BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5394

Length=891
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     254   6e-78   
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     253   2e-77   Populus euphratica
ref|NP_001234409.1|  protein kinase 1b                                  252   3e-77   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    252   5e-77   Nicotiana sylvestris
ref|XP_002314178.2|  Protein kinase capable of phosphorylating ty...    250   1e-76   
ref|XP_011035315.1|  PREDICTED: protein kinase APK1B, chloroplast...    248   2e-76   Populus euphratica
emb|CDP09060.1|  unnamed protein product                                249   5e-76   Coffea canephora [robusta coffee]
ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    249   6e-76   Populus euphratica
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    249   6e-76   Populus euphratica
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    249   8e-76   Populus trichocarpa [western balsam poplar]
emb|CBI16124.3|  unnamed protein product                                247   3e-75   Vitis vinifera
ref|XP_011089469.1|  PREDICTED: protein kinase APK1B, chloroplastic     246   1e-74   Sesamum indicum [beniseed]
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplastic     245   2e-74   Fragaria vesca subsp. vesca
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     246   4e-74   Vitis vinifera
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     244   6e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010043547.1|  PREDICTED: protein kinase APK1A, chloroplast...    243   2e-73   Eucalyptus grandis [rose gum]
ref|XP_002531440.1|  Protein kinase APK1A, chloroplast precursor,...    238   1e-72   
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     241   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007016403.1|  Kinase 1B isoform 1                                240   2e-72   
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...    238   7e-72   Prunus mume [ume]
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    238   1e-71   Sesamum indicum [beniseed]
ref|XP_010106485.1|  Protein kinase APK1A                               238   1e-71   Morus notabilis
emb|CDP06608.1|  unnamed protein product                                238   2e-71   Coffea canephora [robusta coffee]
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    238   3e-71   Prunus mume [ume]
ref|XP_012092540.1|  PREDICTED: protein kinase APK1B, chloroplast...    237   3e-71   Jatropha curcas
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       237   5e-71   Gossypium arboreum [tree cotton]
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...    237   5e-71   Elaeis guineensis
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     236   6e-71   Sesamum indicum [beniseed]
gb|KHG20116.1|  Protein kinase APK1B, chloroplastic -like protein       236   6e-71   Gossypium arboreum [tree cotton]
gb|KJB55870.1|  hypothetical protein B456_009G099000                    236   7e-71   Gossypium raimondii
ref|XP_007027015.1|  Kinase superfamily protein                         236   7e-71   
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             234   3e-70   
gb|EYU18976.1|  hypothetical protein MIMGU_mgv1a007452mg                234   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_010922319.1|  PREDICTED: probable serine/threonine-protein...    234   5e-70   Elaeis guineensis
gb|KJB55871.1|  hypothetical protein B456_009G099000                    236   5e-70   Gossypium raimondii
gb|KJB20070.1|  hypothetical protein B456_003G131600                    234   5e-70   Gossypium raimondii
gb|KJB20072.1|  hypothetical protein B456_003G131600                    234   5e-70   Gossypium raimondii
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    234   6e-70   
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    234   6e-70   
gb|KJB83756.1|  hypothetical protein B456_013G263600                    233   8e-70   Gossypium raimondii
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg             233   9e-70   Citrus clementina [clementine]
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                   233   9e-70   Citrus sinensis [apfelsine]
ref|NP_001240863.1|  protein kinase APK1A, chloroplastic-like           233   1e-69   Glycine max [soybeans]
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    233   2e-69   Nicotiana sylvestris
ref|NP_001242670.1|  uncharacterized protein LOC100798404               233   2e-69   Glycine max [soybeans]
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     231   6e-69   Glycine soja [wild soybean]
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    230   1e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB36715.1|  hypothetical protein B456_006G172600                    230   1e-68   Gossypium raimondii
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     230   2e-68   
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    230   2e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KHF99777.1|  Protein kinase APK1B, chloroplastic -like protein       229   2e-68   Gossypium arboreum [tree cotton]
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...    230   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002322956.2|  hypothetical protein POPTR_0016s11410g             230   3e-68   
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...    229   4e-68   Fragaria vesca subsp. vesca
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   228   5e-68   Citrus sinensis [apfelsine]
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             228   5e-68   Citrus clementina [clementine]
ref|XP_007150326.1|  hypothetical protein PHAVU_005G144200g             229   8e-68   Phaseolus vulgaris [French bean]
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    228   1e-67   Eucalyptus grandis [rose gum]
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    228   1e-67   Vitis vinifera
ref|XP_012074945.1|  PREDICTED: probable serine/threonine-protein...    227   1e-67   Jatropha curcas
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     228   1e-67   Eucalyptus grandis [rose gum]
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    228   1e-67   Cicer arietinum [garbanzo]
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    228   2e-67   Eucalyptus grandis [rose gum]
gb|ABK93253.1|  unknown                                                 219   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011011763.1|  PREDICTED: probable serine/threonine-protein...    227   2e-67   Populus euphratica
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...    227   3e-67   Nicotiana tomentosiformis
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...    227   3e-67   Solanum tuberosum [potatoes]
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    227   3e-67   
ref|XP_004487002.1|  PREDICTED: protein kinase APK1B, chloroplast...    228   3e-67   
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...    227   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    225   4e-67   Cucumis melo [Oriental melon]
dbj|BAE71262.1|  putative protein kinase APK1A                          226   4e-67   Trifolium pratense [peavine clover]
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    226   5e-67   Pyrus x bretschneideri [bai li]
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...    226   5e-67   Nicotiana sylvestris
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    226   5e-67   Cucumis melo [Oriental melon]
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    226   6e-67   
ref|XP_011657150.1|  PREDICTED: protein kinase APK1A, chloroplastic     226   6e-67   Cucumis sativus [cucumbers]
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                226   6e-67   Erythranthe guttata [common monkey flower]
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like           226   7e-67   Solanum tuberosum [potatoes]
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    226   9e-67   Glycine max [soybeans]
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    225   1e-66   Glycine max [soybeans]
ref|XP_007133997.1|  hypothetical protein PHAVU_010G010300g             225   1e-66   Phaseolus vulgaris [French bean]
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    225   2e-66   Phoenix dactylifera
ref|XP_002533148.1|  Protein kinase APK1B, chloroplast precursor,...    224   2e-66   Ricinus communis
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    223   2e-66   Glycine max [soybeans]
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK       224   2e-66   Morus notabilis
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...    224   3e-66   Solanum lycopersicum
ref|XP_008784588.1|  PREDICTED: protein kinase APK1A, chloroplast...    224   3e-66   Phoenix dactylifera
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...    224   3e-66   
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     224   4e-66   Glycine soja [wild soybean]
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    223   6e-66   Glycine max [soybeans]
ref|XP_009414323.1|  PREDICTED: probable serine/threonine-protein...    223   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB16969.1|  hypothetical protein B456_002G257500                    221   1e-65   Gossypium raimondii
ref|XP_009414322.1|  PREDICTED: probable serine/threonine-protein...    223   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557255.1|  PREDICTED: protein kinase APK1A, chloroplast...    221   4e-65   Tarenaya hassleriana [spider flower]
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...    220   6e-65   
ref|XP_010557253.1|  PREDICTED: protein kinase APK1A, chloroplast...    221   6e-65   
ref|XP_010557252.1|  PREDICTED: protein kinase APK1A, chloroplast...    221   6e-65   
ref|XP_010521843.1|  PREDICTED: protein kinase APK1A, chloroplast...    221   6e-65   Tarenaya hassleriana [spider flower]
ref|XP_004307510.1|  PREDICTED: protein kinase APK1A, chloroplast...    221   6e-65   Fragaria vesca subsp. vesca
gb|AFK44181.1|  unknown                                                 220   8e-65   Lotus japonicus
ref|XP_004246420.1|  PREDICTED: probable serine/threonine-protein...    221   8e-65   Solanum lycopersicum
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...    221   9e-65   
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             220   1e-64   Phaseolus vulgaris [French bean]
ref|XP_010325852.1|  PREDICTED: probable serine/threonine-protein...    220   1e-64   Solanum lycopersicum
dbj|BAJ98795.1|  predicted protein                                      216   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003616404.1|  Serine/threonine protein kinase                    214   2e-64   
ref|XP_008802716.1|  PREDICTED: protein kinase APK1B, chloroplast...    219   2e-64   Phoenix dactylifera
gb|KEH39440.1|  kinase 1B                                               219   2e-64   Medicago truncatula
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    219   3e-64   
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             219   3e-64   Citrus clementina [clementine]
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    219   3e-64   Citrus sinensis [apfelsine]
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          219   5e-64   Sorghum bicolor [broomcorn]
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    218   6e-64   Glycine max [soybeans]
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...    218   6e-64   
gb|ACF85751.1|  unknown                                                 213   9e-64   Zea mays [maize]
ref|XP_008810614.1|  PREDICTED: protein kinase APK1A, chloroplastic     218   1e-63   Phoenix dactylifera
gb|ACL52762.1|  unknown                                                 213   1e-63   Zea mays [maize]
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...    217   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_010658583.1|  PREDICTED: protein kinase APK1A, chloroplast...    215   3e-63   Vitis vinifera
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    216   3e-63   Cicer arietinum [garbanzo]
emb|CDP00097.1|  unnamed protein product                                216   4e-63   Coffea canephora [robusta coffee]
ref|XP_002283701.1|  PREDICTED: protein kinase APK1A, chloroplast...    216   5e-63   Vitis vinifera
ref|XP_006846202.1|  PREDICTED: probable serine/threonine-protein...    216   5e-63   Amborella trichopoda
gb|ACU19261.1|  unknown                                                 215   5e-63   Glycine max [soybeans]
ref|XP_007208720.1|  hypothetical protein PRUPE_ppa015273mg             213   7e-63   
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                216   7e-63   Erythranthe guttata [common monkey flower]
dbj|BAJ95924.1|  predicted protein                                      215   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004490921.1|  PREDICTED: protein kinase APK1A, chloroplast...    207   1e-62   
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...    215   1e-62   Setaria italica
ref|XP_010231839.1|  PREDICTED: protein kinase APK1B, chloroplast...    214   2e-62   Brachypodium distachyon [annual false brome]
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...    214   2e-62   Prunus mume [ume]
ref|NP_001054444.1|  Os05g0110900                                       214   2e-62   
gb|EEC78387.1|  hypothetical protein OsI_18165                          214   2e-62   Oryza sativa Indica Group [Indian rice]
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK            216   3e-62   Triticum urartu
ref|XP_009404596.1|  PREDICTED: protein kinase APK1A, chloroplast...    214   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654906.1|  PREDICTED: protein kinase APK1A, chloroplast...    214   4e-62   
gb|AFK40483.1|  unknown                                                 206   4e-62   Lotus japonicus
gb|ACG32116.1|  protein kinase APK1B                                    213   5e-62   Zea mays [maize]
gb|ACF87678.1|  unknown                                                 213   6e-62   Zea mays [maize]
ref|NP_001241128.1|  probable serine/threonine-protein kinase NAK...    213   9e-62   Glycine max [soybeans]
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             213   1e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    212   1e-61   Solanum lycopersicum
ref|XP_010542646.1|  PREDICTED: protein kinase APK1A, chloroplast...    211   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               212   2e-61   Theobroma cacao [chocolate]
ref|XP_003616403.1|  Serine/threonine protein kinase                    212   2e-61   Medicago truncatula
ref|XP_007218037.1|  hypothetical protein PRUPE_ppa006035mg             211   2e-61   
ref|NP_001145874.1|  uncharacterized protein LOC100279389               212   2e-61   Zea mays [maize]
ref|NP_001141912.1|  uncharacterized LOC100274061                       212   2e-61   Zea mays [maize]
ref|XP_011091519.1|  PREDICTED: probable serine/threonine-protein...    211   2e-61   Sesamum indicum [beniseed]
ref|XP_012089179.1|  PREDICTED: protein kinase APK1B, chloroplast...    212   2e-61   Jatropha curcas
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    212   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGU99598.1|  protein kinase                                          213   3e-61   Triticum aestivum [Canadian hard winter wheat]
gb|ABC74580.1|  rust resistance gene ABC1041                            212   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001241432.1|  probable serine/threonine-protein kinase NAK...    211   3e-61   Glycine max [soybeans]
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...    210   4e-61   Tarenaya hassleriana [spider flower]
gb|AAO18450.1|  putative protein kinase                                 211   4e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AFK41166.1|  unknown                                                 211   4e-61   Medicago truncatula
ref|XP_008457480.1|  PREDICTED: protein kinase APK1B, chloroplast...    209   5e-61   Cucumis melo [Oriental melon]
ref|NP_001051730.1|  Os03g0821900                                       211   5e-61   
ref|XP_008457478.1|  PREDICTED: protein kinase APK1B, chloroplast...    210   5e-61   Cucumis melo [Oriental melon]
ref|XP_007218038.1|  hypothetical protein PRUPE_ppa006035mg             211   6e-61   
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...    211   6e-61   
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             210   7e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             210   7e-61   
ref|XP_006417790.1|  hypothetical protein EUTSA_v10007756mg             210   8e-61   Eutrema salsugineum [saltwater cress]
gb|EMT32058.1|  Protein kinase APK1A, chloroplastic                     210   8e-61   
ref|XP_010937617.1|  PREDICTED: protein kinase APK1A, chloroplast...    210   8e-61   Elaeis guineensis
ref|XP_010678048.1|  PREDICTED: probable serine/threonine-protein...    209   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010678047.1|  PREDICTED: probable serine/threonine-protein...    210   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010937616.1|  PREDICTED: protein kinase APK1A, chloroplast...    210   1e-60   Elaeis guineensis
ref|XP_007140532.1|  hypothetical protein PHAVU_008G120600g             209   1e-60   Phaseolus vulgaris [French bean]
ref|XP_004145296.1|  PREDICTED: protein kinase APK1B, chloroplast...    209   1e-60   Cucumis sativus [cucumbers]
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...    209   2e-60   Solanum tuberosum [potatoes]
ref|XP_010501359.1|  PREDICTED: protein kinase APK1A, chloroplast...    206   2e-60   
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     209   2e-60   Nicotiana tomentosiformis
gb|EPS59398.1|  hypothetical protein M569_15409                         208   2e-60   Genlisea aurea
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    208   2e-60   Nicotiana sylvestris
ref|XP_011027201.1|  PREDICTED: protein kinase APK1A, chloroplastic     209   2e-60   Populus euphratica
gb|EYU33216.1|  hypothetical protein MIMGU_mgv1a011111mg                205   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_004492356.1|  PREDICTED: probable serine/threonine-protein...    209   3e-60   
ref|XP_002892407.1|  hypothetical protein ARALYDRAFT_470784             208   4e-60   
ref|XP_009140954.1|  PREDICTED: protein kinase APK1B, chloroplastic     208   4e-60   Brassica rapa
emb|CDX77220.1|  BnaC04g40150D                                          208   4e-60   
ref|XP_006294292.1|  hypothetical protein CARUB_v10023308mg             208   4e-60   Capsella rubella
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    207   5e-60   Eucalyptus grandis [rose gum]
ref|XP_011030315.1|  PREDICTED: protein kinase APK1A, chloroplast...    208   5e-60   Populus euphratica
ref|XP_004142067.1|  PREDICTED: probable serine/threonine-protein...    207   5e-60   Cucumis sativus [cucumbers]
gb|AGP76187.1|  MLPK                                                    208   6e-60   Brassica rapa subsp. chinensis [bok-choy]
gb|KHN32126.1|  Protein kinase APK1B, chloroplastic                     206   6e-60   Glycine soja [wild soybean]
emb|CDY31741.1|  BnaA04g16770D                                          208   7e-60   Brassica napus [oilseed rape]
ref|XP_004142761.1|  PREDICTED: probable serine/threonine-protein...    207   7e-60   Cucumis sativus [cucumbers]
ref|XP_009384874.1|  PREDICTED: protein kinase APK1B, chloroplast...    207   9e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384873.1|  PREDICTED: protein kinase APK1A, chloroplast...    207   1e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_172237.1|  protein kinase APK1A                                  207   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030960.1|  PREDICTED: protein kinase APK1A, chloroplast...    207   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010470021.1|  PREDICTED: protein kinase APK1B, chloroplast...    206   1e-59   
ref|XP_008447952.1|  PREDICTED: probable serine/threonine-protein...    206   1e-59   Cucumis melo [Oriental melon]
ref|NP_001240055.1|  protein kinase APK1A, chloroplastic-like           208   2e-59   Glycine max [soybeans]
ref|XP_009380641.1|  PREDICTED: probable serine/threonine-protein...    207   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384872.1|  PREDICTED: probable serine/threonine-protein...    207   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006591904.1|  PREDICTED: protein kinase APK1A, chloroplast...    207   2e-59   
ref|XP_010487664.1|  PREDICTED: protein kinase APK1A, chloroplastic     206   2e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001184929.1|  protein kinase APK1A                               207   2e-59   
ref|XP_010470019.1|  PREDICTED: protein kinase APK1B, chloroplast...    206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006307674.1|  hypothetical protein CARUB_v10009302mg             206   2e-59   
gb|ACF83789.1|  unknown                                                 205   2e-59   Zea mays [maize]
ref|XP_010470020.1|  PREDICTED: protein kinase APK1B, chloroplast...    206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010510562.1|  PREDICTED: protein kinase APK1B, chloroplast...    206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010510560.1|  PREDICTED: protein kinase APK1B, chloroplast...    206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006649840.1|  PREDICTED: protein kinase APK1B, chloroplast...    205   3e-59   Oryza brachyantha
ref|NP_001031439.1|  protein kinase APK1B                               206   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457947.1|  PREDICTED: protein kinase APK1A, chloroplast...    206   3e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001149364.1|  protein kinase APK1A                               205   3e-59   Zea mays [maize]
ref|XP_010111129.1|  Protein kinase APK1A                               209   3e-59   
gb|ACF82794.1|  unknown                                                 203   4e-59   Zea mays [maize]
ref|NP_001031440.1|  protein kinase APK1B                               206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic     206   4e-59   Cucumis melo [Oriental melon]
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg             205   4e-59   Eutrema salsugineum [saltwater cress]
ref|NP_001049704.1|  Os03g0274800                                       204   4e-59   
ref|NP_180459.2|  protein kinase APK1B                                  206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149460.1|  LOC100283086                                       205   4e-59   Zea mays [maize]
ref|XP_008654993.1|  PREDICTED: LOC100283086 isoform X2                 205   5e-59   
gb|ACF79269.1|  unknown                                                 204   5e-59   Zea mays [maize]
ref|XP_002879189.1|  hypothetical protein ARALYDRAFT_481810             206   6e-59   
gb|ABF95246.1|  Protein kinase APK1B, chloroplast precursor, puta...    204   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     204   7e-59   Solanum lycopersicum
ref|XP_010414461.1|  PREDICTED: protein kinase APK1B, chloroplast...    205   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010414460.1|  PREDICTED: protein kinase APK1B, chloroplast...    205   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009118427.1|  PREDICTED: protein kinase APK1A, chloroplastic     204   9e-59   Brassica rapa
gb|EEC72262.1|  hypothetical protein OsI_05407                          204   9e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010475518.1|  PREDICTED: protein kinase APK1A, chloroplast...    205   9e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009357737.1|  PREDICTED: probable serine/threonine-protein...    204   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_006409926.1|  hypothetical protein EUTSA_v10016722mg             204   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_008677038.1|  PREDICTED: protein kinase APK1A isoform X1         204   1e-58   Zea mays [maize]
ref|XP_008654992.1|  PREDICTED: LOC100283086 isoform X1                 205   1e-58   
ref|XP_006590337.1|  PREDICTED: uncharacterized protein LOC100809...    204   1e-58   Glycine max [soybeans]
ref|XP_006646742.1|  PREDICTED: protein kinase APK1A, chloroplast...    204   1e-58   
ref|XP_010227588.1|  PREDICTED: probable serine/threonine-protein...    205   2e-58   Brachypodium distachyon [annual false brome]
ref|NP_001045548.1|  Os01g0973500                                       203   3e-58   
gb|KDO82763.1|  hypothetical protein CISIN_1g010432mg                   200   3e-58   Citrus sinensis [apfelsine]
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...    203   4e-58   Camelina sativa [gold-of-pleasure]
gb|KDO82764.1|  hypothetical protein CISIN_1g010432mg                   200   4e-58   Citrus sinensis [apfelsine]
emb|CDX80814.1|  BnaC03g00680D                                          202   5e-58   
gb|KHG15912.1|  Protein kinase APK1A, chloroplastic                     202   5e-58   Gossypium arboreum [tree cotton]
gb|ACU18313.1|  unknown                                                 196   5e-58   Glycine max [soybeans]
ref|XP_009122790.1|  PREDICTED: probable serine/threonine-protein...    202   6e-58   Brassica rapa
emb|CDY40347.1|  BnaA10g27210D                                          202   6e-58   Brassica napus [oilseed rape]
ref|XP_002465484.1|  hypothetical protein SORBIDRAFT_01g039630          202   6e-58   Sorghum bicolor [broomcorn]
gb|ABK24429.1|  unknown                                                 204   7e-58   Picea sitchensis
ref|NP_001242718.1|  protein kinase APK1A, chloroplastic-like           202   8e-58   Glycine max [soybeans]
emb|CDX95143.1|  BnaC05g05280D                                          202   9e-58   
gb|KHN21952.1|  Protein kinase APK1A, chloroplastic                     204   9e-58   Glycine soja [wild soybean]
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             202   1e-57   
ref|XP_001758139.1|  predicted protein                                  203   1e-57   
ref|XP_008371735.1|  PREDICTED: probable serine/threonine-protein...    201   1e-57   Malus domestica [apple tree]
emb|CDY06715.1|  BnaA10g04940D                                          202   1e-57   
emb|CDY10453.1|  BnaCnng03540D                                          201   1e-57   Brassica napus [oilseed rape]
gb|AET14353.1|  protein kinase 1b                                       201   2e-57   Glycine max [soybeans]
ref|XP_003633841.1|  PREDICTED: probable receptor-like protein ki...    203   2e-57   Vitis vinifera
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...    200   2e-57   
ref|XP_009124367.1|  PREDICTED: protein kinase APK1B, chloroplast...    201   2e-57   Brassica rapa
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             201   2e-57   
gb|KFK24748.1|  hypothetical protein AALP_AA8G019600                    201   2e-57   Arabis alpina [alpine rockcress]
ref|XP_009118950.1|  PREDICTED: protein kinase APK1A, chloroplast...    201   2e-57   Brassica rapa
ref|XP_009124366.1|  PREDICTED: protein kinase APK1B, chloroplast...    201   2e-57   Brassica rapa
ref|XP_004984728.1|  PREDICTED: protein kinase APK1B, chloroplast...    200   2e-57   
emb|CDY09904.1|  BnaC08g45470D                                          201   3e-57   Brassica napus [oilseed rape]
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...    200   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_001776496.1|  predicted protein                                  201   3e-57   
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...    200   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002963908.1|  hypothetical protein SELMODRAFT_79963              199   3e-57   
ref|XP_002988311.1|  hypothetical protein SELMODRAFT_127709             199   4e-57   
ref|XP_007032485.1|  Kinase superfamily protein isoform 2               202   4e-57   
gb|KDO82762.1|  hypothetical protein CISIN_1g010432mg                   201   4e-57   Citrus sinensis [apfelsine]
gb|KJB75753.1|  hypothetical protein B456_012G055500                    202   5e-57   Gossypium raimondii
ref|XP_003558236.1|  PREDICTED: protein kinase APK1B, chloroplast...    199   5e-57   Brachypodium distachyon [annual false brome]
gb|KHG05986.1|  hypothetical protein F383_32908                         202   5e-57   Gossypium arboreum [tree cotton]
ref|XP_007032484.1|  Kinase superfamily protein isoform 1               202   6e-57   Theobroma cacao [chocolate]
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          199   7e-57   
ref|XP_010066959.1|  PREDICTED: probable receptor-like protein ki...    202   7e-57   
ref|XP_010066960.1|  PREDICTED: probable receptor-like protein ki...    202   7e-57   
ref|NP_001235430.1|  protein kinase                                     198   7e-57   
ref|XP_009130691.1|  PREDICTED: probable serine/threonine-protein...    199   7e-57   
emb|CDY55560.1|  BnaA03g54910D                                          199   8e-57   
ref|XP_003631281.1|  PREDICTED: probable receptor-like protein ki...    201   9e-57   
emb|CDY39519.1|  BnaC04g15180D                                          199   1e-56   
gb|ABR18367.1|  unknown                                                 201   1e-56   
ref|XP_006842103.1|  PREDICTED: probable receptor-like protein ki...    201   1e-56   
gb|KDO82757.1|  hypothetical protein CISIN_1g010432mg                   201   2e-56   
gb|EMT24219.1|  Protein kinase APK1A, chloroplastic                     199   2e-56   
ref|XP_006601720.1|  PREDICTED: protein kinase isoform X1               198   2e-56   
gb|KDO82759.1|  hypothetical protein CISIN_1g010432mg                   200   2e-56   
ref|XP_006483236.1|  PREDICTED: probable receptor-like protein ki...    201   2e-56   
ref|XP_003551987.1|  PREDICTED: probable receptor-like protein ki...    200   2e-56   
ref|XP_010250180.1|  PREDICTED: probable receptor-like protein ki...    199   2e-56   
ref|XP_006438612.1|  hypothetical protein CICLE_v10031362mg             200   2e-56   
emb|CAN82516.1|  hypothetical protein VITISV_008843                     200   2e-56   
ref|XP_002440455.1|  hypothetical protein SORBIDRAFT_09g001190          198   2e-56   
ref|XP_007132065.1|  hypothetical protein PHAVU_011G064000g             198   3e-56   
dbj|BAJ91316.1|  predicted protein                                      199   3e-56   
ref|NP_001151952.1|  LOC100285589                                       198   3e-56   
ref|XP_007139604.1|  hypothetical protein PHAVU_008G043900g             200   3e-56   
gb|KEH19837.1|  receptor-like kinase plant                              200   3e-56   
ref|NP_001167795.1|  uncharacterized LOC100381489                       194   3e-56   
ref|XP_007139605.1|  hypothetical protein PHAVU_008G043900g             199   3e-56   
ref|XP_002520138.1|  Protein kinase APK1B, chloroplast precursor,...    200   3e-56   
emb|CDY48100.1|  BnaC02g03570D                                          197   4e-56   
ref|XP_011463101.1|  PREDICTED: probable receptor-like protein ki...    199   4e-56   
ref|XP_004297338.1|  PREDICTED: probable receptor-like protein ki...    200   4e-56   
ref|XP_009125442.1|  PREDICTED: probable serine/threonine-protein...    197   4e-56   
gb|KHG15911.1|  Protein kinase APK1A, chloroplastic                     202   4e-56   
gb|KDO82758.1|  hypothetical protein CISIN_1g010432mg                   200   4e-56   
ref|XP_007046228.1|  Kinase superfamily protein                         200   4e-56   
ref|XP_008459299.1|  PREDICTED: probable receptor-like protein ki...    199   4e-56   
ref|NP_001150552.1|  LOC100284184                                       199   4e-56   
ref|XP_006357263.1|  PREDICTED: probable receptor-like protein ki...    199   5e-56   
ref|XP_002458067.1|  hypothetical protein SORBIDRAFT_03g026370          199   5e-56   
ref|XP_006378157.1|  hypothetical protein POPTR_0010s04270g             199   5e-56   
ref|XP_008459298.1|  PREDICTED: probable receptor-like protein ki...    199   5e-56   
ref|XP_003567536.1|  PREDICTED: probable serine/threonine-protein...    197   5e-56   
gb|ACN35886.1|  unknown                                                 199   5e-56   
ref|XP_007155041.1|  hypothetical protein PHAVU_003G168000g             197   5e-56   
ref|XP_008389526.1|  PREDICTED: probable receptor-like protein ki...    199   5e-56   
ref|XP_011655989.1|  PREDICTED: probable receptor-like protein ki...    199   5e-56   
emb|CDY04848.1|  BnaAnng00300D                                          197   5e-56   
ref|XP_004489995.1|  PREDICTED: probable receptor-like protein ki...    199   5e-56   
ref|XP_003569281.1|  PREDICTED: probable receptor-like protein ki...    199   5e-56   
ref|XP_009360398.1|  PREDICTED: probable receptor-like protein ki...    199   6e-56   
ref|XP_011655988.1|  PREDICTED: probable receptor-like protein ki...    199   6e-56   
ref|XP_004960525.1|  PREDICTED: protein kinase APK1A, chloroplast...    197   6e-56   
gb|KJB80035.1|  hypothetical protein B456_013G077800                    199   6e-56   
tpg|DAA58731.1|  TPA: putative protein kinase superfamily protein       199   6e-56   
ref|XP_010112470.1|  Receptor-like serine/threonine-protein kinase      198   6e-56   
emb|CDM83073.1|  unnamed protein product                                199   6e-56   
ref|XP_003532048.1|  PREDICTED: probable receptor-like protein ki...    199   6e-56   
ref|XP_002527168.1|  Protein kinase APK1B, chloroplast precursor,...    198   7e-56   
gb|KJB80036.1|  hypothetical protein B456_013G077800                    199   7e-56   
ref|XP_007155042.1|  hypothetical protein PHAVU_003G168000g             197   7e-56   
ref|XP_007222609.1|  hypothetical protein PRUPE_ppa004933mg             199   8e-56   
ref|XP_006587767.1|  PREDICTED: probable receptor-like protein ki...    198   8e-56   
gb|KHG18602.1|  hypothetical protein F383_24083                         199   9e-56   
ref|XP_003534465.1|  PREDICTED: probable receptor-like protein ki...    198   9e-56   
ref|XP_012091941.1|  PREDICTED: probable receptor-like protein ki...    199   9e-56   
ref|XP_004969384.1|  PREDICTED: probable receptor-like protein ki...    199   1e-55   
ref|XP_010242357.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
gb|KHG05340.1|  Protein kinase APK1A, chloroplastic -like protein       197   1e-55   
ref|XP_010927375.1|  PREDICTED: probable receptor-like protein ki...    196   1e-55   
ref|XP_010096340.1|  putative receptor-like protein kinase              198   1e-55   
ref|XP_004489165.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_003517927.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_010242356.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
gb|KJB76054.1|  hypothetical protein B456_012G070600                    196   1e-55   
ref|XP_010242355.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_004489164.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_011034212.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
gb|ABR16311.1|  unknown                                                 197   1e-55   
ref|XP_004238768.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_004509947.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_010242353.1|  PREDICTED: probable receptor-like protein ki...    198   1e-55   
ref|XP_010320662.1|  PREDICTED: probable receptor-like protein ki...    198   2e-55   
emb|CDP00286.1|  unnamed protein product                                198   2e-55   
gb|AAA18853.1|  protein kinase                                          196   2e-55   
ref|XP_009762091.1|  PREDICTED: probable receptor-like protein ki...    196   2e-55   
ref|XP_008339937.1|  PREDICTED: probable receptor-like protein ki...    198   2e-55   
emb|CDP10443.1|  unnamed protein product                                197   2e-55   
gb|KJB76051.1|  hypothetical protein B456_012G070600                    196   2e-55   
ref|XP_011013709.1|  PREDICTED: probable receptor-like protein ki...    196   2e-55   
ref|NP_001235445.1|  protein kinase                                     196   2e-55   
gb|KHN13655.1|  Putative receptor-like protein kinase                   197   2e-55   
ref|XP_006593328.1|  PREDICTED: protein kinase isoform X2               196   2e-55   
ref|XP_006600745.1|  PREDICTED: probable receptor-like protein ki...    196   2e-55   
ref|XP_009797575.1|  PREDICTED: probable receptor-like protein ki...    197   3e-55   
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    197   3e-55   
ref|XP_006601719.1|  PREDICTED: serine/threonine protein kinase-l...    197   3e-55   
ref|NP_001235470.1|  serine/threonine protein kinase-like protein       197   3e-55   
ref|XP_003609389.1|  Protein kinase 2B                                  196   3e-55   
ref|NP_001238522.1|  serine/threonine protein kinase-like protein       197   3e-55   
ref|XP_006646050.1|  PREDICTED: probable receptor-like protein ki...    196   3e-55   
ref|XP_006593327.1|  PREDICTED: protein kinase isoform X1               196   3e-55   
ref|XP_010927374.1|  PREDICTED: probable receptor-like protein ki...    195   3e-55   
gb|EAZ12511.1|  hypothetical protein OsJ_02407                          196   3e-55   
gb|ERN17929.1|  hypothetical protein AMTR_s00046p00017580               191   3e-55   
ref|XP_006600744.1|  PREDICTED: probable receptor-like protein ki...    196   3e-55   
ref|XP_003613590.1|  Serine/threonine protein kinase-like protein       197   3e-55   
ref|XP_012090290.1|  PREDICTED: probable serine/threonine-protein...    193   3e-55   
ref|XP_002311801.1|  hypothetical protein POPTR_0008s19920g             197   4e-55   
ref|XP_004508467.1|  PREDICTED: probable receptor-like protein ki...    196   4e-55   
ref|XP_012090282.1|  PREDICTED: probable serine/threonine-protein...    193   4e-55   
gb|AAU89742.1|  serine/threonine protein kinase-like                    199   4e-55   
ref|XP_006363918.1|  PREDICTED: probable receptor-like protein ki...    197   4e-55   
ref|XP_006574323.1|  PREDICTED: serine/threonine protein kinase-l...    197   4e-55   
ref|XP_004228384.1|  PREDICTED: probable receptor-like protein ki...    197   4e-55   
ref|XP_007163407.1|  hypothetical protein PHAVU_001G232300g             194   4e-55   
gb|KHN15066.1|  Putative receptor-like protein kinase                   196   4e-55   
ref|XP_009594393.1|  PREDICTED: probable receptor-like protein ki...    197   4e-55   
dbj|BAA20968.1|  protein tyrosine-serine-threonine kinase               189   4e-55   
ref|XP_009594394.1|  PREDICTED: probable receptor-like protein ki...    197   4e-55   
ref|XP_008457019.1|  PREDICTED: probable receptor-like protein ki...    196   4e-55   
ref|XP_004150205.1|  PREDICTED: probable receptor-like protein ki...    195   5e-55   
ref|XP_008443961.1|  PREDICTED: probable receptor-like protein ki...    195   5e-55   
ref|XP_008457027.1|  PREDICTED: probable serine/threonine-protein...    196   5e-55   
ref|XP_009762090.1|  PREDICTED: probable receptor-like protein ki...    196   6e-55   
ref|XP_007157391.1|  hypothetical protein PHAVU_002G066400g             196   6e-55   
ref|XP_004139295.1|  PREDICTED: probable receptor-like protein ki...    195   6e-55   
ref|XP_011013708.1|  PREDICTED: probable receptor-like protein ki...    196   6e-55   
ref|XP_007157381.1|  hypothetical protein PHAVU_002G065500g             196   6e-55   
gb|KJB73944.1|  hypothetical protein B456_011G261900                    194   6e-55   
ref|XP_009599240.1|  PREDICTED: probable receptor-like protein ki...    196   6e-55   
ref|NP_001043435.1|  Os01g0588500                                       197   6e-55   
gb|EAY74738.1|  hypothetical protein OsI_02628                          196   6e-55   
gb|KJB54000.1|  hypothetical protein B456_009G015800                    195   7e-55   
gb|KEH34698.1|  tyrosine kinase family protein                          192   8e-55   
ref|XP_002305322.2|  hypothetical protein POPTR_0004s13410g             196   9e-55   
ref|XP_008230724.1|  PREDICTED: probable receptor-like protein ki...    196   9e-55   
ref|XP_007217722.1|  hypothetical protein PRUPE_ppa005147mg             196   9e-55   
ref|XP_010906943.1|  PREDICTED: protein kinase 2B, chloroplastic-...    193   9e-55   
gb|KEH34699.1|  tyrosine kinase family protein                          192   1e-54   
gb|KHN17927.1|  Protein kinase APK1B, chloroplastic                     192   1e-54   
ref|XP_008341535.1|  PREDICTED: probable receptor-like protein ki...    196   1e-54   
ref|XP_009116239.1|  PREDICTED: probable receptor-like protein ki...    193   1e-54   
gb|KJB40826.1|  hypothetical protein B456_007G078700                    196   1e-54   
ref|XP_010554040.1|  PREDICTED: probable receptor-like protein ki...    195   1e-54   
gb|KJB40825.1|  hypothetical protein B456_007G078700                    196   1e-54   
ref|XP_009116240.1|  PREDICTED: probable receptor-like protein ki...    193   1e-54   
emb|CDY40221.1|  BnaA09g35030D                                          193   1e-54   
ref|XP_011020169.1|  PREDICTED: probable receptor-like protein ki...    194   1e-54   
ref|XP_006400026.1|  hypothetical protein EUTSA_v10013316mg             196   2e-54   
gb|KHG19731.1|  hypothetical protein F383_25550                         194   2e-54   
gb|KJB06473.1|  hypothetical protein B456_001G044200                    194   2e-54   
gb|KJB06472.1|  hypothetical protein B456_001G044200                    194   2e-54   
ref|XP_009335822.1|  PREDICTED: probable receptor-like protein ki...    195   2e-54   
ref|XP_010935290.1|  PREDICTED: probable serine/threonine-protein...    194   2e-54   
gb|KFK25744.1|  hypothetical protein AALP_AA8G154000                    196   2e-54   
ref|XP_004135195.1|  PREDICTED: probable receptor-like protein ki...    195   2e-54   
gb|KDP30253.1|  hypothetical protein JCGZ_17035                         194   2e-54   
emb|CDP02215.1|  unnamed protein product                                196   2e-54   
ref|XP_008446315.1|  PREDICTED: probable receptor-like protein ki...    195   2e-54   
ref|XP_006381117.1|  hypothetical protein POPTR_0006s06500g             193   2e-54   
ref|XP_011020168.1|  PREDICTED: receptor-like serine/threonine-pr...    194   3e-54   
ref|XP_008808474.1|  PREDICTED: probable receptor-like protein ki...    195   3e-54   
ref|XP_011003187.1|  PREDICTED: probable receptor-like protein ki...    195   3e-54   
gb|ABK93629.1|  unknown                                                 193   3e-54   
gb|KCW52800.1|  hypothetical protein EUGRSUZ_J02135                     194   3e-54   
ref|XP_008808482.1|  PREDICTED: probable receptor-like protein ki...    194   3e-54   
ref|XP_011003188.1|  PREDICTED: probable receptor-like protein ki...    194   3e-54   
ref|XP_010925062.1|  PREDICTED: probable receptor-like protein ki...    195   3e-54   
ref|XP_012081202.1|  PREDICTED: probable receptor-like protein ki...    194   3e-54   
ref|XP_010420160.1|  PREDICTED: probable receptor-like protein ki...    195   3e-54   
ref|XP_006844578.1|  PREDICTED: probable serine/threonine-protein...    193   3e-54   
ref|XP_010925061.1|  PREDICTED: probable receptor-like protein ki...    194   3e-54   
gb|EPS69141.1|  hypothetical protein M569_05623                         192   3e-54   
ref|XP_011078389.1|  PREDICTED: receptor-like serine/threonine-pr...    193   3e-54   
tpg|DAA61160.1|  TPA: putative protein kinase superfamily protein       193   3e-54   
gb|ABR16273.1|  unknown                                                 193   3e-54   
emb|CDX70589.1|  BnaC03g06730D                                          195   3e-54   
ref|XP_002308064.1|  hypothetical protein POPTR_0006s06500g             193   3e-54   
ref|XP_010492331.1|  PREDICTED: probable receptor-like protein ki...    195   3e-54   
emb|CDY41231.1|  BnaC08g26270D                                          192   3e-54   
ref|XP_006474421.1|  PREDICTED: probable receptor-like protein ki...    193   3e-54   
ref|XP_006453077.1|  hypothetical protein CICLE_v10008365mg             193   3e-54   
ref|NP_197012.1|  probable receptor-like protein kinase                 194   3e-54   
ref|XP_010033218.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    194   4e-54   
gb|KEH34697.1|  tyrosine kinase family protein                          192   4e-54   
dbj|BAD23327.1|  putative serine/threonine protein kinase               190   4e-54   
ref|XP_002871647.1|  hypothetical protein ARALYDRAFT_909477             194   4e-54   
ref|XP_009393735.1|  PREDICTED: receptor-like serine/threonine-pr...    190   4e-54   
ref|XP_003621108.1|  Protein kinase 2B                                  194   4e-54   
ref|XP_008808456.1|  PREDICTED: probable receptor-like protein ki...    194   4e-54   
gb|AES77326.2|  receptor-like kinase plant                              194   5e-54   
ref|XP_008808442.1|  PREDICTED: probable receptor-like protein ki...    194   5e-54   
ref|XP_002323829.2|  hypothetical protein POPTR_0017s11370g             194   5e-54   
gb|KEH34700.1|  tyrosine kinase family protein                          192   5e-54   
ref|XP_009342878.1|  PREDICTED: probable receptor-like protein ki...    194   5e-54   
ref|XP_002323831.2|  hypothetical protein POPTR_0017s11370g             194   5e-54   
dbj|BAC57958.1|  serine/threonine protein kinase                        193   5e-54   
ref|XP_009342879.1|  PREDICTED: probable receptor-like protein ki...    194   5e-54   
ref|XP_008357757.1|  PREDICTED: probable receptor-like protein ki...    194   5e-54   
ref|XP_009131434.1|  PREDICTED: probable receptor-like protein ki...    194   5e-54   
ref|XP_008357756.1|  PREDICTED: probable receptor-like protein ki...    194   6e-54   
ref|XP_009798207.1|  PREDICTED: probable receptor-like protein ki...    194   6e-54   
ref|XP_007032445.1|  Kinase superfamily protein isoform 1               193   7e-54   
ref|XP_010256402.1|  PREDICTED: probable receptor-like protein ki...    194   7e-54   
ref|XP_002976449.1|  hypothetical protein SELMODRAFT_151233             193   7e-54   
ref|XP_010931968.1|  PREDICTED: probable receptor-like protein ki...    192   7e-54   
ref|XP_009798208.1|  PREDICTED: probable receptor-like protein ki...    193   7e-54   
ref|XP_002979837.1|  hypothetical protein SELMODRAFT_153518             193   7e-54   
ref|XP_010256394.1|  PREDICTED: probable receptor-like protein ki...    193   8e-54   
ref|XP_010108963.1|  putative receptor-like protein kinase              194   8e-54   
ref|XP_006856462.2|  PREDICTED: probable receptor-like protein ki...    190   8e-54   
ref|XP_006286494.1|  hypothetical protein CARUB_v10000765mg             194   9e-54   
ref|XP_006358299.1|  PREDICTED: probable receptor-like protein ki...    192   9e-54   
ref|XP_002460108.1|  hypothetical protein SORBIDRAFT_02g022880          194   1e-53   
ref|XP_007013526.1|  Receptor serine/threonine-protein kinase           192   1e-53   
ref|XP_007151194.1|  hypothetical protein PHAVU_004G026000g             193   1e-53   
ref|XP_010245739.1|  PREDICTED: serine/threonine-protein kinase A...    191   1e-53   
ref|XP_009393734.1|  PREDICTED: receptor-like serine/threonine-pr...    191   1e-53   
ref|NP_001062980.1|  Os09g0361100                                       191   1e-53   
ref|XP_008793500.1|  PREDICTED: probable receptor-like protein ki...    192   1e-53   
ref|XP_006431068.1|  hypothetical protein CICLE_v10011575mg             193   1e-53   



