjct  119  AVVQRDMKLLSYDVVERNGKPHVRVQVREGDVRELSPEEVSAMVLTKMKETAEAYLGEKV  178

Query  647  KDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
             DAVVTVPAYF+DAQRQATKDAG IAGLNV RIINEPTAAAIAYG
Sbjct  179  TDAVVTVPAYFDDAQRQATKDAGTIAGLNVRRIINEPTAAAIAYG  223



>ref|XP_006433439.1| hypothetical protein CICLE_v10003341mg, partial [Citrus clementina]
 gb|ESR46679.1| hypothetical protein CICLE_v10003341mg, partial [Citrus clementina]
Length=502

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 159/175 (91%), Gaps = 1/175 (1%)
 Frame = +2

Query  257  LGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDV  436
            +GTTYS VG+Y+D  VEIIANDQGNR TPSW+ FTD ERLIGEAAKNQAA +PERTIFDV
Sbjct  1    MGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPERTIFDV  60

Query  437  KRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKE  616
            KRLIG++FDD EVQRD+K +PYK+VNKDGKPY+QV +K GETKVFSPEEISAMIL KMKE
Sbjct  61   KRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVNVK-GETKVFSPEEISAMILQKMKE  119

Query  617  TAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            TAE FLG  IK+AV+TVPAYFNDAQRQATKDAGIIAGLNVA+IINEP AAAI++G
Sbjct  120  TAETFLGMKIKNAVLTVPAYFNDAQRQATKDAGIIAGLNVAQIINEPAAAAISHG  174



>emb|CEI96781.1| Putative Hsp70-like protein [Rhizopus microsporus]
Length=660

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 179/213 (84%), Gaps = 4/213 (2%)
 Frame = +2

Query  149  RRTSLIVFGIVVFGSLF--AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  322
            R+ SL+    ++F +LF  ++++  +E    GTVIGIDLGTTYSCV V K+ RVEIIAND
Sbjct  3    RKASLLALFALIF-TLFISSYTVKADEQESYGTVIGIDLGTTYSCVAVQKNGRVEIIAND  61

Query  323  QGNRITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPY  502
            QG+RITPS+V FTD+ERLIG+AAKNQ ++NP+RTIFD KRLIGR+FDDKEVQ+DMK  P+
Sbjct  62   QGHRITPSYVAFTDDERLIGDAAKNQYSANPKRTIFDAKRLIGRRFDDKEVQQDMKHFPF  121

Query  503  KIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFN  682
            ++VNK+G P I+V +K GE ++F+PEEIS M+LTKMKETAEA+LGK +  AVVTVPAYFN
Sbjct  122  EVVNKNGAPQIKVAVK-GEDRIFTPEEISGMVLTKMKETAEAYLGKPVTHAVVTVPAYFN  180

Query  683  DAQRQATKDAGIIAGLNVARIINEPTAAAIAYG  781
            DAQRQATKDAG IAGL + RI+NEPTAAAIAYG
Sbjct  181  DAQRQATKDAGTIAGLKILRIVNEPTAAAIAYG  213



>ref|XP_006655245.1| PREDICTED: luminal-binding protein 4-like [Oryza brachyantha]
Length=668

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +2

Query  239  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFTD-NERLIGEAAKNQAASNP  415
            TVIGIDLGTTYSCVGVY++ RVEIIANDQG+RITPSWV FTD  ERLIGEAAKNQAA+NP
Sbjct  42   TVIGIDLGTTYSCVGVYRNGRVEIIANDQGSRITPSWVAFTDAGERLIGEAAKNQAAANP  101

Query  416  ERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAM  595
            ERT++D KRLIGR+F D EVQRDMKL+P+ +V+K GKP+++V +KDG+ ++FSPEEISAM
Sbjct  102  ERTVYDAKRLIGRQFADDEVQRDMKLLPFAVVDKAGKPHVRVDVKDGDVRLFSPEEISAM  161

Query  596  ILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIA  775
            +L KMKETAEA+LG+ +  AVVTVPAYFNDAQRQATKDAG+IAGL V RIINEPTAAAIA
Sbjct  162  VLVKMKETAEAYLGEKVTRAVVTVPAYFNDAQRQATKDAGVIAGLRVDRIINEPTAAAIA  221

Query  776  YG  781
            YG
Sbjct  222  YG  223



>gb|EPB86036.1| glucose-regulated protein [Mucor circinelloides f. circinelloides 
1006PhL]
Length=659

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 175/209 (84%), Gaps = 3/209 (1%)
 Frame = +2

Query  161  LIVFGIVV--FGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  334
            L +F +++  F S F+   A E+    GTVIGIDLGTTYSCV V K+ RVEIIANDQG+R
Sbjct  8    LALFAVILALFVSTFSVQAAAEDKEAYGTVIGIDLGTTYSCVAVQKNGRVEIIANDQGHR  67

Query  335  ITPSWVGFTDNERLIGEAAKNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVN  514
            ITPS+V FTD+ERLIG+AAKNQ ++NPERT+FD KRLIGR+F+DKEV++DMK  P+ IVN
Sbjct  68   ITPSYVAFTDDERLIGDAAKNQFSANPERTVFDAKRLIGRRFNDKEVKQDMKHFPFTIVN  127

Query  515  KDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQR  694
            K+G P IQV +K+ E KVF+PEEIS M+LTKMKETAEA+LGK +  AVVTVPAYFNDAQR
Sbjct  128  KNGAPNIQVAVKN-EDKVFTPEEISGMVLTKMKETAEAYLGKPVTHAVVTVPAYFNDAQR  186

Query  695  QATKDAGIIAGLNVARIINEPTAAAIAYG  781
            QATKDAG IAGLN+ RI+NEPTAAAIAYG
Sbjct  187  QATKDAGTIAGLNIIRILNEPTAAAIAYG  215



>dbj|BAG57068.1| unnamed protein product [Homo sapiens]
Length=278

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  215  KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVGFT-DNERLIGEAA  391
            +++   +GTV+GIDLGTTYSCVGV+K+ RVEIIANDQGNRITPS+V FT + ERLIG+AA
Sbjct  21   EDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAA  80

Query  392  KNQAASNPERTIFDVKRLIGRKFDDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGETKVF  571
            KNQ  SNPE T+FD KRLIGR ++D  VQ+D+K +P+K+V K  KPYIQV I  G+TK F
Sbjct  81   KNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF  140

Query  572  SPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIIN  751
            +PEEISAM+LTKMKETAEA+LGK +  AVVTVPAYFNDAQRQATKDAG IAGLNV RIIN
Sbjct  141  APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIIN  200

Query  752  EPTAAAIAYG  781
            EPTAAAIAYG
Sbjct  201  EPTAAAIAYG  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1559042875252