>ref|XP_009590400.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590401.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590402.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=404

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 151/204 (74%), Gaps = 27/204 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEY++TGHL++KSDVYSFGVVLLEMLSGRR ID N
Sbjct  227  LAKDGPTGDKSHVSTRVMGTYGYAAPEYMATGHLTSKSDVYSFGVVLLEMLSGRRAIDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKRKVFRVLD+RLEGQY+++V+ KVANLAL CLSKDPRFR +M
Sbjct  287  RPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEGQYSMDVASKVANLALRCLSKDPRFRSSM  346

Query  531  DDVVKELEQL-KESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
             D+VKELEQL ++SKD             + RS G      + + + D            
Sbjct  347  SDIVKELEQLYQQSKDAG-----------NTRSHGNNRPRPRRRSAGDVG----------  385

Query  354  dgDAISRNATAAYPRPSTSPLYAK  283
                 +++A+ AYPRPS SPLYAK
Sbjct  386  -----NKHASVAYPRPSASPLYAK  404



>ref|XP_011042707.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=405

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 149/202 (74%), Gaps = 26/202 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ KV+ LAL CLS D +FRPTM
Sbjct  290  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAYKVSTLALRCLSVDTKFRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  L QL++SK+  T +N H G++H  R   A +                       
Sbjct  350  DEVVTALVQLQDSKETGT-ANGHVGNKHRIRRRSAND-----------------------  385

Query  351  gDAISRNATAAYPRPSTSPLYA  286
              A    +TAAYPRPS SPLYA
Sbjct  386  --ATGGGSTAAYPRPSASPLYA  405



>ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum]
 gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum]
Length=401

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 151/206 (73%), Gaps = 31/206 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEY++TGHL++KSDVYSFGVVLLEMLSGRR ID N
Sbjct  224  LAKDGPTGDKSHVSTRVMGTYGYAAPEYMATGHLTSKSDVYSFGVVLLEMLSGRRAIDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKRKVFRVLD+RLEGQY++EV+ KVANLAL CLSKDPRFRP+M
Sbjct  284  RPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEGQYSMEVASKVANLALRCLSKDPRFRPSM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTT---Lgsrrrr  361
             D+VKE+EQL +                            Q KES +T +      R RR
Sbjct  344  SDIVKEMEQLYQ----------------------------QSKESGNTRSHASNRPRPRR  375

Query  360  rsdgDAISRNATAAYPRPSTSPLYAK  283
            RS  D  +RN + AYPRPS SP YAK
Sbjct  376  RSANDVANRNPSVAYPRPSASPPYAK  401



>ref|XP_009774717.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009774718.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=404

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 149/204 (73%), Gaps = 27/204 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLEMLSGRR ID N
Sbjct  227  LAKDGPTGDKSHVSTRVMGTYGYAAPEYMATGHLTTKSDVYSFGVVLLEMLSGRRAIDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKRKVFRVLD+RLEGQY+++V+ KVANLAL CLSKDPRFR +M
Sbjct  287  RPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEGQYSMDVASKVANLALRCLSKDPRFRSSM  346

Query  531  DDVVKELEQL-KESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
             D+VKELEQL ++SKD             + RS G      + + + D            
Sbjct  347  SDIVKELEQLYQQSKDAG-----------NTRSHGNNRPRPRRRSAGDVG----------  385

Query  354  dgDAISRNATAAYPRPSTSPLYAK  283
                 +++ + AYPRPS SPLYAK
Sbjct  386  -----NKHTSVAYPRPSASPLYAK  404



>ref|XP_002314178.2| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE88133.2| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=382

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 148/202 (73%), Gaps = 26/202 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  207  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  266

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LDSRLEGQY+++V+ KV+ LAL CLS + +FRPTM
Sbjct  267  RPSGEHNLVEWAKPYLANKRKIFRILDSRLEGQYSMDVAYKVSTLALRCLSIETKFRPTM  326

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++SK+  T +N H G++   R   A +                       
Sbjct  327  DEVVTALEQLQDSKETGT-ANGHVGNKPRIRRRSAND-----------------------  362

Query  351  gDAISRNATAAYPRPSTSPLYA  286
              A    + AAYPRPS SPLYA
Sbjct  363  --ATGGGSIAAYPRPSASPLYA  382



>ref|XP_011035315.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Populus euphratica]
Length=337

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 30/204 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRV+GTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  162  LAKDGPTGDKSHVSTRVIGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  221

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K + LAL CLS + +FRPTM
Sbjct  222  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKASTLALRCLSIETKFRPTM  281

Query  531  DDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            D+VV  +EQL++SK+ T  +N H  +  R HRRS            ++DT          
Sbjct  282  DEVVTAMEQLQDSKE-TGSANGHASNAPRIHRRS------------ADDT----------  318

Query  357  sdgDAISRNATAAYPRPSTSPLYA  286
                 IS   TAAYPRPSTS LYA
Sbjct  319  -----ISGRNTAAYPRPSTSALYA  337



>emb|CDP09060.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 144/203 (71%), Gaps = 26/203 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL++KSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTSKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKRK+FR+LD+RLEGQY+L+V  K ANLA  C+S DPRFRPTM
Sbjct  290  RPTGEHNLVEWAKPYLTNKRKIFRILDNRLEGQYSLDVGYKAANLAFRCISMDPRFRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            +++VKELE +++S     + N        RR             ++D             
Sbjct  350  NEIVKELEHIQDSNSKEKIGNNAPARSRPRR-----------LSADD-------------  385

Query  351  gDAISRNATAAYPRPSTSPLYAK  283
              A  RN  AAYPRPS SPL++K
Sbjct  386  --ARKRNIPAAYPRPSASPLFSK  406



>ref|XP_011035309.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035310.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035311.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035312.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
Length=407

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 30/204 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRV+GTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPTGDKSHVSTRVIGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K + LAL CLS + +FRPTM
Sbjct  292  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKASTLALRCLSIETKFRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            D+VV  +EQL++SK+ T  +N H  +  R HRRS            ++DT          
Sbjct  352  DEVVTAMEQLQDSKE-TGSANGHASNAPRIHRRS------------ADDT----------  388

Query  357  sdgDAISRNATAAYPRPSTSPLYA  286
                 IS   TAAYPRPSTS LYA
Sbjct  389  -----ISGRNTAAYPRPSTSALYA  407



>ref|XP_011035314.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Populus euphratica]
Length=405

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 30/204 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRV+GTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGDKSHVSTRVIGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K + LAL CLS + +FRPTM
Sbjct  290  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKASTLALRCLSIETKFRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            D+VV  +EQL++SK+ T  +N H  +  R HRRS            ++DT          
Sbjct  350  DEVVTAMEQLQDSKE-TGSANGHASNAPRIHRRS------------ADDT----------  386

Query  357  sdgDAISRNATAAYPRPSTSPLYA  286
                 IS   TAAYPRPSTS LYA
Sbjct  387  -----ISGRNTAAYPRPSTSALYA  405



>ref|XP_002299870.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE84675.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=405

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 152/204 (75%), Gaps = 30/204 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRV+GTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGDKSHVSTRVIGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K + LAL CLS + +FRPTM
Sbjct  290  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKASTLALRCLSIETKFRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            D+VV  +EQL++SK+ T  +N H  +  R  RRS            ++DT          
Sbjct  350  DEVVTAMEQLQDSKE-TGSANGHASNAPRIRRRS------------ADDT----------  386

Query  357  sdgDAISRNATAAYPRPSTSPLYA  286
                 IS   TAAYPRPSTSPLYA
Sbjct  387  -----ISGRNTAAYPRPSTSPLYA  405



>emb|CBI16124.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 144/201 (72%), Gaps = 27/201 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+LE + K +NLAL CLS + +FRPTM
Sbjct  290  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSLEGAHKASNLALRCLSTEAKFRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LEQL++ K+    +N+  G +H RRS       A  KE   T            
Sbjct  350  TEVVTALEQLQDCKEPEITNNRSGGMKHRRRS-------ADDKEKPTTAI----------  392

Query  351  gDAISRNATAAYPRPSTSPLY  289
                      AYPRPS SPLY
Sbjct  393  ----------AYPRPSASPLY  403



>ref|XP_011089469.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
 ref|XP_011089470.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
Length=406

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 152/207 (73%), Gaps = 34/207 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSGRR ID N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSYGVVLLEILSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LVEW++PYLANKRKV+R++D+RLEGQYT++V+QKVANLA  C+S +PR RP M
Sbjct  290  RPPGEHKLVEWSRPYLANKRKVYRIMDNRLEGQYTMDVAQKVANLASRCISLEPRLRPKM  349

Query  531  DDVVKELEQLKESKDMTTLSNKH----DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrr  364
            +++VKELEQL++S +M    N H    +GSR  RRS G                      
Sbjct  350  EEIVKELEQLQDSNNM---DNNHIKTQNGSRQRRRSAG----------------------  384

Query  363  rrsdgDAISRNATAAYPRPSTSPLYAK  283
                 DA ++ A AAYPRPS SP ++K
Sbjct  385  -----DAGNKIANAAYPRPSASPPHSK  406



>ref|XP_004294513.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011461211.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 147/202 (73%), Gaps = 18/202 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR +D N
Sbjct  224  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAVDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKP+LANKRK+FRV+D+RLEGQY+++ + K A LAL CLS + + RPTM
Sbjct  284  RPSGEHNLVEWAKPFLANKRKIFRVIDNRLEGQYSMDGAYKAATLALRCLSTESKLRPTM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVK LEQL++S    T SN+    R  RRS   V +  +    E              
Sbjct  344  DEVVKALEQLQDSN--VTTSNQSHAHRMRRRSADDVSKARRASIDEANK-----------  390

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                +RN T AYPRPS SPLYA
Sbjct  391  ----ARN-TVAYPRPSASPLYA  407



>ref|XP_002283646.2| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
 ref|XP_010651014.1| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
Length=442

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 153/212 (72%), Gaps = 11/212 (5%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+LE + K +NLAL CLS + +FRPTM
Sbjct  290  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSLEGAHKASNLALRCLSTEAKFRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEE----------LAQLKESEDTTT  382
             +VV  LEQL++ K+    +N+  G +H RRS   V            L+     ++   
Sbjct  350  TEVVTALEQLQDCKEPEITNNRSGGMKHRRRSADDVRNEKPPIATPYPLSADDARKEKPV  409

Query  381  LgsrrrrrsdgDAISRNATA-AYPRPSTSPLY  289
            + S   + +D     +  TA AYPRPS SPLY
Sbjct  410  IPSAHPQSADYAKKEKPTTAIAYPRPSASPLY  441



>ref|XP_010256925.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
 ref|XP_010256926.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=415

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 148/204 (73%), Gaps = 20/204 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKRK+FRVLDSRLEGQY++  +QK ANLAL CLS + RFRP M
Sbjct  290  RPSGEHNLVEWAKPYLTNKRKIFRVLDSRLEGQYSMGGAQKAANLALQCLSTEARFRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++ KD+    N  +G+ H  R++ +       + + D             
Sbjct  350  DEVVTTLEQLQDLKDVE--RNTQNGN-HPNRANHSTGGTRSRRRNADE------------  394

Query  351  gDAISRNATAA-YPRPSTSPLYAK  283
                 +N  AA YPRPS SPLY++
Sbjct  395  ----GQNGKAASYPRPSASPLYSR  414



>ref|XP_010043547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043548.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043549.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043550.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW85564.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85565.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85566.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
Length=406

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 144/204 (71%), Gaps = 29/204 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKS+VSTRVMGT+GYAAPEYL+TGHLS KSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSYVSTRVMGTHGYAAPEYLATGHLSTKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL+NKRKVFRVLD+RL+GQY++E + + A LAL CLS D +FRPTM
Sbjct  290  RPSGEHNLVEWAKPYLSNKRKVFRVLDNRLQGQYSMEGAYRTATLALRCLSMDAKFRPTM  349

Query  531  DDVVKELEQLKESKDMTTL--SNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            D+VV ELEQL+ESK       S    G R  RRS            ++D           
Sbjct  350  DEVVTELEQLQESKVSKNAGDSRPSSGQRMRRRS------------ADDGN---------  388

Query  357  sdgDAISRNATAAYPRPSTSPLYA  286
                  +R    AYPRPSTSPLYA
Sbjct  389  ------ARTRAVAYPRPSTSPLYA  406



>ref|XP_002531440.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30952.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=336

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 142/202 (70%), Gaps = 25/202 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR ID N
Sbjct  160  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAIDKN  219

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY +EV+ K A L L C+S +P+FRP M
Sbjct  220  RPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYPMEVAYKAATLTLRCISTEPKFRPNM  279

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D++V  LEQL++SK   + +   +  R  RR           + ++D             
Sbjct  280  DEIVTSLEQLQDSKGTESNNTNSNNVRRIRR-----------RSADDACN----------  318

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                 RN    YPRPS SPLYA
Sbjct  319  ---GGRN-VVTYPRPSPSPLYA  336



>ref|XP_010264446.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=413

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 144/203 (71%), Gaps = 20/203 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LVEWAKPYL NKRK+FR+LD+RLEGQY+L  +QK ANLAL CLS + ++RPTM
Sbjct  290  RPSGEHILVEWAKPYLTNKRKIFRILDNRLEGQYSLTGAQKAANLALQCLSTEAKYRPTM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRR-SDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D+VV  LEQL++SKD    +   +   H  R + G         ES++            
Sbjct  350  DEVVAALEQLQDSKDTVRDTQNGNHPNHESRPTSGTRPRRRSADESQN------------  397

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                  R A A YPRPS SPLYA
Sbjct  398  ------RKA-APYPRPSASPLYA  413



>ref|XP_007016403.1| Kinase 1B isoform 1 [Theobroma cacao]
 gb|EOY34022.1| Kinase 1B isoform 1 [Theobroma cacao]
Length=405

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 145/204 (71%), Gaps = 32/204 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FRVLD+RLEGQY++E + K A LAL CLS D +FRP M
Sbjct  290  RPSGEHNLVEWAKPYLANKRKLFRVLDNRLEGQYSMEGAHKAATLALRCLSIDAKFRPRM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGS---RHHRRSDGAVEELAQLKESEDTTTLgsrrrr  361
            ++VV  LEQL+ S +  + SN+ D S   R  RRS G                       
Sbjct  350  NEVVTALEQLQNSNE--SGSNQIDISSTPRVRRRSAG-----------------------  384

Query  360  rsdgDAISRNATAAYPRPSTSPLY  289
                DAI   +T AYPRPS SPLY
Sbjct  385  ----DAIGGKSTVAYPRPSASPLY  404



>ref|XP_008240890.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=396

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 142/202 (70%), Gaps = 28/202 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRV+GT GYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  223  LARDGPTGDKSHVSTRVIGTQGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  282

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+VFRV+DSRLEGQY+L  +QK ANLAL CLS D ++RP +
Sbjct  283  RPTGEHNLVEWAKPYLRNKRRVFRVIDSRLEGQYSLNRAQKAANLALQCLSIDSKYRPDV  342

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VV  LE+L+E+KDM   + K +    H  S+GA                         
Sbjct  343  NEVVTTLEELQETKDMQKSTQKENHVTSHGHSNGAPNA----------------------  380

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                SR    AYPRPS SPL+A
Sbjct  381  ----SR--VTAYPRPSASPLFA  396



>ref|XP_011077648.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Sesamum 
indicum]
Length=417

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 145/202 (72%), Gaps = 19/202 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+L+G++ ID N
Sbjct  235  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILTGKKAIDKN  294

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR++FRVLD+RLEGQY+L  + K ANLAL CL  D R RPTM
Sbjct  295  RPSGEHNLVEWAKPYLTNKRRIFRVLDARLEGQYSLGQAVKAANLALQCLYVDARSRPTM  354

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++SKD +    KH  S    +++GA +  +  + +E+T            
Sbjct  355  DEVVTALEQLQDSKDTSKNDQKHHRSSRRNQTNGAPK--SWRRSAEET------------  400

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                 R    AYPRPS S  YA
Sbjct  401  -----RRGKPAYPRPSASSRYA  417



>ref|XP_010106485.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC10661.1| Protein kinase APK1A [Morus notabilis]
Length=402

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 142/201 (71%), Gaps = 25/201 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDV+SFGVVLLEMLSGRR +D N
Sbjct  226  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVFSFGVVLLEMLSGRRAVDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAK Y+ANKRK+FR+LD+RLEGQY+++V+ K A LAL CLS +P+FRP M
Sbjct  286  RPSGEHNLVEWAKSYMANKRKIFRILDNRLEGQYSMDVAYKAATLALRCLSTEPKFRPNM  345

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VV  LEQL++S +     N  +  R   R   A E                       
Sbjct  346  EEVVTVLEQLQDSNEPNNRRNSGNAPRPRTRRRSADE-----------------------  382

Query  351  gDAISRNATAAYPRPSTSPLY  289
              A++R +  +YPRPS SPLY
Sbjct  383  --ALTRRSVGSYPRPSASPLY  401



>emb|CDP06608.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 143/212 (67%), Gaps = 40/212 (19%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLEMLSG++ ID N
Sbjct  232  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEMLSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR++FR+LD+RLEGQY++  + +VANLA+HCLS DP+ RP+M
Sbjct  292  RPTGEHNLVEWAKPYLTNKRRIFRILDARLEGQYSMGRALRVANLAIHCLSVDPKVRPSM  351

Query  531  DDVVKELEQLKESK----------DMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTT  382
            D+VV  LEQL++ K           +    N   G RH RRS    EE   +        
Sbjct  352  DEVVTTLEQLQDLKGTSNHDQKDSQLNLDGNSGGGPRHCRRS---AEEAPGM--------  400

Query  381  LgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  286
                                AYPRPS SPLYA
Sbjct  401  -------------------TAYPRPSASPLYA  413



>ref|XP_008223637.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
 ref|XP_008223643.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=414

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 145/202 (72%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR +D N
Sbjct  228  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAVDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKP+LANKRK+FR++D+RLEGQY+++ + K A+LA  CLS + + RP M
Sbjct  288  RPSGEHNLVEWAKPFLANKRKIFRIIDNRLEGQYSMDGAYKAASLASRCLSTESKLRPNM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+++   +   N  +G R  RRS            ++D           + 
Sbjct  348  DEVVTALEQLQDNG--SGQGNASNGQRMRRRS------------ADDAIKAKRAAADATK  393

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                SRN T AYPRPS SPLYA
Sbjct  394  AANESRN-TVAYPRPSASPLYA  414



>ref|XP_012092540.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Jatropha 
curcas]
 gb|KDP20446.1| hypothetical protein JCGZ_05291 [Jatropha curcas]
Length=404

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 140/201 (70%), Gaps = 26/201 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD SHVSTR+MGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  229  LAKDGPTGDNSHVSTRIMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LVEWAKPYL NKRK+FR+LD+RLEGQY+++++ K A LAL CLS + +FRP M
Sbjct  289  RPTGEHVLVEWAKPYLGNKRKIFRILDNRLEGQYSMDIANKAATLALRCLSIESKFRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++SK++  + N H GS    R           + S D             
Sbjct  349  DEVVTSLEQLQDSKEIGNV-NTHSGSAQRMR-----------RHSADD------------  384

Query  351  gDAISRNATAAYPRPSTSPLY  289
              A      AAYPRPS  PLY
Sbjct  385  --ASGGRTAAAYPRPSAFPLY  403



>gb|KHG10966.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=418

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 140/202 (69%), Gaps = 26/202 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHLSA+SDVYSFGVVLLEMLSGRR +D N
Sbjct  243  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLSARSDVYSFGVVLLEMLSGRRAVDKN  302

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LVEWAKPYLANKRK+FRVLD+RLEGQYT+E + K A LAL CL  D +FRP+M
Sbjct  303  RPSGEHKLVEWAKPYLANKRKIFRVLDNRLEGQYTIEGAFKAATLALRCLLIDAKFRPSM  362

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VV  LEQL++S D     N  +     RR            +S D  T          
Sbjct  363  NEVVTALEQLQDSNDSRINHNNTNSVPRRRR------------QSADDAT----------  400

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                   +T AYP+PS SPLYA
Sbjct  401  ----GGRSTTAYPQPSASPLYA  418



>ref|XP_010920578.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Elaeis guineensis]
Length=420

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 143/210 (68%), Gaps = 37/210 (18%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  240  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  299

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYLA+KRK+FR+LD+RL GQY+L  +QK A +A+ CLS + ++RP M
Sbjct  300  RPPGEHNLVEWARPYLASKRKIFRILDTRLGGQYSLGGAQKAAGIAVQCLSAEAKYRPNM  359

Query  531  DDVVKELEQLKESKDMTT--------LSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLg  376
            D+VV  LEQL+++KD            S   +  RHHRRS            SE+     
Sbjct  360  DEVVSALEQLQDAKDAGKNPQTERKLSSQSSNAQRHHRRS------------SEEAG---  404

Query  375  srrrrrsdgDAISRNATAAYPRPSTSPLYA  286
                          N   AYPRPS SPLYA
Sbjct  405  --------------NRKGAYPRPSASPLYA  420



>ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplastic [Sesamum indicum]
Length=414

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 144/202 (71%), Gaps = 20/202 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+L+G++ ID N
Sbjct  233  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILTGKKAIDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL NKR++FRVLD+RLEGQYT+  + K ANLAL CLS D R RP M
Sbjct  293  RPTGEHNLIEWAKPYLTNKRRIFRVLDARLEGQYTVGRAVKAANLALQCLSMDARSRPNM  352

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+ESKD TTL N     R +R S       +    +E+T            
Sbjct  353  DEVVIALEQLQESKD-TTLKNDQKDHRLNRHSQSNGGPKSCRSSTEET------------  399

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                   A +AYPRPS S LYA
Sbjct  400  ------QAASAYPRPSAS-LYA  414



>gb|KHG20116.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=404

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 144/203 (71%), Gaps = 28/203 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  229  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FRVLD+RLE QY++E + K A LAL CLS + +FRP M
Sbjct  289  RPSGEHNLVEWAKPYLANKRKIFRVLDNRLERQYSMEAAFKAATLALRCLSAEAKFRPRM  348

Query  531  DDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LEQL++S +  +  +N     R  RRS G            DT           
Sbjct  349  NEVVTALEQLQDSGECGSNPNNISSKPRIRRRSTG------------DTN----------  386

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                 +  +TAAYPRPS SPLYA
Sbjct  387  -----NGRSTAAYPRPSASPLYA  404



>gb|KJB55870.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55872.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=404

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 144/203 (71%), Gaps = 28/203 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  229  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANK K+FRVLD+RLEGQY++E + K A LAL CLS + +FRP M
Sbjct  289  RPSGEHNLVEWAKPYLANKCKIFRVLDNRLEGQYSMEAAFKAATLALRCLSAEAKFRPRM  348

Query  531  DDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
             +VV  LEQL++S +  +  +N     R  RRS G            DT+          
Sbjct  349  KEVVTALEQLQDSGECGSNPNNISSKPRIRRRSTG------------DTS----------  386

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                 +  +TAAYPRPS SPLYA
Sbjct  387  -----NGRSTAAYPRPSASPLYA  404



>ref|XP_007027015.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07517.1| Kinase superfamily protein [Theobroma cacao]
Length=398

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  230  LARDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR++FRVLD+RL+GQY+L   QKVANLAL CL+ +P+FRP+M
Sbjct  290  RPQGEHNLVEWAKPYLTNKRRIFRVLDTRLQGQYSLNRVQKVANLALQCLAVEPKFRPSM  349

Query  531  DDVVKELEQLKESKDM  484
            D+VV ELEQ +E  DM
Sbjct  350  DEVVTELEQFQEPGDM  365



>ref|XP_007205264.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
 gb|EMJ06463.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
Length=414

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 143/202 (71%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR +D N
Sbjct  228  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAVDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKP+LANKRK+FR++D+RLEGQY+++ + K A+LA  CLS + + RP M
Sbjct  288  RPSGEHNLVEWAKPFLANKRKIFRIIDNRLEGQYSMDGAYKAASLASRCLSTESKLRPNM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+++   +   N  +G R  RRS            ++D           + 
Sbjct  348  DEVVTALEQLQDNG--SGQGNASNGQRMRRRS------------ADDVIKAKRAAADANK  393

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                S N   AYPRPS SPLYA
Sbjct  394  AANKSSN-IVAYPRPSASPLYA  414



>gb|EYU18976.1| hypothetical protein MIMGU_mgv1a007452mg [Erythranthe guttata]
Length=407

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYS+GVVLLE++SGRR ID N
Sbjct  226  LAKDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSYGVVLLELMSGRRAIDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LV+W+KPYLANKRKV+RV+D+RLEGQYT++V+QKVA LAL C+S +PR RP M
Sbjct  286  RPTGEHKLVDWSKPYLANKRKVYRVMDNRLEGQYTIDVAQKVAALALKCISLEPRLRPKM  345

Query  531  DDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDG  430
            ++VVKE+EQL++  ++ +  S  H+GSR  RRS G
Sbjct  346  EEVVKEIEQLQDFSNLDSNRSGSHNGSRQRRRSVG  380



>ref|XP_010922319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=409

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDK+HVSTRV+GTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  234  LAKDGPTGDKTHVSTRVIGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L V+QK A LALHCLS + RFRPTM
Sbjct  294  RPPGEHNLVEWARPYLPHKRKIFRVLDTRLEGQYSLGVAQKAAALALHCLSTEARFRPTM  353

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQ  409
            D+VV  LEQL+++KD T   ++ +   H R    +  EL+Q
Sbjct  354  DEVVSTLEQLQDNKD-TAKKSESEPKEHSRSLGNSGHELSQ  393



>gb|KJB55871.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55873.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=475

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 144/203 (71%), Gaps = 28/203 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  300  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAVDKN  359

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANK K+FRVLD+RLEGQY++E + K A LAL CLS + +FRP M
Sbjct  360  RPSGEHNLVEWAKPYLANKCKIFRVLDNRLEGQYSMEAAFKAATLALRCLSAEAKFRPRM  419

Query  531  DDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
             +VV  LEQL++S +  +  +N     R  RRS G            DT+          
Sbjct  420  KEVVTALEQLQDSGECGSNPNNISSKPRIRRRSTG------------DTS----------  457

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                 +  +TAAYPRPS SPLYA
Sbjct  458  -----NGRSTAAYPRPSASPLYA  475



>gb|KJB20070.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
 gb|KJB20071.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=418

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 140/202 (69%), Gaps = 26/202 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHLSA+SDVYSFGVVLLE+LSGRRV+D N
Sbjct  243  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLSARSDVYSFGVVLLEILSGRRVVDKN  302

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LVEWAKPYLANKRK+F VLD+RLEGQYT+E + K A LAL CLS   +FRP+M
Sbjct  303  RPSGEHKLVEWAKPYLANKRKIFHVLDNRLEGQYTIEGAFKAATLALRCLSIAAKFRPSM  362

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VV  LEQL++S D     N  +     RR            +S D  T          
Sbjct  363  NEVVTALEQLQDSNDSRINHNNTNSVPRRRR------------QSADDAT----------  400

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                   +T AYP+PS SPLYA
Sbjct  401  ----GGRSTTAYPQPSASPLYA  418



>gb|KJB20072.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=400

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 140/202 (69%), Gaps = 26/202 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHLSA+SDVYSFGVVLLE+LSGRRV+D N
Sbjct  225  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLSARSDVYSFGVVLLEILSGRRVVDKN  284

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH LVEWAKPYLANKRK+F VLD+RLEGQYT+E + K A LAL CLS   +FRP+M
Sbjct  285  RPSGEHKLVEWAKPYLANKRKIFHVLDNRLEGQYTIEGAFKAATLALRCLSIAAKFRPSM  344

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VV  LEQL++S D     N  +     RR            +S D  T          
Sbjct  345  NEVVTALEQLQDSNDSRINHNNTNSVPRRRR------------QSADDAT----------  382

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                   +T AYP+PS SPLYA
Sbjct  383  ----GGRSTTAYPQPSASPLYA  400



>ref|XP_009610451.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD+SHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  247  LARDGPTGDQSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  306

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+VFRVLDSRLEGQY L  + KVANLA+ CLS DP+ RPTM
Sbjct  307  RPTGEHNLVEWAKPYLTNKRRVFRVLDSRLEGQYLLNRAIKVANLAVQCLSMDPKSRPTM  366

Query  531  DDVVKELEQLKESKDM  484
            D+VV  LEQL+ESKD+
Sbjct  367  DEVVTALEQLQESKDL  382



>ref|XP_009610452.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=414

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD+SHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  233  LARDGPTGDQSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+VFRVLDSRLEGQY L  + KVANLA+ CLS DP+ RPTM
Sbjct  293  RPTGEHNLVEWAKPYLTNKRRVFRVLDSRLEGQYLLNRAIKVANLAVQCLSMDPKSRPTM  352

Query  531  DDVVKELEQLKESKDM  484
            D+VV  LEQL+ESKD+
Sbjct  353  DEVVTALEQLQESKDL  368



>gb|KJB83756.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
 gb|KJB83757.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
Length=402

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 144/203 (71%), Gaps = 27/203 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSG R +D N
Sbjct  224  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGHRAVDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH+LV+WAKPYLANKRK+FRVLDSRLEGQY++E + KVA LAL C+S +P+FRP M
Sbjct  284  RPSGEHSLVDWAKPYLANKRKMFRVLDSRLEGQYSMEGAFKVATLALRCISTEPKFRPRM  343

Query  531  DDVVKELEQLKESKDM-TTLSNKHDGS-RHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            ++VV  LEQL+ S +  + LSN    + R  RRS       A       +TT        
Sbjct  344  NEVVIVLEQLQNSNESGSNLSNNTSSTPRIRRRS-------ADNPSGGRSTT--------  388

Query  357  sdgDAISRNATAAYPRPSTSPLY  289
                      T AYPRPS SPLY
Sbjct  389  ----------TTAYPRPSASPLY  401



>ref|XP_006424836.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006424837.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006488335.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Citrus sinensis]
 gb|ESR38076.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 gb|ESR38077.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
Length=404

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 145/203 (71%), Gaps = 29/203 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRK+FR++D+RLEGQYTLE + K A LAL CLS + +FRP M
Sbjct  290  RPSGEHNLVEWAKPYLASKRKIFRIIDNRLEGQYTLEGAYKAATLALRCLSTEGKFRPMM  349

Query  531  DDVVKELEQLKESKDMTTL-SNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
             +VV  LEQL++S +   +  N H+  +  R S            ++D            
Sbjct  350  AEVVTVLEQLQDSSETGNIRCNTHNRPKIRRHS------------ADD------------  385

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
               A SR+ T AYPRPS SPLYA
Sbjct  386  ---ARSRSVT-AYPRPSASPLYA  404



>gb|KDO72843.1| hypothetical protein CISIN_1g046897mg [Citrus sinensis]
Length=404

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 145/203 (71%), Gaps = 29/203 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRK+FR++D+RLEGQYTLE + K A LAL CLS + +FRP M
Sbjct  290  RPSGEHNLVEWAKPYLASKRKIFRIIDNRLEGQYTLEGAYKAATLALRCLSTEGKFRPMM  349

Query  531  DDVVKELEQLKESKDMTTL-SNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
             +VV  LEQL++S +   +  N H+  +  R S            ++D            
Sbjct  350  AEVVTVLEQLQDSSETGNIRCNTHNRPKIRRHS------------ADD------------  385

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
               A SR+ T AYPRPS SPLYA
Sbjct  386  ---ARSRSVT-AYPRPSASPLYA  404



>ref|NP_001240863.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006593429.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89549.1| putative protein kinase [Glycine max]
 gb|KHN30169.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=419

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 14/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSG+R +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGKRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKP++ANKRK+FRVLD+RL+GQY+ + + K+A LAL CLS + +FRP M
Sbjct  290  RPSGQHNLVEWAKPFMANKRKIFRVLDTRLQGQYSTDDAYKLATLALRCLSIESKFRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D VV  LEQL+       LSN + G R  RRS          +  ++ +++   R RR  
Sbjct  350  DQVVTTLEQLQ-------LSNVNGGPRVRRRSADVN------RGHQNPSSVNGSRVRRRS  396

Query  351  gDAISRNATA-AYPRPSTSPLY  289
             D ISR  T  AYPRPS SPLY
Sbjct  397  ADDISRLETPNAYPRPSASPLY  418



>ref|XP_009772470.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772479.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=415

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD+SHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  233  LARDGPTGDQSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+VFRVLDSRLEGQY L  + KVANLA+ CLS DP+ RPTM
Sbjct  293  RPTGEHNLVEWAKPYLTNKRRVFRVLDSRLEGQYLLNRAIKVANLAVQCLSMDPKSRPTM  352

Query  531  DDVVKELEQLKESKDM  484
            D+VV  LEQL+ESKD+
Sbjct  353  DEVVTALEQLQESKDV  368



>ref|NP_001242670.1| uncharacterized protein LOC100798404 [Glycine max]
 gb|ACU24124.1| unknown [Glycine max]
Length=422

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 149/203 (73%), Gaps = 13/203 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSG+R +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGKRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYLANKRK+FRVLD+RLEGQY+ + + K+A LAL CLS + +FRP M
Sbjct  290  RPSGQHNLVEWAKPYLANKRKIFRVLDTRLEGQYSTDDACKLATLALRCLSIESKFRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKH-DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D+VV  LEQL+    +  ++  H +GSR  RRS       A +       ++   R RR 
Sbjct  350  DEVVTTLEQLQ----VPNVNGGHQNGSRVRRRS-------ADVNRGYQNPSVNGSRVRRR  398

Query  354  dgDAISRNAT-AAYPRPSTSPLY  289
              D IS   T  AYPRPS SPLY
Sbjct  399  SADDISPMETPTAYPRPSASPLY  421



>gb|KHN33381.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=422

 Score =   231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 149/203 (73%), Gaps = 13/203 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSG+R +D N
Sbjct  230  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGKRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYLANKRK+FRVLD+RLEGQY+ + + K+A LAL CLS + +FRP M
Sbjct  290  RPSGQHNLVEWAKPYLANKRKIFRVLDTRLEGQYSTDDACKLATLALRCLSIESKFRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKH-DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D+VV  LEQL+    +  ++  H +GSR  RRS       A +       ++   R RR 
Sbjct  350  DEVVTTLEQLQ----VPNVNGGHQNGSRVRRRS-------ADVNRGYQNPSVNGSRVRRR  398

Query  354  dgDAISRNAT-AAYPRPSTSPLY  289
              D IS   T  AYPRPS SPLY
Sbjct  399  SADDISPMETPTAYPRPSASPLY  421



>ref|XP_010685751.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  228  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAMDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL NKRK+FR+LD+RLEGQY+L+ + KVA+LA  CLS +P+FRP M
Sbjct  288  RPSGEHNLVEWARPYLTNKRKIFRILDNRLEGQYSLDAAFKVASLAFRCLSSEPKFRPLM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  436
            ++VVKELEQL++S      S+   G R  RRS
Sbjct  348  NEVVKELEQLQDSSKEAR-SSSSTGGRTRRRS  378



>gb|KJB36715.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=397

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  229  LARDGPTGDRSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAIDNN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLV+WAKPYL NKR++FRVLD+RL+GQY+L  +Q+ ANLA  CL+ +P+ RP+M
Sbjct  289  RPSGEHNLVDWAKPYLTNKRRIFRVLDTRLQGQYSLTRAQEAANLAHQCLAVEPKLRPSM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG  430
            D+VV  LE+L+E+ DM   + K      H RS+G
Sbjct  349  DEVVTALEKLQETGDMPKRNQKERRGNAHNRSNG  382



>ref|XP_008357182.1| PREDICTED: protein kinase APK1A, chloroplastic [Malus domestica]
Length=418

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 141/203 (69%), Gaps = 11/203 (5%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR +D N
Sbjct  226  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAVDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKP+L NKRKVFR++D+RLEGQY+++ + K A LA  CLS + + RP M
Sbjct  286  RPSGEHNLVEWAKPFLINKRKVFRIIDNRLEGQYSMDGAHKAATLAARCLSTESKLRPNM  345

Query  531  DDVVKELEQLKE-SKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D+VVK LEQL + + +  T SN   G R  RRS       A            +     +
Sbjct  346  DEVVKTLEQLPDYNPNGGTQSN---GQRMRRRS-------ADDASKAKRAAAAAAAAADA  395

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
               A     T AYPRPS SPLYA
Sbjct  396  IKAANKARNTVAYPRPSASPLYA  418



>ref|XP_010685750.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+A+SDVYSFGVVLLEMLSGRR +D N
Sbjct  237  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTARSDVYSFGVVLLEMLSGRRAMDKN  296

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL NKRK+FR+LD+RLEGQY+L+ + KVA+LA  CLS +P+FRP M
Sbjct  297  RPSGEHNLVEWARPYLTNKRKIFRILDNRLEGQYSLDAAFKVASLAFRCLSSEPKFRPLM  356

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  436
            ++VVKELEQL++S      S+   G R  RRS
Sbjct  357  NEVVKELEQLQDSSKEAR-SSSSTGGRTRRRS  387



>gb|KHF99777.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=402

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 144/203 (71%), Gaps = 27/203 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  224  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH+LV+WAKPYLANKRK+FRVLDSRLEGQY++E + KVA LAL C+S +P+FRP M
Sbjct  284  RPSGEHSLVDWAKPYLANKRKMFRVLDSRLEGQYSMEGAFKVATLALRCISIEPKFRPRM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGS--RHHRRSDGAVEELAQLKESEDTTTLgsrrrrr  358
            ++VV  LEQL+ S +  +  + +  S  R  RRS       +       +TT        
Sbjct  344  NEVVIVLEQLQNSNESGSSLSNNTSSTPRIRRRS-------SDYPSGGRSTT--------  388

Query  357  sdgDAISRNATAAYPRPSTSPLY  289
                      T AYPRPS SPLY
Sbjct  389  ----------TTAYPRPSASPLY  401



>ref|XP_009414410.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 142/201 (71%), Gaps = 18/201 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  233  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FR++D+RLEGQY+L+ +QKVA+LA +CLS D +FRP+M
Sbjct  293  RPHGEHNLVEWARPYLTHKRKIFRIIDNRLEGQYSLDGAQKVASLAQNCLSMDAKFRPSM  352

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D +V  L+QL+++K   T  +  +  R      G  +    LK+     +L         
Sbjct  353  DQMVSTLQQLQDTKQTGTPPSAEEKVRARSVGSGG-DTRVSLKDFRGDGSLK--------  403

Query  351  gDAISRNATAAYPRPSTSPLY  289
                       YPRPS SPLY
Sbjct  404  ---------VTYPRPSASPLY  415



>ref|XP_002322956.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
 gb|EEF04717.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
Length=428

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 139/203 (68%), Gaps = 34/203 (17%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD SHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR ID N
Sbjct  259  LARDGPTGDNSHVSTRVMGTHGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAIDKN  318

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL NKR+VFRVLD+RLEGQY    +QK++NLAL CL+ +P+FRP M
Sbjct  319  RPSGQHNLVEWAKPYLTNKRRVFRVLDTRLEGQYVPSRAQKLSNLALQCLAVEPKFRPNM  378

Query  531  DDVVKELEQLKES-KDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D+VV  LEQL+E  KD+  +S+K     H+ +  G                         
Sbjct  379  DEVVMVLEQLQEQVKDIPKISHKE----HNLKVRGG------------------------  410

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                 +     AYPRPS SPLYA
Sbjct  411  -----ANGGQIAYPRPSASPLYA  428



>ref|XP_004302742.1| PREDICTED: probable serine/threonine-protein kinase NAK [Fragaria 
vesca subsp. vesca]
Length=403

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 140/203 (69%), Gaps = 25/203 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRV+GT GYAAPEYL+TGHL+AKSD+Y FGVVLLEMLSGRR ID N
Sbjct  225  LARDGPTGDKSHVSTRVIGTQGYAAPEYLATGHLTAKSDIYGFGVVLLEMLSGRRAIDRN  284

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+V RV+D RLEGQY+L  +QK A+LAL CLS DP++RP M
Sbjct  285  RPAGEHNLVEWAKPYLTNKRRVLRVIDPRLEGQYSLNRAQKAASLALQCLSTDPKYRPDM  344

Query  531  DDVVKELEQLKE-SKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LEQL++ +KDM     K     HH  S+G    L +   + D            
Sbjct  345  NEVVTTLEQLQDTTKDMPKGGQKE----HHATSNG----LPKRSSANDAPN---------  387

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                     T  YPRPS +PL+A
Sbjct  388  -------RVTVNYPRPSANPLFA  403



>gb|KDO51148.1| hypothetical protein CISIN_1g015909mg [Citrus sinensis]
Length=398

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 135/200 (68%), Gaps = 33/200 (17%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLE+LSGRR ID N
Sbjct  230  LARDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEILSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL +KR++FRVLD RLEGQ++L  +QK A+LAL CLS +P+ RP M
Sbjct  290  RPTGEHNLVEWAKPYLTSKRRIFRVLDPRLEGQFSLPQAQKAASLALQCLSVEPKLRPDM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVKELEQL+E ++M     K   ++ H    G                          
Sbjct  350  DEVVKELEQLQELRNMHKRPQKEHQAKGHVHFKGRA------------------------  385

Query  351  gDAISRNATAAYPRPSTSPL  292
                       YPRPS SPL
Sbjct  386  ---------TTYPRPSASPL  396



>ref|XP_006429091.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
 ref|XP_006480830.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Citrus sinensis]
 gb|ESR42331.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
Length=398

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 135/200 (68%), Gaps = 33/200 (17%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLE+LSGRR ID N
Sbjct  230  LARDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEILSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL +KR++FRVLD RLEGQ++L  +QK A+LAL CLS +P+ RP M
Sbjct  290  RPTGEHNLVEWAKPYLTSKRRIFRVLDPRLEGQFSLPQAQKAASLALQCLSVEPKLRPDM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVKELEQL+E ++M     K   ++ H    G                          
Sbjct  350  DEVVKELEQLQELRNMHKRPQKEHQAKGHVHFKGRA------------------------  385

Query  351  gDAISRNATAAYPRPSTSPL  292
                       YPRPS SPL
Sbjct  386  ---------TTYPRPSASPL  396



>ref|XP_007150326.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
 gb|ESW22320.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
Length=422

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 148/206 (72%), Gaps = 19/206 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL++KSDVYSFGVVLLEMLSG+R +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTSKSDVYSFGVVLLEMLSGKRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+H+LVEW KP+LANKRK+FRVLD+RLEGQY+ + + KVANLAL CLS D +FRP M
Sbjct  290  RPSGQHSLVEWGKPFLANKRKIFRVLDTRLEGQYSTDDAYKVANLALRCLSIDSKFRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGS----RHHRRSDGAVEELAQLKESEDTTTLgsrrr  364
            D+VV  LEQL+       + N ++G+    R  RRS       A +       ++   R 
Sbjct  350  DEVVTTLEQLQ-------VPNANEGNQNLCRVRRRS-------ADVSRGYQNPSVNGSRA  395

Query  363  rrsdgDAISRNAT-AAYPRPSTSPLY  289
            RR   D  SR  T + YPRPS SPLY
Sbjct  396  RRRSADDFSRMETPSTYPRPSASPLY  421



>ref|XP_010047712.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Eucalyptus 
grandis]
Length=398

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 137/202 (68%), Gaps = 22/202 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPT DKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVY FGVVLLE+LSG+R ID N
Sbjct  218  LARDGPTDDKSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYGFGVVLLELLSGQRAIDKN  277

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G HNLVEWAKPYL NKR++FRV+DSRLEGQY+++ +QK A LAL C+S + R RPTM
Sbjct  278  RPAGHHNLVEWAKPYLTNKRRIFRVIDSRLEGQYSMDQAQKAAFLALQCISTEARARPTM  337

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D++V  LEQL+E K   T S   D     RRS  A     +    E +            
Sbjct  338  DEIVTSLEQLQELKG--TRSTHKDRRSVGRRSSNAAPRACRSSAEEVS------------  383

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                     AAYPRPS SPLYA
Sbjct  384  --------AAAYPRPSASPLYA  397



>ref|XP_002266032.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654281.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654282.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI30550.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL +KRK+FRV+D+RLEGQY+L+ +QK A LAL CL  +PR RP M
Sbjct  290  RPSGEHNLVEWAKPYLTSKRKIFRVIDTRLEGQYSLDRAQKAAMLALQCLLTEPRARPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSD  433
            D+VV  LEQ+ E KD    + K   S H  R +
Sbjct  350  DEVVTALEQICEPKDKLRSTTKEQHSNHQSRPN  382



>ref|XP_012074945.1| PREDICTED: probable serine/threonine-protein kinase NAK [Jatropha 
curcas]
 gb|KDP35639.1| hypothetical protein JCGZ_09077 [Jatropha curcas]
Length=392

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+LSGRR +D N
Sbjct  230  LARDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEILSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL NK++VFR+LD+RL+GQY+L  +QKVANLAL+CL  +P+FRP M
Sbjct  290  RPSGQHNLVEWAKPYLTNKKRVFRILDTRLDGQYSLTRAQKVANLALNCLDVEPKFRPNM  349

Query  531  DDVVKELEQLKES----KDMTTLSNKHDGSRHHRRSDGAV  424
            ++VVK LE+++ES    +++TT  N   G   + R   ++
Sbjct  350  EEVVKALEEVQESNKKEENLTTHGNTKTGKIAYPRPSASL  389



>gb|KCW88940.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=408

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 137/202 (68%), Gaps = 22/202 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPT DKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVY FGVVLLE+LSG+R ID N
Sbjct  228  LARDGPTDDKSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYGFGVVLLELLSGQRAIDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G HNLVEWAKPYL NKR++FRV+DSRLEGQY+++ +QK A LAL C+S + R RPTM
Sbjct  288  RPAGHHNLVEWAKPYLTNKRRIFRVIDSRLEGQYSMDQAQKAAFLALQCISTEARARPTM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D++V  LEQL+E K   T S   D     RRS  A     +    E +            
Sbjct  348  DEIVTSLEQLQELKG--TRSTHKDRRSVGRRSSNAAPRACRSSAEEVS------------  393

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                     AAYPRPS SPLYA
Sbjct  394  --------AAAYPRPSASPLYA  407



>ref|XP_004487006.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X5 
[Cicer arietinum]
Length=411

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 141/203 (69%), Gaps = 23/203 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSG+R +D N
Sbjct  231  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGKRSVDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYLANKRK+F VLDSRLEGQY+ + + K+A LAL CLS + +FRP M
Sbjct  291  RPSGQHNLVEWAKPYLANKRKIFSVLDSRLEGQYSTDEAYKIATLALRCLSTESKFRPNM  350

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQLK       + N + GS+   R   A +     ++S D             
Sbjct  351  DEVVITLEQLK-------VPNLNAGSQKRARRKSADDVSHARRKSVD-------------  390

Query  351  gDAISR-NATAAYPRPSTSPLYA  286
               ++R      YPRPS SPLYA
Sbjct  391  --GVNRPKIPTTYPRPSASPLYA  411



>ref|XP_010047703.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
 gb|KCW88941.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=407

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 137/202 (68%), Gaps = 22/202 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPT DKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVY FGVVLLE+LSG+R ID N
Sbjct  227  LARDGPTDDKSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYGFGVVLLELLSGQRAIDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G HNLVEWAKPYL NKR++FRV+DSRLEGQY+++ +QK A LAL C+S + R RPTM
Sbjct  287  RPAGHHNLVEWAKPYLTNKRRIFRVIDSRLEGQYSMDQAQKAAFLALQCISTEARARPTM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D++V  LEQL+E K   T S   D     RRS  A     +    E +            
Sbjct  347  DEIVTSLEQLQELKG--TRSTHKDRRSVGRRSSNAAPRACRSSAEEVS------------  392

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                     AAYPRPS SPLYA
Sbjct  393  --------AAAYPRPSASPLYA  406



>gb|ABK93253.1| unknown [Populus trichocarpa]
Length=159

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 132/185 (71%), Gaps = 26/185 (14%)
 Frame = -1

Query  840  MGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLA  661
            MGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D NRP GEHNLVEWAKPYLA
Sbjct  1    MGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLA  60

Query  660  NKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT  481
            NKRK+FR+LDSRLEGQY+++V+ KV+ LAL CLS + +FRPTMD+VV  LEQL++SK+  
Sbjct  61   NKRKIFRILDSRLEGQYSMDVAYKVSTLALRCLSIETKFRPTMDEVVTALEQLQDSKETG  120

Query  480  TLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPST  301
            T +N H G++   R   A +                         A    + AAYPRPS 
Sbjct  121  T-ANGHVGNKPRIRRRSAND-------------------------ATGGGSIAAYPRPSA  154

Query  300  SPLYA  286
            SPLYA
Sbjct  155  SPLYA  159



>ref|XP_011011763.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Populus euphratica]
Length=399

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 135/203 (67%), Gaps = 34/203 (17%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD SHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LARDGPTGDNSHVSTRVMGTHGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL NKR+VF VLD+RLEGQY    +QK+ANLAL CL+ +P+FRP M
Sbjct  290  RPSGQHNLVEWAKPYLTNKRRVFHVLDTRLEGQYVPNRAQKLANLALQCLAVEPKFRPNM  349

Query  531  DDVVKELEQLKES-KDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D VV  LEQL+E  KD+   S K     H+ +  G                         
Sbjct  350  DKVVMVLEQLQEQVKDIPKFSRKE----HNLKVRGG------------------------  381

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                 +     AYPRPS SPLYA
Sbjct  382  -----ANGGQIAYPRPSASPLYA  399



>ref|XP_009588344.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
tomentosiformis]
Length=417

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 146/198 (74%), Gaps = 16/198 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  232  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH+LV W++PYL +KR+VFRVLDSRLEGQY+L  + KVANLAL CL+ DP+ RPTM
Sbjct  292  RPTGEHSLVGWSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVANLALQCLAMDPKSRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+ESKD      K+D ++         ++L +L  S+ ++      R  S+
Sbjct  352  DEVVTALEQLQESKDTA----KNDTNKD--------QQLNRLISSQSSSEFNRSCRSSSE  399

Query  351  gDAISRNATAAYPRPSTS  298
                + N    YPRPS S
Sbjct  400  ETPRAAN----YPRPSAS  413



>ref|XP_006339025.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=413

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 142/200 (71%), Gaps = 19/200 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD+SHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  232  LARDGPIGDQSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH+LV+WAKPYL NKR+VFRVLD+RLEGQY+L  + KVA L+L C+S DP+ RPTM
Sbjct  292  RPMGEHSLVDWAKPYLTNKRRVFRVLDARLEGQYSLSHALKVAILSLQCISMDPKSRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++SKD+     K      H RS  A+++    K S + T           
Sbjct  352  DEVVTALEQLQQSKDVAKNDKKVRQVNQHSRSSFALKK--SCKSSTEETP----------  399

Query  351  gDAISRNATAAYPRPSTSPL  292
                   A + YPRPS S L
Sbjct  400  -------AKSKYPRPSLSLL  412



>ref|XP_004487004.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004487005.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=428

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 141/203 (69%), Gaps = 23/203 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSG+R +D N
Sbjct  248  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGKRSVDKN  307

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYLANKRK+F VLDSRLEGQY+ + + K+A LAL CLS + +FRP M
Sbjct  308  RPSGQHNLVEWAKPYLANKRKIFSVLDSRLEGQYSTDEAYKIATLALRCLSTESKFRPNM  367

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQLK       + N + GS+   R   A +     ++S D             
Sbjct  368  DEVVITLEQLK-------VPNLNAGSQKRARRKSADDVSHARRKSVD-------------  407

Query  351  gDAISR-NATAAYPRPSTSPLYA  286
               ++R      YPRPS SPLYA
Sbjct  408  --GVNRPKIPTTYPRPSASPLYA  428



>ref|XP_004487002.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004487003.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 141/203 (69%), Gaps = 23/203 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSG+R +D N
Sbjct  261  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGKRSVDKN  320

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYLANKRK+F VLDSRLEGQY+ + + K+A LAL CLS + +FRP M
Sbjct  321  RPSGQHNLVEWAKPYLANKRKIFSVLDSRLEGQYSTDEAYKIATLALRCLSTESKFRPNM  380

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQLK       + N + GS+   R   A +     ++S D             
Sbjct  381  DEVVITLEQLK-------VPNLNAGSQKRARRKSADDVSHARRKSVD-------------  420

Query  351  gDAISR-NATAAYPRPSTSPLYA  286
               ++R      YPRPS SPLYA
Sbjct  421  --GVNRPKIPTTYPRPSASPLYA  441



>ref|XP_009364395.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=418

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 138/202 (68%), Gaps = 9/202 (4%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR +D N
Sbjct  226  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAVDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKP+L NKRK+FR++D+RLEGQY+++ + K   LA  CLS + + RP M
Sbjct  286  RPSGEHNLVEWAKPFLVNKRKIFRIIDNRLEGQYSMDGAHKAGILAARCLSTESKLRPNM  345

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVK LEQL +     T   + +G R  RRS       A            +     + 
Sbjct  346  DEVVKTLEQLPDYN--PTGGTQSNGQRMRRRS-------ADDASKAKRAAAAAAAAADAI  396

Query  351  gDAISRNATAAYPRPSTSPLYA  286
              A     T AYPRPS SPLYA
Sbjct  397  KAANEARKTVAYPRPSASPLYA  418



>ref|XP_008464125.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Cucumis melo]
Length=362

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 141/201 (70%), Gaps = 27/201 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+  SDVYSFGVVLLE+L GRR ID N
Sbjct  188  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTWSDVYSFGVVLLEILCGRRAIDKN  247

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLVEWAKPYLANKRK+FR++DSRLEGQY+L+ + K + LAL CLS +P+ RP M
Sbjct  248  RPAREHNLVEWAKPYLANKRKIFRIIDSRLEGQYSLDGAYKASMLALRCLSINPKLRPNM  307

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            +DVVKELEQL++S    TL   +  S ++RR        A+   ++D             
Sbjct  308  NDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRHSADD-------------  342

Query  351  gDAISRNATAAYPRPSTSPLY  289
              A + N   AYPRP  S LY
Sbjct  343  --ARNPNNAQAYPRPPVSALY  361



>dbj|BAE71262.1| putative protein kinase APK1A [Trifolium pratense]
Length=409

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 144/203 (71%), Gaps = 24/203 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLEMLSG+R +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEMLSGKRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+H+LVEWAKPYLANKRKVF VLDSRLEGQY+ + S +VA LAL CLS + ++RP M
Sbjct  290  RPSGQHSLVEWAKPYLANKRKVFSVLDSRLEGQYSSDESYRVATLALRCLSTESKYRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGS-RHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            D+VV+ LEQLK       + N + G+ R +RR           K ++D T       R  
Sbjct  350  DEVVRILEQLK-------VPNVNVGNQRRYRR-----------KSADDVT-----HARTH  386

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
                 S  A  +YPRPS SPLYA
Sbjct  387  KKSCASARAHTSYPRPSASPLYA  409



>ref|XP_009353659.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009353660.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=391

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  227  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKP+LANKRK+FRV+D+RLEGQY+++ + K A LA  C+S + + RP M
Sbjct  287  RPSGEHNLVEWAKPFLANKRKIFRVIDNRLEGQYSMDGAHKAATLAARCISTESKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  436
            D+VV  LEQL++S    T   + +G R  RRS
Sbjct  347  DEVVTALEQLQDSN--ATGGTQSNGQRMRRRS  376



>ref|XP_009766459.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=416

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 137/198 (69%), Gaps = 17/198 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  232  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE +LV W++PYL +KR+VFRVLDSRLEGQY+L  + KVANLAL CL+ DP+ RPTM
Sbjct  292  RPTGEQSLVGWSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVANLALQCLAMDPKSRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+ESKD        D   +   S  + E     + S + T           
Sbjct  352  DEVVTALEQLQESKDTAKTDTNKDQQLNRLSSQSSSELNRSCRSSSEETP----------  401

Query  351  gDAISRNATAAYPRPSTS  298
                     A+YPRPS S
Sbjct  402  -------RAASYPRPSAS  412



>ref|XP_008464124.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Cucumis melo]
Length=404

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 141/201 (70%), Gaps = 27/201 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+  SDVYSFGVVLLE+L GRR ID N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTWSDVYSFGVVLLEILCGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLVEWAKPYLANKRK+FR++DSRLEGQY+L+ + K + LAL CLS +P+ RP M
Sbjct  290  RPAREHNLVEWAKPYLANKRKIFRIIDSRLEGQYSLDGAYKASMLALRCLSINPKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            +DVVKELEQL++S    TL   +  S ++RR        A+   ++D             
Sbjct  350  NDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRHSADD-------------  384

Query  351  gDAISRNATAAYPRPSTSPLY  289
              A + N   AYPRP  S LY
Sbjct  385  --ARNPNNAQAYPRPPVSALY  403



>ref|XP_002534306.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF28074.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=389

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 139/202 (69%), Gaps = 39/202 (19%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  227  LARDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL NKR+V  VLD+R+EGQY+L  +QKVA+L + CL  +P+FRP+M
Sbjct  287  RPTGQHNLVEWAKPYLTNKRRVLHVLDTRIEGQYSLSRAQKVASLTVQCLDVEPKFRPSM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV+ LEQL+ES      + K   +R H              ++ D  T          
Sbjct  347  DEVVQALEQLQES------NKKESNTRAH-------------GDTNDGRT----------  377

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                      +YPRPS SPL+A
Sbjct  378  ----------SYPRPSRSPLFA  389



>ref|XP_011657150.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis sativus]
 gb|KGN47146.1| hypothetical protein Csa_6G190370 [Cucumis sativus]
Length=404

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 142/201 (71%), Gaps = 27/201 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+  SDVYSFGVVLLE+L GRR ID N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTWSDVYSFGVVLLEILCGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLVEWAKPYLANKRK+FR++DSRLEGQY+L+ + K + LAL C+S +P+ RP M
Sbjct  290  RPAREHNLVEWAKPYLANKRKIFRIIDSRLEGQYSLDGAYKASMLALRCISINPKLRPIM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            +DVVKELEQL++S    TL   +  S ++RR        A+   ++D             
Sbjct  350  NDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRHSADD-------------  384

Query  351  gDAISRNATAAYPRPSTSPLY  289
              A + N+  AYPRP  S LY
Sbjct  385  --ARNPNSAQAYPRPPVSALY  403



>gb|EYU41728.1| hypothetical protein MIMGU_mgv1a007413mg [Erythranthe guttata]
Length=408

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 143/202 (71%), Gaps = 26/202 (13%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYS+GVVLLE+L+G++ ID N
Sbjct  233  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSYGVVLLEILTGKKAIDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR++FRV+D+R+EGQY  + + K ANLAL C+S DPR RP M
Sbjct  293  RPTGEHNLVEWAKPYLTNKRRIFRVIDARIEGQYLADRAVKAANLALQCISMDPRSRPNM  352

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LE L++SK+    S+K+    ++ +S G  +      +SE+T            
Sbjct  353  DEVVSALENLQDSKE----SSKNGHRNNNSQSRGGPKSC----KSEET------------  392

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                    T AYPRP  S LYA
Sbjct  393  ------RKTTAYPRPKASALYA  408



>ref|NP_001274846.1| protein kinase APK1B, chloroplastic-like [Solanum tuberosum]
 gb|ABN69037.1| protein kinase [Solanum tuberosum]
Length=416

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 142/198 (72%), Gaps = 17/198 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  232  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVE ++PYL +KR+VFRVLDSRLEGQY+L  + KVAN+AL CL+ DP+ RPTM
Sbjct  292  RPTGEHNLVECSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVANVALQCLAMDPKSRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+ESKD    ++K+   + +R S  +  EL +   S    T          
Sbjct  352  DEVVTALEQLQESKDRVK-NDKNKDQQLNRLSSQSSGELNKSFRSNSEETPR--------  402

Query  351  gDAISRNATAAYPRPSTS  298
                     A YPRPS S
Sbjct  403  --------VANYPRPSAS  412



>ref|XP_006573305.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Glycine 
max]
 gb|KHN19150.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=413

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 141/202 (70%), Gaps = 17/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A LA  CLS +P++RP M
Sbjct  289  RPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAATLAFQCLSVEPKYRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVK LEQL+ES D      K+   +  R S   +     L  S    ++ + ++    
Sbjct  349  DEVVKALEQLRESNDKV----KNGDHKKCRVSGSGLGHPNGLPASTSKGSIDAAKKFN--  402

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                       YPRPS S LY+
Sbjct  403  -----------YPRPSASLLYS  413



>ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Glycine 
max]
 gb|KHN20929.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=399

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  227  LAKDGPAGDKSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMSGKRALDSN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL+NKR++F+V+D+R+EGQYTL  S KVANLA+ CLS +PRFRP M
Sbjct  287  RPSGEHNLIEWAKPYLSNKRRIFQVMDARIEGQYTLRESMKVANLAIQCLSVEPRFRPKM  346

Query  531  DDVVKELEQLKESKD  487
            D+VV+ LE+L++S+D
Sbjct  347  DEVVRALEELQDSED  361



>ref|XP_007133997.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
 gb|ESW05991.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
Length=413

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 141/202 (70%), Gaps = 17/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL++KSDVYSFGVVLLEMLSGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTSKSDVYSFGVVLLEMLSGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYLANKR+VFRV+DSRLEGQY+L  +Q+ A LA  CLS +P++RP M
Sbjct  289  RPSGEQCLVEWAKPYLANKRRVFRVMDSRLEGQYSLNRAQRAATLAFQCLSVEPKYRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV+ LEQ++ES D      K+   +  R S   +     L  S  T +  + ++    
Sbjct  349  DEVVRVLEQVRESND----EGKNGNCKKRRVSGSGLGHPNGLPASASTGSSDAPKKL---  401

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                      AYPRPS S LY 
Sbjct  402  ----------AYPRPSASLLYV  413



>ref|XP_008784589.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=415

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 139/202 (69%), Gaps = 19/202 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  233  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAVDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL+NKRK+FR+LD+RL GQY L  +QK A +A+ CLS + ++RP M
Sbjct  293  RPPGEHNLVEWARPYLSNKRKIFRILDTRLGGQYPLGGAQKAAAIAVRCLSAEAKYRPNM  352

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LE L+++KD        +     + S   V    Q ++   +            
Sbjct  353  DEVVSALELLQDAKD-----TGRNAQTERKASSQIVGSNVQRRDRRGSEA----------  397

Query  351  gDAISRNATAAYPRPSTSPLYA  286
              A SR    AYPRPS SPLYA
Sbjct  398  --AGSRK--GAYPRPSASPLYA  415



>ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=410

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 141/212 (67%), Gaps = 40/212 (19%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLEM+SGRR ID N
Sbjct  225  LAKDGPTGSKSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEMISGRRAIDKN  284

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  E NLVEWA+PYL NKRK+F+V+D+R+EGQY+L+ + KVANLA+ C+S +PRFRP M
Sbjct  285  RPSREQNLVEWARPYLGNKRKIFQVMDARVEGQYSLKDALKVANLAVQCISPEPRFRPKM  344

Query  531  DDVVKELEQLKESKD------------MTTLSNKHDGSRHHRRSDGAVEELAQLKESEDT  388
            ++VVK LEQL ES D                 N ++G R+HR+S           E+ D 
Sbjct  345  EEVVKALEQLLESNDNEGSRGSRHESLRKVNRNSNNGPRYHRKSTA---------ETCD-  394

Query  387  TTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  292
                                 A+YPRPS SPL
Sbjct  395  ------------------GKAASYPRPSASPL  408



>ref|XP_006576543.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Glycine max]
Length=371

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (70%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  186  LARDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  245

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A LA  CL+ +P++RP M
Sbjct  246  RPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAATLAFQCLAVEPKYRPNM  305

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV+ LEQL+ES +     ++     H +RS  +   L        +T+          
Sbjct  306  DEVVRALEQLRESNN-----DQVKNGDHKKRSRVSGSGLGHHNGLPASTS----------  350

Query  351  gDAISRNATAAYPRPSTSPLY  289
              +I       YPRPS S LY
Sbjct  351  KGSIDAAKKFNYPRPSASLLY  371



>ref|XP_010111458.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
 gb|EXC30981.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
Length=394

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR ID N
Sbjct  222  LARDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAIDKN  281

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL NKR++  V+D+RLEGQY+L ++QK ANLAL CL+ D ++RP +
Sbjct  282  RPTGQHNLVEWAKPYLTNKRRLLHVMDARLEGQYSLSLAQKAANLALQCLAIDSKYRPNI  341

Query  531  DDVVKELEQLKESKDMT  481
            D+VV  LEQL++SKD++
Sbjct  342  DEVVTTLEQLQDSKDIS  358



>ref|XP_004249535.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=413

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 141/200 (71%), Gaps = 19/200 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD+SHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  232  LARDGPVGDQSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH+LV+WAKPYL +KR+VFRVLD+RLEGQY+L  + KVA L+L C+S DP+ RPTM
Sbjct  292  RPMGEHSLVDWAKPYLTSKRRVFRVLDARLEGQYSLSHALKVAILSLQCISMDPKSRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++SKD+     K      H RS  A ++    K S + T           
Sbjct  352  DEVVTALEQLQQSKDVAKNDKKVRQVNQHSRSSFAFKK--SCKSSTEETP----------  399

Query  351  gDAISRNATAAYPRPSTSPL  292
                   A + YPRPS S L
Sbjct  400  -------AKSKYPRPSLSLL  412



>ref|XP_008784588.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=422

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 139/202 (69%), Gaps = 19/202 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  240  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAVDKN  299

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL+NKRK+FR+LD+RL GQY L  +QK A +A+ CLS + ++RP M
Sbjct  300  RPPGEHNLVEWARPYLSNKRKIFRILDTRLGGQYPLGGAQKAAAIAVRCLSAEAKYRPNM  359

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LE L+++KD        +     + S   V    Q ++   +            
Sbjct  360  DEVVSALELLQDAKD-----TGRNAQTERKASSQIVGSNVQRRDRRGSEA----------  404

Query  351  gDAISRNATAAYPRPSTSPLYA  286
              A SR    AYPRPS SPLYA
Sbjct  405  --AGSRK--GAYPRPSASPLYA  422



>ref|XP_008387769.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=393

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 138/202 (68%), Gaps = 31/202 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRV+GT GYAAPEYL+TGHL+ KSD+YSFGVVLLEMLSGRR ID N
Sbjct  223  LARDGPTGDKSHVSTRVIGTQGYAAPEYLATGHLTTKSDIYSFGVVLLEMLSGRRAIDKN  282

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+VFRV+D RLEGQY++  SQK A LAL CL+ DP++RP M
Sbjct  283  RPTGEHNLVEWAKPYLRNKRRVFRVIDPRLEGQYSVSRSQKAAVLALQCLAVDPKYRPDM  342

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VV  LE+L+++KD+   + K     H+  S G   +                      
Sbjct  343  NEVVTILEELQDTKDIPKSTQKE----HNATSQGLPNDAP--------------------  378

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                   +  AYPRPS +PL+A
Sbjct  379  -------SVTAYPRPSRNPLFA  393



>gb|KHN47889.1| Protein kinase APK1B, chloroplastic [Glycine soja]
Length=413

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 139/201 (69%), Gaps = 16/201 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A LA  CL+ +P++RP M
Sbjct  289  RPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAATLAFQCLAVEPKYRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV+ LEQL+ES +    +  H   +  R S   +     L  S    ++ +       
Sbjct  349  DEVVRALEQLRESNNDQVKNGDHK--KRSRVSGSGLGHHNGLPASTSKGSIDA-------  399

Query  351  gDAISRNATAAYPRPSTSPLY  289
                   A   YPRPS S LY
Sbjct  400  -------AKFNYPRPSASLLY  413



>ref|XP_003522100.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
Length=414

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (70%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A LA  CL+ +P++RP M
Sbjct  289  RPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAATLAFQCLAVEPKYRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV+ LEQL+ES +     ++     H +RS  +   L        +T+          
Sbjct  349  DEVVRALEQLRESNN-----DQVKNGDHKKRSRVSGSGLGHHNGLPASTS----------  393

Query  351  gDAISRNATAAYPRPSTSPLY  289
              +I       YPRPS S LY
Sbjct  394  KGSIDAAKKFNYPRPSASLLY  414



>ref|XP_009414323.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+LSGRR +D N
Sbjct  234  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLELLSGRRAVDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD RL GQY+L  +QK A LAL CLS + R+RPTM
Sbjct  294  RPTGEHNLVEWARPYLTSKRKIFRVLDPRLGGQYSLVGAQKAAVLALQCLSSEARYRPTM  353

Query  531  DDVVKELEQLKESKD  487
            D VV  LEQL+++KD
Sbjct  354  DQVVAALEQLQDAKD  368



>gb|KJB16969.1| hypothetical protein B456_002G257500 [Gossypium raimondii]
Length=371

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGD+SHVSTRVMGT+GYAAPEYL TGHL+AKSD+YSFGVVLLE++ GRR ID N
Sbjct  231  LARDGPTGDRSHVSTRVMGTHGYAAPEYLVTGHLTAKSDIYSFGVVLLEIICGRRAIDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLVEWAKPYL NKR+VFRVLD+RL+GQY+L   QK A+LALHCL+K+P+ RP+M
Sbjct  291  KPSGEHNLVEWAKPYLTNKRRVFRVLDTRLQGQYSLNRVQKAAHLALHCLAKEPKSRPSM  350

Query  531  DDVVKELEQLKE  496
            D+VVK LEQL+E
Sbjct  351  DEVVKRLEQLQE  362



>ref|XP_009414322.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+LSGRR +D N
Sbjct  241  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLELLSGRRAVDKN  300

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD RL GQY+L  +QK A LAL CLS + R+RPTM
Sbjct  301  RPTGEHNLVEWARPYLTSKRKIFRVLDPRLGGQYSLVGAQKAAVLALQCLSSEARYRPTM  360

Query  531  DDVVKELEQLKESKD  487
            D VV  LEQL+++KD
Sbjct  361  DQVVAALEQLQDAKD  375



>ref|XP_010557255.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Tarenaya hassleriana]
Length=412

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 141/201 (70%), Gaps = 19/201 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT DKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  230  LAKDGPTDDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKR+VFRV+D+RL+ QY++E + KVA LA+ CLS + + RP M
Sbjct  290  RPTGEHNLVEWAKPYLANKRRVFRVIDNRLQDQYSMEEAHKVATLAMRCLSTEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LEQ++      +L+      R  R SD  + + A++   + +            
Sbjct  350  KEVVSHLEQIQ------SLNAARRERRTRRSSDSVIAKKAKVGYGQPSPM----------  393

Query  351  gDAISRNATAAYPRPSTSPLY  289
                + N TAAYPRPS SPL+
Sbjct  394  ---AAANGTAAYPRPSGSPLH  411



>ref|XP_008343582.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Malus domestica]
Length=395

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY+STGHL+A+SDVYSFGVV+LE+LSGRRV+D N
Sbjct  210  LAKDGPAGDKSHVSTRVMGTYGYAAPEYMSTGHLTARSDVYSFGVVMLELLSGRRVVDKN  269

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  NLA+ CL+ +P+ RPTM
Sbjct  270  RPSGEHNLVEWAKPYLASKRKVIQIFDGRIEGQYSLDEALRAVNLAIQCLAVEPKSRPTM  329

Query  531  DDVVKELEQLKESKD  487
            DDVVK LEQL+E  D
Sbjct  330  DDVVKALEQLQEPSD  344



>ref|XP_010557253.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 141/201 (70%), Gaps = 19/201 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT DKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  250  LAKDGPTDDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  309

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKR+VFRV+D+RL+ QY++E + KVA LA+ CLS + + RP M
Sbjct  310  RPTGEHNLVEWAKPYLANKRRVFRVIDNRLQDQYSMEEAHKVATLAMRCLSTEIKLRPNM  369

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LEQ++      +L+      R  R SD  + + A++   + +            
Sbjct  370  KEVVSHLEQIQ------SLNAARRERRTRRSSDSVIAKKAKVGYGQPSPM----------  413

Query  351  gDAISRNATAAYPRPSTSPLY  289
                + N TAAYPRPS SPL+
Sbjct  414  ---AAANGTAAYPRPSGSPLH  431



>ref|XP_010557252.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=435

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 141/201 (70%), Gaps = 19/201 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT DKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  253  LAKDGPTDDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  312

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKR+VFRV+D+RL+ QY++E + KVA LA+ CLS + + RP M
Sbjct  313  RPTGEHNLVEWAKPYLANKRRVFRVIDNRLQDQYSMEEAHKVATLAMRCLSTEIKLRPNM  372

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LEQ++      +L+      R  R SD  + + A++   + +            
Sbjct  373  KEVVSHLEQIQ------SLNAARRERRTRRSSDSVIAKKAKVGYGQPSPM----------  416

Query  351  gDAISRNATAAYPRPSTSPLY  289
                + N TAAYPRPS SPL+
Sbjct  417  ---AAANGTAAYPRPSGSPLH  434



>ref|XP_010521843.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010521844.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
Length=414

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 139/201 (69%), Gaps = 14/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  227  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLANKRK+FRV+DSRL+ QY++E   K A LAL CLS + + RP M
Sbjct  287  RPAGEHNLVEWAKPYLANKRKMFRVIDSRLQDQYSMEEVYKAATLALRCLSTEVKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             DVV +LEQ++     +    + +     R +D  + + A++      + + +       
Sbjct  347  KDVVSQLEQIRALNASSGNPERRERRARRRSTDSVITKKAKVGYFAQPSPMAA-------  399

Query  351  gDAISRNATAAYPRPSTSPLY  289
                   + AAYPRPS SPL+
Sbjct  400  -------SVAAYPRPSASPLH  413



>ref|XP_004307510.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD+SHVSTRVMGTYGYAAPEY++TGHL+AKSDVYSFGVV+LEMLSGRR +D N
Sbjct  216  LAKDGPAGDRSHVSTRVMGTYGYAAPEYMATGHLTAKSDVYSFGVVMLEMLSGRRAVDKN  275

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEH+LVEWAKPYLA+KR+V +V D+R++GQY++  + K  NLA+ CLS +P+FRP M
Sbjct  276  RPTGEHSLVEWAKPYLASKRRVLQVFDARIDGQYSVAAALKAVNLAIRCLSTEPKFRPIM  335

Query  531  DDVVKELEQLKESKDM  484
             DVVK LEQL+E++DM
Sbjct  336  SDVVKSLEQLQETEDM  351



>gb|AFK44181.1| unknown [Lotus japonicus]
Length=401

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 11/167 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVST VMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  232  LAKDGPVGDKSHVSTGVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMSGKRALDQN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL+NKR++F+V+D+R+EGQYTL  + KVANLA+ CLS +PRFRP M
Sbjct  292  RPSGEHNLIEWAKPYLSNKRRIFQVMDARIEGQYTLREAMKVANLAIQCLSVEPRFRPKM  351

Query  531  DDVVKELEQLK-----------ESKDMTTLSNKHDGSRHHRRSDGAV  424
            D+VV  LE+L+            S+D     N H G + HR     +
Sbjct  352  DEVVSVLEELQGSHDDTAGGVGTSRDQRARRNVHSGPKQHRSKQSGI  398



>ref|XP_004246420.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=416

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 142/198 (72%), Gaps = 17/198 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  232  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVE ++ YL +KR+VFRVLDSRLEGQY+L  + KVA++AL CL+ DP+ RPTM
Sbjct  292  RPTGEHNLVECSRAYLTSKRRVFRVLDSRLEGQYSLTRALKVASVALQCLAMDPKSRPTM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+ESKD    ++K+   + +R S  +  EL +   S    T          
Sbjct  352  DEVVTALEQLQESKDRVK-NDKNKDQQLNRLSSQSSGELNKSFRSNSEET----------  400

Query  351  gDAISRNATAAYPRPSTS  298
                     A+YPRPS S
Sbjct  401  ------PRVASYPRPSAS  412



>ref|XP_008354131.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Malus domestica]
Length=427

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY+STGHL+A+SDVYSFGVV+LE+LSGRRV+D N
Sbjct  242  LAKDGPAGDKSHVSTRVMGTYGYAAPEYMSTGHLTARSDVYSFGVVMLELLSGRRVVDKN  301

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  NLA+ CL+ +P+ RPTM
Sbjct  302  RPSGEHNLVEWAKPYLASKRKVIQIFDGRIEGQYSLDEALRAVNLAIQCLAVEPKSRPTM  361

Query  531  DDVVKELEQLKESKD  487
            DDVVK LEQL+E  D
Sbjct  362  DDVVKALEQLQEPSD  376



>ref|XP_007141880.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
 gb|ESW13874.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
Length=400

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  227  LAKDGPAGDKSHVSTRVMGTYGYAAPEYIATGHLTKKSDVYSFGVVLLEIMSGKRALDSN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL+NKR++F+V+D+R+EGQY++  + KV+NLA+ CLS +PRFRP M
Sbjct  287  RPGGEHNLIEWAKPYLSNKRRIFQVMDARIEGQYSMRTAMKVSNLAIQCLSVEPRFRPKM  346

Query  531  DDVVKELEQLKESKD  487
            D+VV+ LE+L++S D
Sbjct  347  DEVVRTLEELQDSGD  361



>ref|XP_010325852.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Solanum lycopersicum]
Length=422

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 142/198 (72%), Gaps = 17/198 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  238  LARDGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEILSGKKAIDKN  297

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVE ++ YL +KR+VFRVLDSRLEGQY+L  + KVA++AL CL+ DP+ RPTM
Sbjct  298  RPTGEHNLVECSRAYLTSKRRVFRVLDSRLEGQYSLTRALKVASVALQCLAMDPKSRPTM  357

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL+ESKD    ++K+   + +R S  +  EL +   S    T          
Sbjct  358  DEVVTALEQLQESKDRVK-NDKNKDQQLNRLSSQSSGELNKSFRSNSEET----------  406

Query  351  gDAISRNATAAYPRPSTS  298
                     A+YPRPS S
Sbjct  407  ------PRVASYPRPSAS  418



>dbj|BAJ98795.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  97   LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  156

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLVEWA+PYL +KR++FRVLD RL GQY+L  +QK A+LAL CLS D R RP+M
Sbjct  157  QPTGEHNLVEWARPYLTSKRRIFRVLDPRLGGQYSLAKAQKTASLALQCLSADSRHRPSM  216

Query  531  DDVVKELEQLKESKD  487
            + VV  LEQL ++K+
Sbjct  217  EQVVVALEQLHDAKE  231



>ref|XP_003616404.1| Serine/threonine protein kinase [Medicago truncatula]
Length=233

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD SHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  46   LAKDGPAGDNSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMSGKRALDNN  105

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL +KR+VF+V+D+R+EGQYT+  + KVA+LA+ CLS +PRFRP M
Sbjct  106  RPSGEHNLIEWAKPYLNSKRRVFQVMDARIEGQYTVRQAMKVADLAVRCLSVEPRFRPKM  165

Query  531  DDVVKELEQLKES  493
            D++V+ LE+L+ S
Sbjct  166  DEIVRVLEELQSS  178



>ref|XP_008802716.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Phoenix 
dactylifera]
Length=382

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 143/207 (69%), Gaps = 33/207 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDK+HVSTRV+GTYGYAAPEYL+TGHL+AKSDV+SFGVVLLEMLSGRR ID N
Sbjct  200  LAKDGPTGDKTHVSTRVIGTYGYAAPEYLATGHLTAKSDVFSFGVVLLEMLSGRRAIDKN  259

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +QK A LALHCLS + +FRPTM
Sbjct  260  RPPGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLAAAQKAAALALHCLSTEAKFRPTM  319

Query  531  DDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgs  373
            D+VV  LEQL+++KD           S++  GS  H+    ++EE    K          
Sbjct  320  DEVVSTLEQLQDNKDAAKHSQSEPKASSRSLGSSGHKLGHRSLEEAGTRK----------  369

Query  372  rrrrrsdgDAISRNATAAYPRPSTSPL  292
                             AYPRPS SPL
Sbjct  370  ----------------VAYPRPSASPL  380



>gb|KEH39440.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSG+R +D N
Sbjct  230  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGKRAVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+H+LVEWAKPYLANKRKVF VLDSRLEGQY+ + S +VA LAL CLS + R+RP M
Sbjct  290  RPSGQHSLVEWAKPYLANKRKVFSVLDSRLEGQYSSDESYRVATLALRCLSTESRYRPNM  349

Query  531  DDVVKELEQLK  499
            D+VV+ LEQLK
Sbjct  350  DEVVRILEQLK  360



>ref|XP_009343547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=402

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY+STGHL+A+SDVYSFGVV+LE+LSGRR +D N
Sbjct  217  LAKDGPAGDKSHVSTRVMGTYGYAAPEYMSTGHLTARSDVYSFGVVMLELLSGRRAVDKN  276

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  NLA+ CL+ +PR RPTM
Sbjct  277  RPSGEHNLVEWAKPYLASKRKVTQIFDGRIEGQYSLDEALRAVNLAIRCLAVEPRVRPTM  336

Query  531  DDVVKELEQLKESKD  487
            DDVVK LEQL+E  D
Sbjct  337  DDVVKALEQLQEPSD  351



>ref|XP_006435539.1| hypothetical protein CICLE_v10031723mg [Citrus clementina]
 ref|XP_006486484.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Citrus sinensis]
 gb|ESR48779.1| hypothetical protein CICLE_v10031723mg [Citrus clementina]
 gb|KDO69305.1| hypothetical protein CISIN_1g015731mg [Citrus sinensis]
Length=400

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG +SHVSTRVMGTYGYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRRVID N
Sbjct  226  LAKDGPTGSQSHVSTRVMGTYGYAAPEYMATGHLTAKSDVYSFGVVLLEMLSGRRVIDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNL+EWAKPYL +KR++F+V+D+R+EGQY+L  + K A LA+ CLS +P+FRPTM
Sbjct  286  RPSREHNLIEWAKPYLQSKRRIFQVMDARIEGQYSLGAALKTAVLAIKCLSNEPKFRPTM  345

Query  531  DDVVKELEQLKESKD  487
            D+VVK LEQ++++ D
Sbjct  346  DEVVKALEQIQDTND  360



>ref|XP_006486482.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006486483.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|KDO69306.1| hypothetical protein CISIN_1g015731mg [Citrus sinensis]
Length=401

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG +SHVSTRVMGTYGYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRRVID N
Sbjct  227  LAKDGPTGSQSHVSTRVMGTYGYAAPEYMATGHLTAKSDVYSFGVVLLEMLSGRRVIDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNL+EWAKPYL +KR++F+V+D+R+EGQY+L  + K A LA+ CLS +P+FRPTM
Sbjct  287  RPSREHNLIEWAKPYLQSKRRIFQVMDARIEGQYSLGAALKTAVLAIKCLSNEPKFRPTM  346

Query  531  DDVVKELEQLKESKD  487
            D+VVK LEQ++++ D
Sbjct  347  DEVVKALEQIQDTND  361



>ref|XP_002466186.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
 gb|EER93184.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
Length=418

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+ KSD+YSFGVVLLEMLSGRR ID N
Sbjct  234  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTTKSDIYSFGVVLLEMLSGRRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYLA+KRK+FR+LD+RLEGQY L  +Q +A LAL CLS + + RPTM
Sbjct  294  RPQGEHNLVEWARPYLAHKRKIFRILDTRLEGQYNLNSAQSIAALALECLSYEAKMRPTM  353

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRH  448
            DDVV  L+++++S +   L     G++ 
Sbjct  354  DDVVTILQEVQDSSEAEKLQEPKAGTKQ  381



>ref|XP_003519344.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform 1 
[Glycine max]
 gb|KHN41092.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=392

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 7/157 (4%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  227  LAKDGPAGDKSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMSGKRALDSN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL++KR++F+V+D+R+EGQY L  + KVA LA+ CLS +PRFRP M
Sbjct  287  RPSGEHNLIEWAKPYLSSKRRIFQVMDARIEGQYMLREAMKVATLAIQCLSVEPRFRPKM  346

Query  531  DDVVKELEQLKESKDMT-------TLSNKHDGSRHHR  442
            D+VV+ LE+L++S D           + +  G R HR
Sbjct  347  DEVVRALEELQDSDDRVGGVGSSRDQTTRRSGPRQHR  383



>ref|XP_010558327.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010558328.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
Length=392

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHLSAKSDVYSFGVVLLEMLSGRR ID N
Sbjct  224  LARDGPTGDKSHVSTRVMGTQGYAAPEYLATGHLSAKSDVYSFGVVLLEMLSGRRAIDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLVEWAKPYL N+R+V RV+D RL+GQY+L  + KVA LAL CLS D + RP+M
Sbjct  284  QPVGEHNLVEWAKPYLTNRRRVLRVMDPRLQGQYSLTRAHKVAILALDCLSVDAKLRPSM  343

Query  531  DDVVKELEQLKESKDMT  481
            +DVVK LE+L+  KD T
Sbjct  344  NDVVKTLEELQSHKDST  360



>gb|ACF85751.1| unknown [Zea mays]
 gb|AFW67137.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW67138.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=259

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLE+LSGRR ID N
Sbjct  71   LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEVLSGRRAIDKN  130

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A L+L CLS + + RPTM
Sbjct  131  RPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIAALSLECLSYEAKMRPTM  190

Query  531  DDVVKELEQLKESKD  487
            D VV  LE+L++S +
Sbjct  191  DAVVTILEELQDSGE  205



>ref|XP_008810614.1| PREDICTED: protein kinase APK1A, chloroplastic [Phoenix dactylifera]
Length=415

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 145/209 (69%), Gaps = 33/209 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  233  LAKDGPTGDKSHVSTRVMGTFGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+P+LANK+++FR+LD+RL GQY+L  +QK A LAL CLS + ++RP M
Sbjct  293  RPAGEHNLVEWARPHLANKKRIFRILDARLGGQYSLGGAQKAAALALQCLSIEAKYRPNM  352

Query  531  DDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgs  373
            D+VV ELEQL+++KD          +S+++ GS   R    +VEE  + K          
Sbjct  353  DEVVPELEQLQDTKDTGRNPQTERKVSSQYVGSNLQRYRRRSVEEPGRGK----------  402

Query  372  rrrrrsdgDAISRNATAAYPRPSTSPLYA  286
                             AY RPS SPLYA
Sbjct  403  ----------------GAYARPSASPLYA  415



>gb|ACL52762.1| unknown [Zea mays]
Length=259

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLE+LSGRR ID N
Sbjct  71   LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEVLSGRRAIDKN  130

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A L+L CLS + + RPTM
Sbjct  131  RPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIAALSLECLSYEAKMRPTM  190

Query  531  DDVVKELEQLKES  493
            D VV  LE+L++S
Sbjct  191  DAVVTILEELQDS  203



>ref|XP_010558326.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Tarenaya hassleriana]
Length=406

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHLSAKSDVYSFGVVLLEMLSGRR ID N
Sbjct  238  LARDGPTGDKSHVSTRVMGTQGYAAPEYLATGHLSAKSDVYSFGVVLLEMLSGRRAIDKN  297

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLVEWAKPYL N+R+V RV+D RL+GQY+L  + KVA LAL CLS D + RP+M
Sbjct  298  QPVGEHNLVEWAKPYLTNRRRVLRVMDPRLQGQYSLTRAHKVAILALDCLSVDAKLRPSM  357

Query  531  DDVVKELEQLKESKDMT  481
            +DVVK LE+L+  KD T
Sbjct  358  NDVVKTLEELQSHKDST  374



>ref|XP_010658583.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Vitis 
vinifera]
Length=372

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ +SDVYSFGVVLLEMLSGRR +D N
Sbjct  199  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTRSDVYSFGVVLLEMLSGRRAVDKN  258

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYLA+KRK+F VLDSR++GQ++L  +   A +A+ CLS +P+ RP M
Sbjct  259  RPSGEHNLVEWARPYLASKRKIFHVLDSRIQGQFSLNGAHGAARVAIQCLSTEPKHRPNM  318

Query  531  DDVVKELEQLKESKDMTTLS-NKHDGSRHHRRSDG  430
            D VV  LEQL+   + TT S N+   + H+  S+G
Sbjct  319  DQVVTALEQLQADSNNTTASQNRPRPNFHNSSSNG  353



>ref|XP_004490898.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=397

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 127/164 (77%), Gaps = 14/164 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD SHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  226  LAKDGPAGDNSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMSGKRTLDNN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL +KR++F+V+D+R+EGQYTL  + KVA+LA+ CLS +PRFRP M
Sbjct  286  RPSGEHNLIEWAKPYLNSKRRIFQVMDARIEGQYTLRQAMKVADLAVQCLSVEPRFRPKM  345

Query  531  DDVVKELEQLKESKDM--------------TTLSNKHDGSRHHR  442
            D+VV+ LE+L+ S D               +  S++ +G R HR
Sbjct  346  DEVVRALEELQGSDDTIEGAGSSRDRNIRRSVHSSRSNGPRQHR  389



>emb|CDP00097.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 3/152 (2%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KSHVSTRVMGTYGYAAPEY+ TGHL+AKSDVYSFGVVLLEML+GRRVID N
Sbjct  227  LAKDGPMDGKSHVSTRVMGTYGYAAPEYMVTGHLTAKSDVYSFGVVLLEMLTGRRVIDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYLA+KR++F+V+D+R+EGQY+L  + K ANLA+ CL+ +P++RP M
Sbjct  287  RPPGEHNLIEWAKPYLASKRRIFQVIDARIEGQYSLGGAIKAANLAVKCLATEPKYRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  436
            D+VVK LEQL++S   +    KH+  R H ++
Sbjct  347  DEVVKALEQLQDSDSGSV---KHEVVRKHHKT  375



>ref|XP_002283701.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Vitis 
vinifera]
 emb|CBI31685.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ +SDVYSFGVVLLEMLSGRR +D N
Sbjct  231  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTRSDVYSFGVVLLEMLSGRRAVDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYLA+KRK+F VLDSR++GQ++L  +   A +A+ CLS +P+ RP M
Sbjct  291  RPSGEHNLVEWARPYLASKRKIFHVLDSRIQGQFSLNGAHGAARVAIQCLSTEPKHRPNM  350

Query  531  DDVVKELEQLKESKDMTTLS-NKHDGSRHHRRSDG  430
            D VV  LEQL+   + TT S N+   + H+  S+G
Sbjct  351  DQVVTALEQLQADSNNTTASQNRPRPNFHNSSSNG  385



>ref|XP_006846202.1| PREDICTED: probable serine/threonine-protein kinase NAK [Amborella 
trichopoda]
 gb|ERN07877.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
Length=405

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 141/202 (70%), Gaps = 30/202 (15%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG+ +HVSTRVMGTYGYAAPEYL+TGHL+ +SDVYSFGVVLLEMLSGRR +D N
Sbjct  234  LAKDGPTGENTHVSTRVMGTYGYAAPEYLATGHLTTRSDVYSFGVVLLEMLSGRRALDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL+NKRK+FRV+DSR+EGQY+L+++QK A LAL CLS +P++RP+M
Sbjct  294  RPTGEHNLVEWAKPYLSNKRKLFRVMDSRIEGQYSLKIAQKAAALALQCLSSEPKYRPSM  353

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV+ LEQL+ESKD          S   R  +G+                         
Sbjct  354  KEVVEVLEQLQESKDAPRTFQPEPQSMPTR--NGSSRP----------------------  389

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                  N T +YPRPS SPLY+
Sbjct  390  ------NGTVSYPRPSASPLYS  405



>gb|ACU19261.1| unknown [Glycine max]
Length=392

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 124/157 (79%), Gaps = 7/157 (4%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++ G+R +D N
Sbjct  227  LAKDGPAGDKSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMFGKRALDSN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL++KR++F+V+D+R+EGQY L  + KVA LA+ CLS +PRFRP M
Sbjct  287  RPSGEHNLIEWAKPYLSSKRRIFQVMDARIEGQYMLREAMKVATLAIQCLSVEPRFRPKM  346

Query  531  DDVVKELEQLKESKDMT-------TLSNKHDGSRHHR  442
            D+VV+ LE+L++S D           + +  G R HR
Sbjct  347  DEVVRALEELQDSDDRVGGVGSSRDQTTRRSGPRQHR  383



>ref|XP_007208720.1| hypothetical protein PRUPE_ppa015273mg, partial [Prunus persica]
 gb|EMJ09919.1| hypothetical protein PRUPE_ppa015273mg, partial [Prunus persica]
Length=310

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRV+GT GYAAPEYL+TGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  188  LARDGPTGDKSHVSTRVIGTQGYAAPEYLATGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  247

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+VFRV+DSRLEGQY+L  +QK ANLAL CLS DP++RP +
Sbjct  248  RPTGEHNLVEWAKPYLRNKRRVFRVIDSRLEGQYSLNRAQKAANLALQCLSIDPKYRPDV  307

Query  531  DDV  523
            ++V
Sbjct  308  NEV  310



>gb|EYU26593.1| hypothetical protein MIMGU_mgv1a007265mg [Erythranthe guttata]
Length=413

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYLSTGHL+AKSDVYSFGVVL+E+L G++ ID N
Sbjct  235  LARDGPTGDKSHVSTRVMGTHGYAAPEYLSTGHLTAKSDVYSFGVVLVEILCGKKAIDKN  294

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR++ RVLD+RLEGQY+L  + K A LAL CLS + R RP+M
Sbjct  295  RPPGEHNLVEWAKPYLTNKRRILRVLDNRLEGQYSLAHAVKAAQLALQCLSTEARSRPSM  354

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEE  418
            D+VV  LEQL++S   T +   H  +RH + + G   E
Sbjct  355  DEVVTALEQLQDSN--TNIQKNHRLNRHGKTNSGPNSE  390



>dbj|BAJ95924.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97649.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  242  LAKDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRALDKN  301

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KR+VFR+LD+RL GQY+L  +QK A LA+ CLS D R RP M
Sbjct  302  RPAGEHNLVEWARPYLTSKRRVFRILDARLGGQYSLPGAQKTAALAMQCLSGDARARPGM  361

Query  531  DDVVKELEQLKESKD  487
              VV  LEQL+++K+
Sbjct  362  AQVVTALEQLQDAKE  376



>ref|XP_004490921.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=178

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD SHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  52   LAKDGPAGDNSHVSTRVMGTYGYAAPEYVATGHLTKKSDVYSFGVVLLEIMSGKRTLDNN  111

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL +KR++F+V+D+R+EGQYTL  + KVA+LA+ CLS +PRFRP M
Sbjct  112  RPSGEHNLIEWAKPYLNSKRRIFQVMDARIEGQYTLRQAMKVADLAVQCLSVEPRFRPKM  171

Query  531  DDVVKEL  511
            D+VV+ L
Sbjct  172  DEVVRAL  178



>ref|XP_004981243.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=416

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A LAL CLS + + RP+M
Sbjct  292  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLSGAQTIATLALECLSYEAKMRPSM  351

Query  531  DDVVKELEQLKES  493
            D VV  LE+L++S
Sbjct  352  DAVVTILEELQDS  364



>ref|XP_010231839.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Brachypodium 
distachyon]
Length=393

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDV+SFGVVLLEMLSGRR +D N
Sbjct  229  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVFSFGVVLLEMLSGRRAVDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KR++FRVLD+RL GQY+L  +QK A+LAL CLS + R RP+M
Sbjct  289  RPNGEHNLVEWARPYLTSKRRIFRVLDARLGGQYSLTSAQKAASLALQCLSVESRHRPSM  348

Query  531  DDVVKELEQLKESKD  487
            + VV  LEQL+E  +
Sbjct  349  EQVVTVLEQLQEPNE  363



>ref|XP_008233629.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=401

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD+SHVSTR+MGTYGYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  217  LAKDGPAGDRSHVSTRIMGTYGYAAPEYMATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  276

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRKV  + D+R+EGQY+L  + +  NLA+ CL+ + +FRP M
Sbjct  277  RPSGEHNLVEWAKPYLASKRKVLHIFDARIEGQYSLGGALRAVNLAIRCLAVEAKFRPNM  336

Query  531  DDVVKELEQLKESKD  487
            +DV+K LEQL+E  D
Sbjct  337  NDVIKALEQLQEPSD  351



>ref|NP_001054444.1| Os05g0110900 [Oryza sativa Japonica Group]
 gb|AAK73157.1|AC079022_30 putative protein kinase [Oryza sativa]
 gb|AAU44204.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16358.1| Os05g0110900 [Oryza sativa Japonica Group]
 dbj|BAG93323.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62074.1| hypothetical protein OsJ_16858 [Oryza sativa Japonica Group]
Length=395

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  226  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRALDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KR++FR+LD+RL GQY+L  +QK A LAL C+S + + RP M
Sbjct  286  RPTGEHNLVEWARPYLMSKRRIFRILDARLGGQYSLAKAQKAATLALQCISVEAKNRPNM  345

Query  531  DDVVKELEQLKESKD  487
            + VV  LEQL++SK+
Sbjct  346  EQVVAVLEQLQDSKE  360



>gb|EEC78387.1| hypothetical protein OsI_18165 [Oryza sativa Indica Group]
Length=395

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  226  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRALDKN  285

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KR++FR+LD+RL GQY+L  +QK A LAL C+S + + RP M
Sbjct  286  RPTGEHNLVEWARPYLMSKRRIFRILDARLGGQYSLAKAQKAATLALQCISVEAKNRPNM  345

Query  531  DDVVKELEQLKESKD  487
            + VV  LEQL++SK+
Sbjct  346  EQVVAVLEQLQDSKE  360



>gb|EMS53821.1| putative serine/threonine-protein kinase NAK [Triticum urartu]
Length=493

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  229  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRAVDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KR++FRVLD RL GQY+L  +QK A+LAL CLS D R RP+M
Sbjct  289  RPTGEHNLVEWARPYLTSKRRIFRVLDPRLGGQYSLAKAQKAASLALQCLSVDSRNRPSM  348

Query  531  DDVVKELEQLKESKDMTT  478
            + VV  LEQL ++K+  T
Sbjct  349  EQVVVALEQLHDAKEGGT  366



>ref|XP_009404596.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 132/214 (62%), Gaps = 45/214 (21%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  231  LAKDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRALDRN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+P+LA+KRK+FRVLD+RL  QY L  +QK + +AL CLS + R RP M
Sbjct  291  RPIGEHNLVEWARPFLASKRKIFRVLDTRLGAQYPLATAQKASFIALQCLSTEARHRPAM  350

Query  531  DDVVKELEQL-------------KESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESED  391
              VV  LE+L             + S   +  SN H   R  RRS G +           
Sbjct  351  AQVVSALEELQNAEVTDQSLRTGQNSSSQSGYSNPH---RSRRRSAGEIG----------  397

Query  390  TTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  289
                               N   AYPRPS SPLY
Sbjct  398  -------------------NRKVAYPRPSASPLY  412



>ref|XP_006654906.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=419

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  250  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRALDKN  309

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KR++FR+LD+RL GQY+L  +QK A LAL C+S + + RP M
Sbjct  310  RPTGEHNLVEWARPYLTSKRRIFRILDARLGGQYSLAKAQKAATLALQCISVEAKNRPNM  369

Query  531  DDVVKELEQLKESKDMTT  478
            + VV  LEQL+++K+  T
Sbjct  370  EQVVAVLEQLQDAKETGT  387



>gb|AFK40483.1| unknown [Lotus japonicus]
Length=163

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 126/185 (68%), Gaps = 28/185 (15%)
 Frame = -1

Query  840  MGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLA  661
            MGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSG++ +D NRP G+HNLVEWAKPYLA
Sbjct  1    MGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGKKAVDKNRPSGQHNLVEWAKPYLA  60

Query  660  NKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT  481
            NKRKVFRVLDSRLEGQY+ + + KVA LAL CLS + +FRP MD+VVK LEQL+ SK   
Sbjct  61   NKRKVFRVLDSRLEGQYSSDEAYKVATLALRCLSTESKFRPNMDEVVKALEQLQVSKVKG  120

Query  480  TLSNKH-DGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPS  304
               N   +G+R  R+S   V  +  L                           ++YPRPS
Sbjct  121  GNQNASANGARMRRKSADDVGRVRTL---------------------------SSYPRPS  153

Query  303  TSPLY  289
             SPLY
Sbjct  154  ASPLY  158



>gb|ACG32116.1| protein kinase APK1B [Zea mays]
Length=419

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L  +Q +A LAL CLS + + RPTM
Sbjct  292  RPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLNGAQTIAALALECLSYEAKMRPTM  351

Query  531  DDVVKELEQLKESKD  487
            D VV  LE+L+ S +
Sbjct  352  DAVVAILEELQGSGE  366



>gb|ACF87678.1| unknown [Zea mays]
 tpg|DAA52220.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=419

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L  +Q +A LAL CLS + + RPTM
Sbjct  292  RPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLNGAQTIAALALECLSYEAKMRPTM  351

Query  531  DDVVKELEQLKESKD  487
            D VV  LE+L+ S +
Sbjct  352  DAVVAILEELQGSGE  366



>ref|NP_001241128.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006601852.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 ref|XP_006601853.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Glycine max]
 gb|ACM89535.1| protein kinase [Glycine max]
 gb|KHN13986.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHL+ KSDVYSFGVVLLEM+SGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTRGYAAPEYLATGHLTTKSDVYSFGVVLLEMISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +Q  A LA+ C S +P+ RP M
Sbjct  289  QPTGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSQNRAQAAAALAMQCFSVEPKCRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG  430
            D+VVK LE+L+ESK+M      H   +HH R+ G
Sbjct  349  DEVVKALEELQESKNMQRKGADH--KQHHVRNSG  380



>ref|XP_002316286.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
 gb|EEF02457.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
Length=415

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 7/150 (5%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTR+MGTYGYAAPEY++TGHL+A+SDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGSKSHVSTRIMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLVEWA+PYL++KR++F+V+D+R++GQY+   + K ANLA+ CLS +P++RP M
Sbjct  290  RPSKEHNLVEWARPYLSSKRRIFQVMDARIQGQYSSSDALKAANLAIQCLSTEPKYRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHR  442
            + VVK LEQL  S D       +DGS+  R
Sbjct  350  EAVVKALEQLHNSND-------NDGSKGSR  372



>ref|XP_004239839.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=409

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 138/200 (69%), Gaps = 19/200 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD+SHVSTRV+GTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+LSG++ ID N
Sbjct  228  LARDGPVGDQSHVSTRVVGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEILSGKKAIDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLV+WAKPYL +K +V RVLD+RLEGQY+L  + KVA L+  C+S +P+ RPTM
Sbjct  288  RPMGEHNLVDWAKPYLTSKLRVSRVLDARLEGQYSLSHALKVAILSFQCISTEPKSRPTM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VV  LEQL++SKD+     K      H +S  A ++    K S + T           
Sbjct  348  DEVVTALEQLQQSKDVAKNDKKVRQVNQHSQSSFAFKK--SCKSSTEETP----------  395

Query  351  gDAISRNATAAYPRPSTSPL  292
                   A + YPRPS S L
Sbjct  396  -------AESNYPRPSLSFL  408



>ref|XP_010542646.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010542647.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=398

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  227  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLEILSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPY+ANKRK+FRV+D+RL+ QY++E + KVA LAL CLS + + RP M
Sbjct  287  RPTGQHNLVEWAKPYMANKRKIFRVIDNRLQDQYSMEEAYKVAILALRCLSAEVKLRPNM  346

Query  531  DDVVKELEQLK  499
             +VV +LEQ++
Sbjct  347  KEVVSQLEQIQ  357



>ref|XP_007009312.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18122.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=410

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 138/205 (67%), Gaps = 29/205 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEY++TGHL+A+SDVYSFGVVLLEML+G+R +D N
Sbjct  228  LAKDGPTGDKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGKRAVDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  E NLV+WAKPYL +KRK+ +V+D+R+EGQYTL+V+ K A +AL CLS +P+ RP M
Sbjct  288  RPSREQNLVDWAKPYLTSKRKILQVMDARIEGQYTLDVALKAAYVALQCLSIEPKLRPNM  347

Query  531  DDVVKELEQLKESKDM-----TTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrr  367
            + VVK LEQL+++ D       ++ N H  SR+  +         Q K + D        
Sbjct  348  NAVVKVLEQLQDTGDKGGPRNASVQNSHQNSRNAAK--------FQRKNAND--------  391

Query  366  rrrsdgDAISRNATAAYPRPSTSPL  292
                    +      + P+PS SPL
Sbjct  392  --------VCNGIDGSCPQPSASPL  408



>ref|XP_003616403.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES99361.1| kinase 1B [Medicago truncatula]
Length=418

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD SHVSTRVMGTYGYAAPEY++TGHL+ KSDVYSFGVVLLE++SG+R +D N
Sbjct  231  LAKDGPAGDNSHVSTRVMGTYGYAAPEYMATGHLTKKSDVYSFGVVLLEIMSGKRALDNN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKPYL +KR+VF+V+D+R+EGQYT+  + KVA+LA+ CLS +PRFRP M
Sbjct  291  RPSGEHNLIEWAKPYLNSKRRVFQVMDARIEGQYTVRQAMKVADLAVRCLSVEPRFRPKM  350

Query  531  DDVVKELEQLKES  493
            D++V+ LE+L+ S
Sbjct  351  DEIVRVLEELQSS  363



>ref|XP_007218037.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
 gb|EMJ19236.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
Length=366

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD+SHVSTR+MGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  152  LAKDGPAGDRSHVSTRIMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  211

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRKV ++ D+R+EGQY++  + +  NLA+ CL+ +P+FR  M
Sbjct  212  RPSGEHNLVEWAKPYLASKRKVLQIFDARIEGQYSVGGALRAVNLAIRCLAVEPKFRLNM  271

Query  531  DDVVKELEQLKE  496
            +DVVK LEQL+E
Sbjct  272  NDVVKALEQLQE  283



>ref|NP_001145874.1| uncharacterized protein LOC100279389 [Zea mays]
 gb|ACL52773.1| unknown [Zea mays]
Length=419

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK FR+LD+RLEGQY L  +Q +A LAL CLS + + RPTM
Sbjct  292  RPQGEHNLVEWARPYLTHKRKTFRILDTRLEGQYNLNGAQTIAALALECLSYEAKMRPTM  351

Query  531  DDVVKELEQLKESKD  487
            D VV  LE+L+ S +
Sbjct  352  DAVVAILEELQGSGE  366



>ref|NP_001141912.1| uncharacterized LOC100274061 [Zea mays]
 gb|ACF87298.1| unknown [Zea mays]
 gb|AFW67139.1| putative protein kinase superfamily protein [Zea mays]
Length=418

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLE+LSGRR ID N
Sbjct  230  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEVLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A L+L CLS + + RPTM
Sbjct  290  RPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIAALSLECLSYEAKMRPTM  349

Query  531  DDVVKELEQLKESKD  487
            D VV  LE+L++S +
Sbjct  350  DAVVTILEELQDSGE  364



>ref|XP_011091519.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=397

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 32/202 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KSHVSTRVMGTYGYAAPEY++TGHL+A+SDVYSFGVVLLEML+GRRV+D N
Sbjct  228  LAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NL+EWA+PYLA+KR+V RV+D+RLEGQY+   + + A LA+ CL+ +P+ RPTM
Sbjct  288  RPHGEQNLIEWARPYLASKRRVLRVMDARLEGQYSPSGALRAATLAIKCLALEPKHRPTM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            DDVVK LEQL+E   + T     +  +H R  D            ED+++          
Sbjct  348  DDVVKALEQLQEMGSVKT----EEAQKHRRARD------------EDSSS----------  381

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                     A+YPRPS SP+ A
Sbjct  382  ------RKMASYPRPSVSPILA  397



>ref|XP_012089179.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Jatropha 
curcas]
 gb|KDP44953.1| hypothetical protein JCGZ_01453 [Jatropha curcas]
Length=415

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTRVMGTYGYAAPEY++TGHL+ KSD+YSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGSKSHVSTRVMGTYGYAAPEYMATGHLTKKSDIYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P  E NLVEWA+PYL +KRK+F+V+D+R+EGQY+L+ + K A LA+ CLS +PR+RP M
Sbjct  290  KPSREQNLVEWARPYLGSKRKIFQVMDARIEGQYSLKDALKAATLAVQCLSTEPRYRPNM  349

Query  531  DDVVKELEQLKESKD  487
            ++VVK LEQL ES D
Sbjct  350  EEVVKALEQLLESND  364



>ref|XP_009412594.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+G KSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVL+E+L+G+R ID N
Sbjct  234  LAKDGPSGSKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLVELLTGQRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLVEWAKPYLA+KR+V R++DSRL+GQY++  +Q+ A LAL CLS   + RP+M
Sbjct  294  RPSEEHNLVEWAKPYLASKRRVIRIMDSRLQGQYSVAGAQRTAGLALQCLSMQAKRRPSM  353

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGA  427
            D VV  LEQL+++ DM         S  HR SD A
Sbjct  354  DQVVIALEQLQDATDMERTPKTELKSSGHRGSDRA  388



>gb|AGU99598.1| protein kinase [Triticum aestivum]
Length=472

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  272  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  331

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A LA+ CLS + + RP+M
Sbjct  332  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLNGAQTIAALAVECLSFEAKMRPSM  391

Query  531  DDVVKELEQLKESKD  487
            D VV  LE +++S D
Sbjct  392  DAVVSILEGIQDSSD  406



>gb|ABC74580.1| rust resistance gene ABC1041 [Hordeum vulgare subsp. vulgare]
 gb|ABF18544.1| serine/threonine kinase-like protein ABC1041 [Hordeum vulgare 
subsp. vulgare]
Length=425

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A LA+ CLS + + RP+M
Sbjct  292  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLNGAQTIAALAVECLSFEAKMRPSM  351

Query  531  DDVVKELEQLKESKDMT  481
            + VV  LE +++S D T
Sbjct  352  EAVVSILEGIQDSSDPT  368



>ref|NP_001241432.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006582915.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 gb|ACM89505.1| protein kinase [Glycine max]
 gb|KHN40300.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 138/200 (69%), Gaps = 20/200 (10%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLEM+SGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLEMISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WAKPYL+NKR+VFRV+D RLEGQY    +Q  A LA+ CLS + R RP M
Sbjct  289  QPTGEHNLVDWAKPYLSNKRRVFRVIDPRLEGQYLQSRAQAAAALAIQCLSIEARCRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVK LEQL+ESK+M      H   +HH R+ G          S+              
Sbjct  349  DEVVKALEQLQESKNMQRKGADH--KQHHVRNSGPGRSNGGNGGSD--------------  392

Query  351  gDAISRNATAAYPRPSTSPL  292
               + R A+ AYPRPS S L
Sbjct  393  ---VPRKAS-AYPRPSASLL  408



>ref|XP_010543301.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=387

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT+GYAAPEYLSTGHL+AKSDVYSFGVVLLEM+SGRR ID N
Sbjct  224  LARDGPTGDKSHVSTRVMGTHGYAAPEYLSTGHLTAKSDVYSFGVVLLEMVSGRRAIDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P G+HNLV+WAKPYL NKR+V RV+D RL+GQY+L  + KVA LA  CLS D + RP M
Sbjct  284  QPTGQHNLVDWAKPYLTNKRRVLRVMDPRLQGQYSLNRALKVAMLAFDCLSVDAKLRPGM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVE  421
            +DVVK LE+L+  K         +G    R +   V+
Sbjct  344  NDVVKALEELQSHKAAVHGEQNSNGGSDSRETSQTVD  380



>gb|AAO18450.1| putative protein kinase [Oryza sativa Japonica Group]
Length=416

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLEM+SGRR ID N
Sbjct  234  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEMMSGRRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+   +Q VA LAL CLS + + RP+M
Sbjct  294  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSHVGAQTVATLALECLSYEAKMRPSM  353

Query  531  DDVVKELEQLKES  493
            + VV  LE+L+ES
Sbjct  354  EAVVTILEELQES  366



>gb|AFK41166.1| unknown [Medicago truncatula]
 gb|KEH22883.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 139/201 (69%), Gaps = 23/201 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYSFGVVLLE++SGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTRGYAAPEYLATGHLTAKSDVYSFGVVLLEIISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
             P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +   A LA  CLS +PR RP M
Sbjct  289  LPSGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSHSRAHAAAALASQCLSVEPRIRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVK LEQL+E KD     ++  GS H  R+   +   A  K + D T           
Sbjct  349  DEVVKTLEQLQEPKD-----SQKKGSDHRARNSN-LGLNASGKGNADAT-----------  391

Query  351  gDAISRNATAAYPRPSTSPLY  289
                 R A+ AYPRPS S L+
Sbjct  392  -----RKAS-AYPRPSASLLH  406



>ref|XP_008457480.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cucumis melo]
Length=374

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 132/205 (64%), Gaps = 41/205 (20%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHLSAKSDVYSFGVVLLEM+SGRR ID N
Sbjct  206  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLSAKSDVYSFGVVLLEMISGRRAIDKN  265

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKP LAN+RK FR+LD+R+E  Y++E + ++A LA  CLS +PRFRP M
Sbjct  266  RPQGEQNLVEWAKPLLANRRKTFRLLDARIERNYSMESAFRLAVLASRCLSAEPRFRPNM  325

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHR----RSDGAVEELAQLKESEDTTTLgsrrr  364
            D++V  L  L++SK          G R  R     +DG  +E+                 
Sbjct  326  DEIVTMLNDLQDSKGT-------GGPRRSRTCKQNTDGGNKEV-----------------  361

Query  363  rrsdgDAISRNATAAYPRPSTSPLY  289
                          AYPRPS S L+
Sbjct  362  -------------TAYPRPSASALF  373



>ref|NP_001051730.1| Os03g0821900 [Oryza sativa Japonica Group]
 gb|ABF99600.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13644.1| Os03g0821900 [Oryza sativa Japonica Group]
 dbj|BAG92171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76429.1| hypothetical protein OsI_14109 [Oryza sativa Indica Group]
 gb|EEE60197.1| hypothetical protein OsJ_13155 [Oryza sativa Japonica Group]
Length=424

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVLLEM+SGRR ID N
Sbjct  234  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEMMSGRRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+   +Q VA LAL CLS + + RP+M
Sbjct  294  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSHVGAQTVATLALECLSYEAKMRPSM  353

Query  531  DDVVKELEQLKES  493
            + VV  LE+L+ES
Sbjct  354  EAVVTILEELQES  366



>ref|XP_008457478.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cucumis melo]
 ref|XP_008457479.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cucumis melo]
Length=397

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 132/205 (64%), Gaps = 41/205 (20%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHLSAKSDVYSFGVVLLEM+SGRR ID N
Sbjct  229  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLSAKSDVYSFGVVLLEMISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKP LAN+RK FR+LD+R+E  Y++E + ++A LA  CLS +PRFRP M
Sbjct  289  RPQGEQNLVEWAKPLLANRRKTFRLLDARIERNYSMESAFRLAVLASRCLSAEPRFRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHR----RSDGAVEELAQLKESEDTTTLgsrrr  364
            D++V  L  L++SK          G R  R     +DG  +E+                 
Sbjct  349  DEIVTMLNDLQDSKGT-------GGPRRSRTCKQNTDGGNKEV-----------------  384

Query  363  rrsdgDAISRNATAAYPRPSTSPLY  289
                          AYPRPS S L+
Sbjct  385  -------------TAYPRPSASALF  396



>ref|XP_007218038.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
 gb|EMJ19237.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
Length=431

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD+SHVSTR+MGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  217  LAKDGPAGDRSHVSTRIMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  276

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRKV ++ D+R+EGQY++  + +  NLA+ CL+ +P+FR  M
Sbjct  277  RPSGEHNLVEWAKPYLASKRKVLQIFDARIEGQYSVGGALRAVNLAIRCLAVEPKFRLNM  336

Query  531  DDVVKELEQLKE  496
            +DVVK LEQL+E
Sbjct  337  NDVVKALEQLQE  348



>ref|XP_006650809.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=423

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+ KSDVYSFGVVLLEM+SGRR ID N
Sbjct  234  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTPKSDVYSFGVVLLEMMSGRRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+   +Q VA LAL CLS + + RP+M
Sbjct  294  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSHVGAQTVATLALECLSYETKMRPSM  353

Query  531  DDVVKELEQLKESKD  487
            D VV  LE+L+ES +
Sbjct  354  DAVVTILEELQESSN  368



>ref|XP_002311169.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|EEE88536.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 135/200 (68%), Gaps = 18/200 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTRVMGT+GYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGSKSHVSTRVMGTHGYAAPEYMATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  E  LVEWA+PYL++KRK+F+V+D+R++GQY+   + K ANLA+ CLS +PR+RP M
Sbjct  290  RPSKEQYLVEWARPYLSSKRKIFQVMDARIQGQYSSSDALKAANLAIQCLSAEPRYRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VVK LEQL         SN +DGSR  R   G +        S   T           
Sbjct  350  EEVVKALEQLHN-------SNNNDGSRGSR---GEIPRRVHRSSSNGPT--------YHR  391

Query  351  gDAISRNATAAYPRPSTSPL  292
             + +S    A+Y  P  SPL
Sbjct  392  KNEVSNGKPASYAGPCVSPL  411



>ref|XP_006379595.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|ERP57392.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 135/200 (68%), Gaps = 18/200 (9%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTRVMGT+GYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGSKSHVSTRVMGTHGYAAPEYMATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  E  LVEWA+PYL++KRK+F+V+D+R++GQY+   + K ANLA+ CLS +PR+RP M
Sbjct  290  RPSKEQYLVEWARPYLSSKRKIFQVMDARIQGQYSSSDALKAANLAIQCLSAEPRYRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            ++VVK LEQL         SN +DGSR  R   G +        S   T           
Sbjct  350  EEVVKALEQLHN-------SNNNDGSRGSR---GEIPRRVHRSSSNGPT--------YHR  391

Query  351  gDAISRNATAAYPRPSTSPL  292
             + +S    A+Y  P  SPL
Sbjct  392  KNEVSNGKPASYAGPCVSPL  411



>ref|XP_006417790.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
 gb|ESQ36143.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
Length=413

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 134/201 (67%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  227  LAKDGPVGDKSHVSTRVMGTYGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYLANKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  287  RPSGERNLVEWAKPYLANKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++              S +  R         +++   D+ T        + 
Sbjct  347  REVVSHLEHIQ--------------SLNATRGGNMDRTERRVRRRSDSITTKKPNAGFAR  392

Query  351  gDAISRNATAAYPRPSTSPLY  289
              A+  +   AYPRPS SPLY
Sbjct  393  QTAVG-STVVAYPRPSASPLY  412



>gb|EMT32058.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=423

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGT+GYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPVGEKSHVSTRVMGTHGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A LA+ CLS + + RP+M
Sbjct  290  RPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLNGAQTIAALAVECLSFEAKMRPSM  349

Query  531  DDVVKELEQLKESKD  487
            D VV  LE +++S D
Sbjct  350  DAVVSILEGIQDSSD  364



>ref|XP_010937617.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Elaeis guineensis]
Length=415

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 141/209 (67%), Gaps = 33/209 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  233  LAKDGPTGDKSHVSTRVMGTFGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  292

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL+NK+K+FR+LD+RL GQY+L  +QK A LAL CLS D ++R  M
Sbjct  293  RPAGEHNLVEWARPYLSNKKKIFRILDTRLGGQYSLGGAQKAAALALQCLSIDSKYRLNM  352

Query  531  DDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgs  373
            D+VV  LEQL+++KD           S+++ GS  HR    ++EE    K          
Sbjct  353  DEVVSALEQLQDAKDTGRNPHTERKGSSQNVGSNLHRYRRRSLEEAGSRK----------  402

Query  372  rrrrrsdgDAISRNATAAYPRPSTSPLYA  286
                             A+ R S SPLYA
Sbjct  403  ----------------GAHARSSASPLYA  415



>ref|XP_010678048.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP+GDKS+VSTRVMGTYGYAAPEY++TGHL+AKSD+YSFGVVLLE+LSG+RVID N
Sbjct  228  LARDGPSGDKSYVSTRVMGTYGYAAPEYVATGHLTAKSDIYSFGVVLLEILSGKRVIDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYL NKRK+FRVLD R+EGQY+L+ + KVA LAL CLS DP+ RP M
Sbjct  288  RPNGEQKLVEWAKPYLTNKRKIFRVLDPRIEGQYSLDHAVKVATLALKCLSIDPKLRPNM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTT  382
            + V KELE+L+  ++ T     H   +  RR+ G       L+++  +T+
Sbjct  348  NMVSKELEKLQVPQE-TIRRETHLPGQLTRRAVGVQSCRHTLQKASGSTS  396



>ref|XP_010678047.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP+GDKS+VSTRVMGTYGYAAPEY++TGHL+AKSD+YSFGVVLLE+LSG+RVID N
Sbjct  229  LARDGPSGDKSYVSTRVMGTYGYAAPEYVATGHLTAKSDIYSFGVVLLEILSGKRVIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKPYL NKRK+FRVLD R+EGQY+L+ + KVA LAL CLS DP+ RP M
Sbjct  289  RPNGEQKLVEWAKPYLTNKRKIFRVLDPRIEGQYSLDHAVKVATLALKCLSIDPKLRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTT  382
            + V KELE+L+  ++ T     H   +  RR+ G       L+++  +T+
Sbjct  349  NMVSKELEKLQVPQE-TIRRETHLPGQLTRRAVGVQSCRHTLQKASGSTS  397



>ref|XP_010937616.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Elaeis guineensis]
Length=423

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 141/209 (67%), Gaps = 33/209 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  241  LAKDGPTGDKSHVSTRVMGTFGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRAVDKN  300

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL+NK+K+FR+LD+RL GQY+L  +QK A LAL CLS D ++R  M
Sbjct  301  RPAGEHNLVEWARPYLSNKKKIFRILDTRLGGQYSLGGAQKAAALALQCLSIDSKYRLNM  360

Query  531  DDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgs  373
            D+VV  LEQL+++KD           S+++ GS  HR    ++EE    K          
Sbjct  361  DEVVSALEQLQDAKDTGRNPHTERKGSSQNVGSNLHRYRRRSLEEAGSRK----------  410

Query  372  rrrrrsdgDAISRNATAAYPRPSTSPLYA  286
                             A+ R S SPLYA
Sbjct  411  ----------------GAHARSSASPLYA  423



>ref|XP_007140532.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
 gb|ESW12526.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
Length=410

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYSFGVVLLEM+SGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTRGYAAPEYLATGHLTAKSDVYSFGVVLLEMISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WAKPYL+NKR+VFRV+D RLEGQY+   +Q  A LA+ CLS + + RP M
Sbjct  289  QPSGEHNLVDWAKPYLSNKRRVFRVMDPRLEGQYSHSRAQAAAALAMQCLSVESKCRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG  430
            ++VVK LEQ++ESKDM      H    HH R+ G
Sbjct  349  EEVVKALEQVQESKDMQRKGADHK--HHHLRNSG  380



>ref|XP_004145296.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Cucumis 
sativus]
 ref|XP_011658173.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65726.1| hypothetical protein Csa_1G522520 [Cucumis sativus]
Length=397

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 133/201 (66%), Gaps = 33/201 (16%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHLSAKSDVYSFGVVLLEM+SGRR ID N
Sbjct  229  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLSAKSDVYSFGVVLLEMISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKP LAN+RK FR+LD+R+E  Y++E + ++A LA  CLS +P+FRP M
Sbjct  289  RPQGEQNLVEWAKPLLANRRKTFRLLDTRIERNYSMESAFRLAVLASRCLSAEPKFRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D++VK L  L++ K          GS   +RS          K++ D+            
Sbjct  349  DEIVKMLNDLQDLK----------GSGGPKRSR-------TCKQNTDS------------  379

Query  351  gDAISRNATAAYPRPSTSPLY  289
                      AYPRPS S L+
Sbjct  380  ----GNKEVTAYPRPSASALF  396



>ref|XP_006365700.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=394

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 133/200 (67%), Gaps = 28/200 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KSHVSTRVMGT+GYAAPEY++TGH++A+SDVYSFGVVLLEML+GRRV+D N
Sbjct  221  LAKDGPIDGKSHVSTRVMGTFGYAAPEYMATGHITARSDVYSFGVVLLEMLTGRRVMDKN  280

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKP+L +KRKV R++D R+EGQY++E + + A LA+ CL+ +P+FRP M
Sbjct  281  RPHGEHNLIEWAKPFLTSKRKVLRIMDHRIEGQYSVEGALRAALLAVKCLALEPKFRPKM  340

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VVK LEQL+   +  +L  +    +HHR S                            
Sbjct  341  PEVVKALEQLQNLNESGSLKRETTQRKHHRTSTDEA------------------------  376

Query  351  gDAISRNATAAYPRPSTSPL  292
                S   T +YPRP+ SPL
Sbjct  377  ----SGRKTTSYPRPAASPL  392



>ref|XP_010501359.1| PREDICTED: protein kinase APK1A, chloroplastic-like, partial 
[Camelina sativa]
Length=305

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 131/202 (65%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  119  LAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  178

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  179  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEVKLRPNM  238

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD    + A    +  T            
Sbjct  239  SEVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAGFARQTAV----------  288

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                  +   AYPRPS SPLY 
Sbjct  289  -----GSTVVAYPRPSASPLYV  305



>ref|XP_009626085.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=395

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 134/199 (67%), Gaps = 28/199 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KS+VSTRVMGTYGYAAPEY++TGHL+A+SD+YSFGVVLLEM++GRRV+D N
Sbjct  221  LAKDGPVDGKSYVSTRVMGTYGYAAPEYMATGHLTARSDIYSFGVVLLEMMTGRRVVDKN  280

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NL+EWAKP+L++KRKV R++D R+EGQY+LE + K A LA+ CL+ +P+FRP M
Sbjct  281  RPHGEQNLIEWAKPFLSSKRKVLRIMDPRIEGQYSLEGALKAALLAVKCLALEPKFRPKM  340

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VVK LEQL+ S +  +L       RH             L+   D             
Sbjct  341  HEVVKALEQLQNSNESGSLKRDQTQRRH-------------LRTCTDEA-----------  376

Query  351  gDAISRNATAAYPRPSTSP  295
                SR  T++YPRP+ SP
Sbjct  377  ----SRRKTSSYPRPAASP  391



>gb|EPS59398.1| hypothetical protein M569_15409, partial [Genlisea aurea]
Length=375

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPT DKSHVSTRVMGTYGYAAPEYLSTGHL+AKSDVYSFGVVL+E+L+G++ ID N
Sbjct  231  LARDGPTDDKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLVEILTGKKAIDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL NKR+V  V+D RLEGQY++    K  +LAL CLS DPR RP M
Sbjct  291  RPPGEHNLVEWAKPYLGNKRRVLSVVDGRLEGQYSVATVAKTGSLALQCLSTDPRTRPNM  350

Query  531  DDVVKELEQLKES  493
            +++V  LEQL++S
Sbjct  351  EEIVNALEQLQDS  363



>ref|XP_009759469.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=395

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 137/199 (69%), Gaps = 28/199 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KS+VSTRVMGTYGYAAPEY++TGHL+A+SD+YSFGVVLLEML+GRRV+D N
Sbjct  221  LAKDGPVDGKSYVSTRVMGTYGYAAPEYMATGHLTARSDIYSFGVVLLEMLTGRRVVDKN  280

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NL+EWAKP+L++KRKV R++D R+EGQY++E + K A LA+ CL+ +P+FRP M
Sbjct  281  RPHGEQNLIEWAKPFLSSKRKVLRIMDPRIEGQYSVEGALKAALLAVKCLALEPKFRPKM  340

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VVK LEQL+ S +  +L  +    R HRR+    +E                      
Sbjct  341  HEVVKALEQLQNSNESGSL-KRDQTQRKHRRT--CTDE----------------------  375

Query  351  gDAISRNATAAYPRPSTSP  295
                SR  T++YPRP+ SP
Sbjct  376  ---ASRRKTSSYPRPAASP  391



>ref|XP_011027201.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=415

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 124/164 (76%), Gaps = 12/164 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTR+MGTYGYAAPEY++TGHL+A+SDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGSKSHVSTRIMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  E NLVEWA+PYL++KR++F+V+D+R++GQY+   + K ANLA+ CLS +P++RP M
Sbjct  290  RPSKEQNLVEWARPYLSSKRRIFQVMDARIQGQYSSSDALKAANLAIQCLSAEPKYRPHM  349

Query  531  DDVVKELEQLKESKDMTTLSNKH------------DGSRHHRRS  436
            + VVK LEQL  S D       H            +G ++HR++
Sbjct  350  EAVVKALEQLNNSNDNDGSKGSHGENPLRVNRSSSNGPKYHRKN  393



>gb|EYU33216.1| hypothetical protein MIMGU_mgv1a011111mg [Erythranthe guttata]
Length=292

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 136/204 (67%), Gaps = 37/204 (18%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KSHVSTR+MGTYGYAAPEY++TGHL+A+SDVYSFGVVLLE+L+G+RV+D N
Sbjct  124  LAKDGPMDGKSHVSTRIMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEILTGKRVLDKN  183

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NL+EWAKPYLA+KR+V R++D+R+EGQYT   + K A LA+ C++ +P++RPTM
Sbjct  184  RPHGEQNLIEWAKPYLASKRRVLRIMDARIEGQYTPSGALKAATLAIKCIATEPKYRPTM  243

Query  531  DDVVKELEQLKESKDMTTLSN-KHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrs  355
            ++VVK LEQL+ES         + D  + HR                             
Sbjct  244  NEVVKGLEQLQESGTAVKPEQVEADQQKLHR-----------------------------  274

Query  354  dgDAISRNATAAYPRPST-SPLYA  286
                  R ATA+YPRPS+ SP+ A
Sbjct  275  ------RKATASYPRPSSASPVVA  292



>ref|XP_004492356.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Cicer arietinum]
 ref|XP_004492357.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Cicer arietinum]
Length=407

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 138/201 (69%), Gaps = 23/201 (11%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYSFGVVLLEM+SGRR ID N
Sbjct  229  LARDGPTGDKSHVSTRVMGTRGYAAPEYLATGHLTAKSDVYSFGVVLLEMISGRRAIDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
             P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +   A LA  CLS +PR RP M
Sbjct  289  LPSGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSHTRAHAAAALASQCLSVEPRIRPNM  348

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D+VVK LEQL+E K+      +  G+ H  R  G +   +  K + D             
Sbjct  349  DEVVKTLEQLQEPKE-----TQKKGADHRVRYPG-LGNNSSGKGNADA------------  390

Query  351  gDAISRNATAAYPRPSTSPLY  289
                SR A+ AYPRPS S L+
Sbjct  391  ----SRKAS-AYPRPSASLLH  406



>ref|XP_002892407.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68666.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 132/201 (66%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  224  LAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  284  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD  V + A    +  T            
Sbjct  344  SEVVSHLEHIQSLNAAIGGNMDRTERRMRRRSDSVVSKKANAGFARQTAV----------  393

Query  351  gDAISRNATAAYPRPSTSPLY  289
                  +   AYPRPS SPLY
Sbjct  394  -----GSTVVAYPRPSASPLY  409



>ref|XP_009140954.1| PREDICTED: protein kinase APK1B, chloroplastic [Brassica rapa]
Length=418

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 131/202 (65%), Gaps = 13/202 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLMTGHLTTKSDVYSYGVVLLEILSGRRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  290  RPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVATLALRCLTTEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++   +     N     R  RR               D+  +  +      
Sbjct  350  TEVVAHLEHIQTLHETGGGRNIDKMERRTRRRS-------------DSVVVSQKPNAGFA  396

Query  351  gDAISRNATAAYPRPSTSPLYA  286
              +      AAYPRPS SPL+ 
Sbjct  397  RQSAVGGIAAAYPRPSASPLFV  418



>emb|CDX77220.1| BnaC04g40150D [Brassica napus]
Length=418

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 131/201 (65%), Gaps = 13/201 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLMTGHLTTKSDVYSYGVVLLEILSGRRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  290  RPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVATLALRCLTTEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++   +     N     R  RR               D+  +  +      
Sbjct  350  TEVVAHLEHIQTLHETGGGRNIDKMERRTRRRS-------------DSVVVSQKPNAGFA  396

Query  351  gDAISRNATAAYPRPSTSPLY  289
              +      AAYPRPS SPL+
Sbjct  397  RQSAVGGIAAAYPRPSASPLF  417



>ref|XP_006294292.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
 gb|EOA27190.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
Length=414

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  227  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRVVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWAKP LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  287  RPPGEQKLVEWAKPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  347  NEVVAHLEHIQTLNEAGGRNVDKVERRMRRRSDSVAINQKPNAGFARQT-----------  395

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  396  ---AVGVIAT-AYPRPSNSPLF  413



>ref|XP_010067409.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW65537.1| hypothetical protein EUGRSUZ_G02935 [Eucalyptus grandis]
Length=392

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 129/162 (80%), Gaps = 9/162 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGT+GYAAPEY++TGHL+A+SDVYSFGVVLLEML GRR +D N
Sbjct  222  LAKDGPTGDKSHVSTRIMGTFGYAAPEYMATGHLTARSDVYSFGVVLLEMLCGRRAVDKN  281

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLVEWAKP L +KRK+ +V+D R++GQY++  + K+A LA+ CLS +P++RPTM
Sbjct  282  RPAREHNLVEWAKPCLTSKRKILQVMDPRIQGQYSVGGALKLAKLAIGCLSTEPKYRPTM  341

Query  531  DDVVKELEQLK---ESKDMTTL------SNKHDGSRHHRRSD  433
            ++VV+ LEQL+   E+K   TL      S+  DGS+H R ++
Sbjct  342  NEVVRALEQLQASEEAKANETLSEGQHPSSSSDGSKHPRSTN  383



>ref|XP_011030315.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Populus 
euphratica]
Length=415

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 122/150 (81%), Gaps = 7/150 (5%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG KSHVSTRVMGT+GYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRR ID N
Sbjct  230  LAKDGPTGSKSHVSTRVMGTHGYAAPEYVATGHLTAKSDVYSFGVVLLEMLSGRRAIDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P  E +LVEWA+PYL++KRK+F+V+D+R++GQY+   + +VANLA+ CLS +PR+RP M
Sbjct  290  KPSKEQHLVEWARPYLSSKRKIFQVMDARIQGQYSSSDALEVANLAIQCLSAEPRYRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHR  442
             +VVK LEQL         SN +DGSR  R
Sbjct  350  KEVVKALEQLHN-------SNNNDGSRGSR  372



>ref|XP_004142067.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
sativus]
 gb|KGN54255.1| hypothetical protein Csa_4G296090 [Cucumis sativus]
Length=384

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD+SHVST++MGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLE+LSGRR +D N
Sbjct  230  LARDGPIGDQSHVSTKIMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLELLSGRRALDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLV+WAKPYL NK K+ RV+D+RLEG Y L  +Q+ ANLA  CL+ DP++RPTM
Sbjct  290  RPTGEHNLVDWAKPYLVNKHKIRRVMDNRLEGHYALGQAQRAANLAFLCLAIDPKYRPTM  349

Query  531  DDVVKELEQL-KESKDMTTLSNKHDGSRHHR  442
            ++VV  LEQL K S+ + +    H+G  + R
Sbjct  350  NEVVTSLEQLQKPSEVLRSGRESHNGQSNGR  380



>gb|AGP76187.1| MLPK [Brassica rapa subsp. chinensis]
Length=418

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 131/201 (65%), Gaps = 13/201 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLMTGHLTTKSDVYSYGVVLLEILSGRRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  290  RPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVATLALRCLTTEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++   +     N     R  RR               D+  +  +      
Sbjct  350  TEVVAHLEHIQTLHETGGGRNIDKLERRTRRRS-------------DSVVVSQKPNAGFA  396

Query  351  gDAISRNATAAYPRPSTSPLY  289
              +      AAYPRPS SPL+
Sbjct  397  RQSAVGGIAAAYPRPSASPLF  417



>gb|KHN32126.1| Protein kinase APK1B, chloroplastic, partial [Glycine soja]
Length=365

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT +KSH STRVMGTYGYAAPEYL+TG+LSAKSDV+SFGVVLLEMLSGRR +D N
Sbjct  198  LAKDGPTREKSHASTRVMGTYGYAAPEYLATGNLSAKSDVFSFGVVLLEMLSGRRAVDKN  257

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL+NKRK+ RVLD+RLEGQY L+ + KVA L+L CL+ + + RPTM
Sbjct  258  RPSGQHNLVEWAKPYLSNKRKLLRVLDNRLEGQYELDEACKVATLSLRCLAIESKLRPTM  317

Query  531  DDVVKELEQLK  499
            D+V  +LEQL+
Sbjct  318  DEVATDLEQLQ  328



>emb|CDY31741.1| BnaA04g16770D [Brassica napus]
Length=418

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 131/201 (65%), Gaps = 13/201 (6%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLMTGHLTTKSDVYSYGVVLLEILSGRRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  290  RPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVATLALRCLTTEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++   +     N     R  RR               D+  +  +      
Sbjct  350  TEVVAHLEHIQTLHETGGGRNIDKLERRTRRRS-------------DSVVVSQKPNAGFA  396

Query  351  gDAISRNATAAYPRPSTSPLY  289
              +      AAYPRPS SPL+
Sbjct  397  RQSAVGGIAAAYPRPSASPLF  417



>ref|XP_004142761.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
sativus]
 gb|KGN51318.1| hypothetical protein Csa_5G517160 [Cucumis sativus]
Length=401

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 136/200 (68%), Gaps = 28/200 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+S+VSTRVMGT+GYAAPEY+ TGHL+AKSDVYSFGVVLLE+LSGRR ID N
Sbjct  228  LAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL +KR+V ++LD+R+EGQY+   + K A LA+ C+S +P+ RP M
Sbjct  288  RPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAAKLAIQCISTEPKLRPNM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            + VVK LEQL++S + +       GSR              L E  +T++          
Sbjct  348  NAVVKALEQLQDSSETS-------GSR------------GTLSEPLNTSS---------Q  379

Query  351  gDAISRNATAAYPRPSTSPL  292
            G   + N   +YPRPS S L
Sbjct  380  GSGSTNNKPVSYPRPSASVL  399



>ref|XP_009384874.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009384875.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 131/200 (66%), Gaps = 23/200 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+L+GRR ID N
Sbjct  224  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEILTGRRAIDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE+ LVEWAKP+LA+KRK+  +LDSRL  QY+L  +QK+A LA  CLS + + RPTM
Sbjct  284  RPTGEYKLVEWAKPHLASKRKIISILDSRLRAQYSLAGAQKIAGLADRCLSLETKHRPTM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D VV  LEQL+  KD           +  + S G    + + +  ED             
Sbjct  344  DQVVVALEQLQHGKDA------ERNPKTEQNSSGQRPAMPRWRSWEDVG-----------  386

Query  351  gDAISRNATAAYPRPSTSPL  292
                  N   A+PRPS S L
Sbjct  387  ------NRKIAHPRPSASSL  400



>ref|XP_009384873.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=412

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 131/200 (66%), Gaps = 23/200 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+L+GRR ID N
Sbjct  234  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEILTGRRAIDKN  293

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE+ LVEWAKP+LA+KRK+  +LDSRL  QY+L  +QK+A LA  CLS + + RPTM
Sbjct  294  RPTGEYKLVEWAKPHLASKRKIISILDSRLRAQYSLAGAQKIAGLADRCLSLETKHRPTM  353

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D VV  LEQL+  KD           +  + S G    + + +  ED             
Sbjct  354  DQVVVALEQLQHGKDA------ERNPKTEQNSSGQRPAMPRWRSWEDVG-----------  396

Query  351  gDAISRNATAAYPRPSTSPL  292
                  N   A+PRPS S L
Sbjct  397  ------NRKIAHPRPSASSL  410



>ref|NP_172237.1| protein kinase APK1A [Arabidopsis thaliana]
 ref|NP_973778.1| protein kinase APK1A [Arabidopsis thaliana]
 sp|Q06548.1|APK1A_ARATH RecName: Full=Protein kinase APK1A, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02092.1| tyrosine-serine-threonine kinase [Arabidopsis thaliana]
 gb|AAO42086.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AAO50645.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28143.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28144.1| protein kinase APK1A [Arabidopsis thaliana]
Length=410

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 131/201 (65%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  224  LAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  284  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD  V +      +  T            
Sbjct  344  SEVVSHLEHIQSLNAAIGGNMDKTDRRMRRRSDSVVSKKVNAGFARQTAV----------  393

Query  351  gDAISRNATAAYPRPSTSPLY  289
                  +   AYPRPS SPLY
Sbjct  394  -----GSTVVAYPRPSASPLY  409



>ref|XP_010030960.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50195.1| hypothetical protein EUGRSUZ_J00006 [Eucalyptus grandis]
Length=409

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 126/166 (76%), Gaps = 7/166 (4%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTG +SHVSTR+MGTYGYAAPEY++TGHL+AKSDVYSFGVVLLEMLSGRRV+D N
Sbjct  229  LAKDGPTGGRSHVSTRIMGTYGYAAPEYMATGHLTAKSDVYSFGVVLLEMLSGRRVVDKN  288

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NL+EWAKPYL++KRK+F V+D+R+ GQY+L  + K A +A+ CLS + + RP M
Sbjct  289  RPSGEQNLIEWAKPYLSSKRKIFHVMDARIRGQYSLSGALKAATIAVKCLSLEAKSRPNM  348

Query  531  DDVVKELEQLKESK-------DMTTLSNKHDGSRHHRRSDGAVEEL  415
             +VV+ LEQL++S+             N H G ++ RRS   + ++
Sbjct  349  KEVVRALEQLQDSEARAITEAQQNANRNTHAGPKYRRRSTTDISDV  394



>ref|XP_010470021.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470022.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
 ref|XP_010470023.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Camelina sativa]
Length=394

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 137/203 (67%), Gaps = 16/203 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  207  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRVVDKN  266

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  267  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  326

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  327  NEVVSHLEHIQTLNEAGGKNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  375

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
               A+   AT AYPRPS SPL+ 
Sbjct  376  ---AVGVIAT-AYPRPSDSPLFV  394



>ref|XP_008447952.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
melo]
Length=384

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD+SHVST++MGT+GYAAPEYL+TGHL+AKSDVYSFGVVLLE+LSGRR +D N
Sbjct  230  LARDGPIGDQSHVSTKIMGTHGYAAPEYLATGHLTAKSDVYSFGVVLLELLSGRRALDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLV+WAKPYL NK K+ R++D+RLEG Y L  +Q+ ANLA  CL+ DP++RPTM
Sbjct  290  RPTGEHNLVDWAKPYLINKHKIRRIMDNRLEGHYGLGQAQRAANLAFLCLATDPKYRPTM  349

Query  531  DDVVKELEQL-KESKDMTTLSNKHDGSRHHR  442
            ++VV  LEQL K S+ + +    H+G  + R
Sbjct  350  NEVVTSLEQLQKPSEVLRSEREGHNGQSNGR  380



>ref|NP_001240055.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006591903.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89543.1| rust resistance protein [Glycine max]
Length=463

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT +KSH STRVMGTYGYAAPEYL+TG+LSAKSDV+SFGVVLLEMLSGRR +D N
Sbjct  296  LAKDGPTREKSHASTRVMGTYGYAAPEYLATGNLSAKSDVFSFGVVLLEMLSGRRAVDKN  355

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL+NKRK+ RVLD+RLEGQY L+ + KVA L+L CL+ + + RPTM
Sbjct  356  RPSGQHNLVEWAKPYLSNKRKLLRVLDNRLEGQYELDEACKVATLSLRCLAIESKLRPTM  415

Query  531  DDVVKELEQLK  499
            D+V  +LEQL+
Sbjct  416  DEVATDLEQLQ  426



>ref|XP_009380641.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380642.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT DKSHVSTR+MGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  241  LAKDGPTDDKSHVSTRIMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLEMLSGRRALDKN  300

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYLA+KRK+FRVLD+RLE QY+   +QK A L+  CLS +  +RPTM
Sbjct  301  RPTGEHNLVEWARPYLASKRKIFRVLDARLERQYSPVGAQKAAVLSFQCLSLEASYRPTM  360

Query  531  DDVVKELEQLKESKDM  484
            D VV  LE+L+ + D+
Sbjct  361  DQVVAALEELQNATDI  376



>ref|XP_009384872.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=419

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 131/200 (66%), Gaps = 23/200 (12%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLE+L+GRR ID N
Sbjct  241  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEILTGRRAIDKN  300

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE+ LVEWAKP+LA+KRK+  +LDSRL  QY+L  +QK+A LA  CLS + + RPTM
Sbjct  301  RPTGEYKLVEWAKPHLASKRKIISILDSRLRAQYSLAGAQKIAGLADRCLSLETKHRPTM  360

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            D VV  LEQL+  KD           +  + S G    + + +  ED             
Sbjct  361  DQVVVALEQLQHGKDA------ERNPKTEQNSSGQRPAMPRWRSWEDVG-----------  403

Query  351  gDAISRNATAAYPRPSTSPL  292
                  N   A+PRPS S L
Sbjct  404  ------NRKIAHPRPSASSL  417



>ref|XP_006591904.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Glycine max]
Length=451

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPT +KSH STRVMGTYGYAAPEYL+TG+LSAKSDV+SFGVVLLEMLSGRR +D N
Sbjct  284  LAKDGPTREKSHASTRVMGTYGYAAPEYLATGNLSAKSDVFSFGVVLLEMLSGRRAVDKN  343

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYL+NKRK+ RVLD+RLEGQY L+ + KVA L+L CL+ + + RPTM
Sbjct  344  RPSGQHNLVEWAKPYLSNKRKLLRVLDNRLEGQYELDEACKVATLSLRCLAIESKLRPTM  403

Query  531  DDVVKELEQLK  499
            D+V  +LEQL+
Sbjct  404  DEVATDLEQLQ  414



>ref|XP_010487664.1| PREDICTED: protein kinase APK1A, chloroplastic [Camelina sativa]
Length=413

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 131/201 (65%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  227  LAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  287  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEVKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD    + A    +  T            
Sbjct  347  SEVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAGFARQTAV----------  396

Query  351  gDAISRNATAAYPRPSTSPLY  289
                  +   AYPRPS SPLY
Sbjct  397  -----GSTVVAYPRPSASPLY  412



>ref|NP_001184929.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28145.1| protein kinase APK1A [Arabidopsis thaliana]
Length=424

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 131/202 (65%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  238  LAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  297

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  298  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNM  357

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD  V +      +  T            
Sbjct  358  SEVVSHLEHIQSLNAAIGGNMDKTDRRMRRRSDSVVSKKVNAGFARQTAV----------  407

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                  +   AYPRPS SPLY 
Sbjct  408  -----GSTVVAYPRPSASPLYV  424



>ref|XP_010470019.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  290  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  350  NEVVSHLEHIQTLNEAGGKNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  398

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  399  ---AVGVIAT-AYPRPSDSPLF  416



>ref|XP_006307674.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 ref|XP_006307675.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40572.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40573.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
Length=410

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 131/202 (65%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTR+MGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  224  LAKDGPIGDKSHVSTRIMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  284  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEVKLRPNM  343

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD  V +      +  T            
Sbjct  344  SEVVSHLEHIQSLNAAIGGNMDRTERRTRRRSDSVVSKKVNAGFARQTAV----------  393

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                  +   AYPRPS SPLY 
Sbjct  394  -----GSTVVAYPRPSASPLYV  410



>gb|ACF83789.1| unknown [Zea mays]
 gb|AFW83845.1| putative protein kinase superfamily protein [Zea mays]
Length=378

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  205  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAMDKN  264

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLV+WA+PYL++KR+V R+LD RL G Y L   Q+ A LAL CLS+D R RPTM
Sbjct  265  RPATEHNLVDWARPYLSSKRRVSRILDDRLAGHYPLPAVQRAAALALQCLSEDSRKRPTM  324

Query  531  DDVVKELEQLKESKD  487
            D VV  L+QL  ++D
Sbjct  325  DQVVASLQQLTAAQD  339



>ref|XP_010470020.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  227  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRVVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  287  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  347  NEVVSHLEHIQTLNEAGGKNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  395

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  396  ---AVGVIAT-AYPRPSDSPLF  413



>ref|XP_010510562.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Camelina 
sativa]
Length=414

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  227  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRVVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  287  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  347  NEVVAHLEHIQTLNEAGGRNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  395

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  396  ---AVGVIAT-AYPRPSDSPLF  413



>ref|XP_010510560.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X1 [Camelina 
sativa]
Length=417

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  290  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  350  NEVVAHLEHIQTLNEAGGRNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  398

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  399  ---AVGVIAT-AYPRPSDSPLF  416



>ref|XP_006649840.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=374

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  237  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  296

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QK+A LA+ CLS D R RP M
Sbjct  297  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKIAGLAMQCLSMDARCRPGM  356

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+  K
Sbjct  357  DQVVTALEQLQNGK  370



>ref|NP_001031439.1| protein kinase APK1B [Arabidopsis thaliana]
 sp|P46573.2|APK1B_ARATH RecName: Full=Protein kinase APK1B, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC33221.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15075.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08190.1| protein kinase APK1B [Arabidopsis thaliana]
Length=412

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRR +D N
Sbjct  225  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKN  284

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  285  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNM  344

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  345  NEVVSHLEHIQTLNEAGGRNIDMVQRRMRRRSDSVAINQKPNAGFARQT-----------  393

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  394  ---AVGVIAT-AYPRPSDSPLF  411



>ref|XP_010457947.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 131/202 (65%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRVMGT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  227  LAKDGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  287  RPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEVKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD    + A    +  T            
Sbjct  347  REVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAGFARQTAV----------  396

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                  +   AYPRPS SPLY 
Sbjct  397  -----GSTVVAYPRPSASPLYV  413



>ref|NP_001149364.1| protein kinase APK1A [Zea mays]
 gb|ACG35162.1| protein kinase APK1A [Zea mays]
Length=374

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  239  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  298

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA LAL CLS D R RP M
Sbjct  299  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVATLALQCLSMDARCRPAM  358

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+  +
Sbjct  359  DQVVTALEQLQRPR  372



>ref|XP_010111129.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC30494.1| Protein kinase APK1A [Morus notabilis]
Length=527

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 128/167 (77%), Gaps = 11/167 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD+SHVSTRVMGT+GYAAPEY++TGHL+AKSDVYSFGVV+LEMLSG+R +D N
Sbjct  342  LAKDGPVGDRSHVSTRVMGTFGYAAPEYMATGHLTAKSDVYSFGVVMLEMLSGKRAVDKN  401

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KR+V ++ DSR+EGQY++  + +  N+A+ CL+ +P++RP+M
Sbjct  402  RPSGEHNLVEWAKPYLASKRRVLQIFDSRIEGQYSVGGAIRAVNIAIQCLATEPKYRPSM  461

Query  531  DDVVKELEQLKESKDM-TTLSNKH----------DGSRHHRRSDGAV  424
             +VVK LEQL+E   +    SN+H          +G +H R S   V
Sbjct  462  KEVVKALEQLQELDCVGAPASNQHHLQSLNGKSSNGHKHLRASTNGV  508



>gb|ACF82794.1| unknown [Zea mays]
 tpg|DAA44648.1| TPA: putative protein kinase superfamily protein [Zea mays]
 tpg|DAA44649.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=325

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  190  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  249

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA LAL CLS D R RP M
Sbjct  250  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVATLALQCLSMDARCRPGM  309

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+  +
Sbjct  310  DQVVTALEQLQRPR  323



>ref|NP_001031440.1| protein kinase APK1B [Arabidopsis thaliana]
 gb|AEC08191.1| protein kinase APK1B [Arabidopsis thaliana]
Length=415

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRR +D N
Sbjct  228  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  288  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  348  NEVVSHLEHIQTLNEAGGRNIDMVQRRMRRRSDSVAINQKPNAGFARQT-----------  396

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  397  ---AVGVIAT-AYPRPSDSPLF  414



>ref|XP_008458866.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis melo]
Length=401

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 136/200 (68%), Gaps = 28/200 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+S+VSTRVMGT+GYAAPEY+ TGHL+AKSDVYSFGVVLLE+LSGRR ID N
Sbjct  228  LAKDGPTGDRSYVSTRVMGTFGYAAPEYMITGHLTAKSDVYSFGVVLLEILSGRRAIDKN  287

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYL +KR+V ++LD+R+E QY+   + K A LA+ C+S +P+ RP M
Sbjct  288  RPSGEHNLVEWAKPYLTSKRRVLQMLDARIESQYSTGGALKAAKLAIQCISTEPKLRPNM  347

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
            + VVK LEQL++S + +       GSR            A + E  +T++          
Sbjct  348  NAVVKALEQLQDSSETS-------GSR------------ATISEPLNTSS---------Q  379

Query  351  gDAISRNATAAYPRPSTSPL  292
            G   + N   +YPRPS S L
Sbjct  380  GSGSTNNKPVSYPRPSASVL  399



>ref|XP_006398693.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
 gb|ESQ40146.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
Length=396

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD SHVSTRVMGT GYAAPEYL+TGHLSAKSDVYSFGVVLLE+LSGRR ID N
Sbjct  224  LARDGPMGDNSHVSTRVMGTQGYAAPEYLATGHLSAKSDVYSFGVVLLELLSGRRAIDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WAKPYL NKR++ RV+D RL+GQY+L  + K+A LAL C+S D + RPTM
Sbjct  284  QPVGEHNLVDWAKPYLTNKRRLLRVMDPRLQGQYSLTRALKIAILALDCISIDAKSRPTM  343

Query  531  DDVVKELEQLKESKD  487
            +D+VK LEQL   K+
Sbjct  344  NDIVKTLEQLHVQKE  358



>ref|NP_001049704.1| Os03g0274800 [Oryza sativa Japonica Group]
 gb|ABF95245.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11618.1| Os03g0274800 [Oryza sativa Japonica Group]
 gb|EAY89440.1| hypothetical protein OsI_10947 [Oryza sativa Indica Group]
 gb|EAZ26435.1| hypothetical protein OsJ_10320 [Oryza sativa Japonica Group]
 dbj|BAG95774.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  237  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  296

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QK+A LA+ CLS D R RP M
Sbjct  297  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKIAGLAVQCLSMDARCRPGM  356

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+ +K
Sbjct  357  DQVVTALEQLQGAK  370



>ref|NP_180459.2| protein kinase APK1B [Arabidopsis thaliana]
 gb|ABM06025.1| At2g28930 [Arabidopsis thaliana]
 gb|AEC08189.1| protein kinase APK1B [Arabidopsis thaliana]
Length=423

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 137/203 (67%), Gaps = 16/203 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRR +D N
Sbjct  236  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKN  295

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  296  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNM  355

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  356  NEVVSHLEHIQTLNEAGGRNIDMVQRRMRRRSDSVAINQKPNAGFARQT-----------  404

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
               A+   AT AYPRPS SPL+ 
Sbjct  405  ---AVGVIAT-AYPRPSDSPLFV  423



>ref|NP_001149460.1| LOC100283086 [Zea mays]
 gb|ACG35526.1| protein kinase APK1B [Zea mays]
Length=385

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  212  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAMDKN  271

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLV+WA+PYL++KR+V R+LD RL G Y L   Q+ A LAL CLS+D R RPTM
Sbjct  272  RPATEHNLVDWARPYLSSKRRVSRILDDRLAGHYPLPAVQRAAALALQCLSEDSRKRPTM  331

Query  531  DDVVKELEQLKESKD  487
            D VV  L+QL  ++D
Sbjct  332  DQVVASLQQLTAAQD  346



>ref|XP_008654993.1| PREDICTED: LOC100283086 isoform X2 [Zea mays]
Length=409

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  236  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAMDKN  295

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLV+WA+PYL++KR+V R+LD RL G Y L   Q+ A LAL CLS+D R RPTM
Sbjct  296  RPATEHNLVDWARPYLSSKRRVSRILDDRLAGHYPLPAVQRAAALALQCLSEDSRKRPTM  355

Query  531  DDVVKELEQLKESKD  487
            D VV  L+QL  ++D
Sbjct  356  DQVVASLQQLTAAQD  370



>gb|ACF79269.1| unknown [Zea mays]
 gb|ACN26123.1| unknown [Zea mays]
 gb|ACR37930.1| unknown [Zea mays]
 tpg|DAA44647.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=374

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  239  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  298

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA LAL CLS D R RP M
Sbjct  299  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVATLALQCLSMDARCRPGM  358

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+  +
Sbjct  359  DQVVTALEQLQRPR  372



>ref|XP_002879189.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55448.1| hypothetical protein ARALYDRAFT_481810 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 137/203 (67%), Gaps = 16/203 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSGRR +D N
Sbjct  238  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKN  297

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  298  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNM  357

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  358  NEVVSHLEHIQTLNEAGGRNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  406

Query  354  dgDAISRNATAAYPRPSTSPLYA  286
               A+   AT AYPRPS SPL+ 
Sbjct  407  ---AVGVIAT-AYPRPSDSPLFV  425



>gb|ABF95246.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=372

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  235  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  294

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QK+A LA+ CLS D R RP M
Sbjct  295  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKIAGLAVQCLSMDARCRPGM  354

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+ +K
Sbjct  355  DQVVTALEQLQGAK  368



>ref|XP_004236745.1| PREDICTED: protein kinase APK1A, chloroplastic [Solanum lycopersicum]
Length=394

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 131/200 (66%), Gaps = 28/200 (14%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP   KSHVSTRVMGT+GYAAPEY++TGH++ +SDVYSFGVVLLEML+GRRV+D N
Sbjct  221  LAKDGPIDGKSHVSTRVMGTFGYAAPEYMATGHITTRSDVYSFGVVLLEMLTGRRVMDKN  280

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNL+EWAKP+L +KRKV  ++D R+EGQY++E + + A LA+ CL+ +P+FRP M
Sbjct  281  RPHGEHNLIEWAKPFLTSKRKVLHIMDHRIEGQYSVEGALRAALLAVKCLALEPKFRPKM  340

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VVK LEQL+   +  +L  +    +HHR S                            
Sbjct  341  PEVVKALEQLQNLNESGSLKRETTQRKHHRTSTDEA------------------------  376

Query  351  gDAISRNATAAYPRPSTSPL  292
                S   T +YPRP+ SPL
Sbjct  377  ----SGRKTTSYPRPAASPL  392



>ref|XP_010414461.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Camelina sativa]
Length=414

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSG+RV+D N
Sbjct  227  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGQRVVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  287  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  347  NEVVSHLEHIQTLNEAGGRNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  395

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  396  ---AVGVIAT-AYPRPSDSPLF  413



>ref|XP_010414460.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Camelina sativa]
Length=417

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 16/202 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGYAAPEYL+TGHL+ KSDVYS+GVVLLE+LSG+RV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGQRVVDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LVEWA+P LANKRK+FRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  290  RPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLVLRCLTYEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQLKESEDTTTLgsrrrrrs  355
            ++VV  LE ++   +    +      R  RRSD  A+ +      +  T           
Sbjct  350  NEVVSHLEHIQTLNEAGGRNIDKVERRMRRRSDSVAINQKPNAGFARQT-----------  398

Query  354  dgDAISRNATAAYPRPSTSPLY  289
               A+   AT AYPRPS SPL+
Sbjct  399  ---AVGVIAT-AYPRPSDSPLF  416



>ref|XP_009118427.1| PREDICTED: protein kinase APK1A, chloroplastic [Brassica rapa]
 emb|CDY06271.1| BnaA09g49320D [Brassica napus]
Length=406

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 132/202 (65%), Gaps = 15/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRV+GT+GYAAPEY++TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  220  LAKDGPVGDKSHVSTRVIGTHGYAAPEYMATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  279

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYLANKRK+FRV+D+RL+ QY++E + KVA L+L CL+ + + RP M
Sbjct  280  RPSGERNLVEWAKPYLANKRKIFRVIDTRLQDQYSMEEACKVAILSLRCLTTETKLRPNM  339

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             DVV  LE ++                  RR  G ++   +       + +G +      
Sbjct  340  SDVVSHLEHIQSLNSA-------------RR--GIMDRTERRMRRRSDSVVGKKPNAGFA  384

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                  +   AYPRPS SPLY 
Sbjct  385  RQTAVGSTLVAYPRPSASPLYV  406



>gb|EEC72262.1| hypothetical protein OsI_05407 [Oryza sativa Indica Group]
Length=408

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHLSAKSDVYSFGVV++EMLSGRR +D N
Sbjct  231  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLSAKSDVYSFGVVMVEMLSGRRALDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL+++R++FR+LD+RL GQY+L  + K A LAL CLS D R RPTM
Sbjct  291  RPAGEHNLVEWARPYLSSRRRIFRILDARLAGQYSLAGAHKAAALALQCLSADARNRPTM  350

Query  531  DDVVKELEQLKESKDMTTLSNKH  463
              VV  LEQL+E+   TT S+ H
Sbjct  351  HQVVAALEQLQET---TTTSHHH  370



>ref|XP_010475518.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
 ref|XP_010475519.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 130/201 (65%), Gaps = 15/201 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDKSHVSTRV+GT+GYAAPEYL+TGHL+ KSDVYSFGVVLLE+LSGRR +D N
Sbjct  227  LAKDGPIGDKSHVSTRVIGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKN  286

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE NLVEWAKPYL NKRKVFRV+D+RL+ QY++E + KVA L L CL+ + + RP M
Sbjct  287  RPSGERNLVEWAKPYLVNKRKVFRVIDNRLQDQYSMEEACKVATLCLRCLTTETKLRPNM  346

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE ++        +      R  RRSD    + A    +  T            
Sbjct  347  TEVVSCLEHIQSVNAAIGGNMDRTERRMRRRSDSVASKKANAGFARQTAV----------  396

Query  351  gDAISRNATAAYPRPSTSPLY  289
                  +   AYPRPS SPLY
Sbjct  397  -----GSTVVAYPRPSASPLY  412



>ref|XP_009357737.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=402

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 122/168 (73%), Gaps = 12/168 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP  D SHVSTRVMGTYGYAAPEY++TGHL+AKSDVYSFGVV+LE+LSGRR +D N
Sbjct  217  LAKDGPADDTSHVSTRVMGTYGYAAPEYMATGHLTAKSDVYSFGVVMLELLSGRRAVDKN  276

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWAKPYLA+KRK  ++ D R+EGQY+++ + +  +LA+ CL+ +P+ RP M
Sbjct  277  RPTGEHNLVEWAKPYLASKRKFIQIFDLRIEGQYSMDEALRAVSLAIRCLAFEPKSRPNM  336

Query  531  DDVVKELEQLKESKDM------------TTLSNKHDGSRHHRRSDGAV  424
            +DVVK LEQL+E  D                +N +   RH RRS   V
Sbjct  337  NDVVKALEQLQEPIDSEGAGISPNQHRPNPHANSNHAPRHRRRSINGV  384



>ref|XP_006409926.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
 gb|ESQ51379.1| hypothetical protein EUTSA_v10016722mg [Eutrema salsugineum]
Length=417

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 135/202 (67%), Gaps = 14/202 (7%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTR+MGTYGY APEYL+TGHL+ KSDVYS+GVVLLE+LSGRRV+D N
Sbjct  230  LAKDGPTGDKSHVSTRIMGTYGYTAPEYLATGHLTTKSDVYSYGVVLLELLSGRRVLDKN  289

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GE  LV+WA+P+LANKRK+F+V+D+RL+ QY++E + KVA LAL CL+ + + RP M
Sbjct  290  RPPGEQKLVQWARPFLANKRKIFKVIDNRLQDQYSMEEACKVATLALRCLTLEIKLRPNM  349

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLKESEDTTTLgsrrrrrsd  352
             +VV  LE +        L+    G R+  + +       +++   D+  +  +      
Sbjct  350  TEVVSHLEHI--------LTLHEAGGRNIDKIE------RRMRRKSDSVVISQKPNAGFA  395

Query  351  gDAISRNATAAYPRPSTSPLYA  286
                     AAYPRPS SPL+ 
Sbjct  396  RQTAVGGIAAAYPRPSDSPLFV  417



>ref|XP_008677038.1| PREDICTED: protein kinase APK1A isoform X1 [Zea mays]
 gb|ACR33989.1| unknown [Zea mays]
 tpg|DAA44646.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=405

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP+GDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  270  LAKDGPSGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  329

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA LAL CLS D R RP M
Sbjct  330  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVATLALQCLSMDARCRPGM  389

Query  531  DDVVKELEQLKESK  490
            D VV  LEQL+  +
Sbjct  390  DQVVTALEQLQRPR  403



>ref|XP_008654992.1| PREDICTED: LOC100283086 isoform X1 [Zea mays]
Length=436

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGD+SHVSTRVMGTYGYAAPEYL+TGHL+ KSDVYSFGVVLLEMLSGRR +D N
Sbjct  263  LAKDGPTGDQSHVSTRVMGTYGYAAPEYLATGHLTPKSDVYSFGVVLLEMLSGRRAMDKN  322

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLV+WA+PYL++KR+V R+LD RL G Y L   Q+ A LAL CLS+D R RPTM
Sbjct  323  RPATEHNLVDWARPYLSSKRRVSRILDDRLAGHYPLPAVQRAAALALQCLSEDSRKRPTM  382

Query  531  DDVVKELEQLKESKD  487
            D VV  L+QL  ++D
Sbjct  383  DQVVASLQQLTAAQD  397



>ref|XP_006590337.1| PREDICTED: uncharacterized protein LOC100809679 isoform X1 [Glycine 
max]
Length=412

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK  PT +KSHVSTRVMGTYGYAAPEY +TG+LSAKSDV+SFGVVLLEMLSGRR +D N
Sbjct  237  LAKDRPTREKSHVSTRVMGTYGYAAPEYQTTGNLSAKSDVFSFGVVLLEMLSGRRAVDKN  296

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWAKPYLANK K+ RVLD+RLEGQY L+ + KVA L+L CL+ + + RPTM
Sbjct  297  RPSGQHNLVEWAKPYLANKHKLLRVLDNRLEGQYALDEACKVATLSLRCLATESKLRPTM  356

Query  531  DDVVKELEQLK  499
            D+VV +LEQL+
Sbjct  357  DEVVTDLEQLQ  367



>ref|XP_006646742.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=421

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 128/166 (77%), Gaps = 13/166 (8%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHL+AKSDVYSFGVVLLEMLSGRR +D N
Sbjct  231  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLTAKSDVYSFGVVLLEMLSGRRALDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL ++R++FR+LD+RL GQY+L  +QK A LAL CLS D R RPTM
Sbjct  291  RPSGEHNLVEWARPYLTSRRRIFRILDARLGGQYSLAGAQKAAALALQCLSGDSRNRPTM  350

Query  531  DDVVKELEQLKESKD--------MTTLSNKHDG-----SRHHRRSD  433
              VV  LEQL+++K+        MT      +G     SR +RRS+
Sbjct  351  QQVVAALEQLQDAKETSHQPQSKMTLAGRGFNGSGSSWSRGNRRSE  396



>ref|XP_010227588.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=478

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 122/157 (78%), Gaps = 4/157 (3%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP G+KSHVSTRVMGTYGYAAPEYLSTGHL+AKSD+YSFGVVLLEMLSGRR ID N
Sbjct  232  LAKDGPVGEKSHVSTRVMGTYGYAAPEYLSTGHLTAKSDIYSFGVVLLEMLSGRRAIDKN  291

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PYL + RKVFRVLD++LEGQY+   +Q +A LA+ CLS D + RP+M
Sbjct  292  RPQGQHNLVEWARPYLTHSRKVFRVLDTKLEGQYSHRGAQTIAALAVECLSYDAKMRPSM  351

Query  531  DDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVE  421
            D VV  LE ++ S +    +++   +  H+   GA +
Sbjct  352  DAVVSILEGIQGSSE----ADRKPATEKHQEPKGAAK  384



>ref|NP_001045548.1| Os01g0973500 [Oryza sativa Japonica Group]
 dbj|BAD87376.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD87420.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF07462.1| Os01g0973500 [Oryza sativa Japonica Group]
 dbj|BAG91482.1| unnamed protein product [Oryza sativa Japonica Group]
Length=408

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGTYGYAAPEYL+TGHLSAKSDVYSFGVV++EMLSGRR +D N
Sbjct  231  LAKDGPTGDKSHVSTRVMGTYGYAAPEYLATGHLSAKSDVYSFGVVMVEMLSGRRALDKN  290

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+PYL+++R++FR+LD+RL GQY+L  + K A LAL CLS D + RPTM
Sbjct  291  RPAGEHNLVEWARPYLSSRRRIFRILDARLAGQYSLAGAHKAAALALQCLSADAKNRPTM  350

Query  531  DDVVKELEQLKESKDMTTLSNKH  463
              VV  LEQL+E+   TT S+ H
Sbjct  351  HQVVAALEQLQET---TTTSHHH  370



>gb|KDO82763.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=304

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDK+HVSTRVMGTYGYAAPEY+ TGHL+++SDVYSFGVVLLEML+GRR +D N
Sbjct  103  LAKDGPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMLTGRRSMDKN  162

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+P+L  +R+ +R++D RLEG ++++ +QK A LA HCLS+DP+ RP M
Sbjct  163  RPNGEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLM  222

Query  531  DDVVKELEQLKESKDMTTLS  472
             +VV+ L+ L   KDM + S
Sbjct  223  SEVVEALKPLPNLKDMASSS  242



>ref|XP_010490647.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
 ref|XP_010490648.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=400

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD SHVSTRVMGT GYAAPEYL+TGHLSAKSDVYSFGVVLLE+LSGRR ID N
Sbjct  224  LARDGPMGDNSHVSTRVMGTQGYAAPEYLATGHLSAKSDVYSFGVVLLELLSGRRAIDKN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WAKPYL NKR++ RV+D RL+GQY+L  + K+A LAL CLS D + RPTM
Sbjct  284  QPVGEHNLVDWAKPYLLNKRRLLRVMDPRLQGQYSLTRASKIAGLALECLSIDAKSRPTM  343

Query  531  DDVVKELEQLKESKDM  484
             ++VK+LE+ +  K++
Sbjct  344  SEIVKKLEEHQIQKEV  359



>gb|KDO82764.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=306

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GDK+HVSTRVMGTYGYAAPEY+ TGHL+++SDVYSFGVVLLEML+GRR +D N
Sbjct  105  LAKDGPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMLTGRRSMDKN  164

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLVEWA+P+L  +R+ +R++D RLEG ++++ +QK A LA HCLS+DP+ RP M
Sbjct  165  RPNGEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAAQLAAHCLSRDPKARPLM  224

Query  531  DDVVKELEQLKESKDMTTLS  472
             +VV+ L+ L   KDM + S
Sbjct  225  SEVVEALKPLPNLKDMASSS  244



>emb|CDX80814.1| BnaC03g00680D [Brassica napus]
Length=391

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GDKSHVSTR+MGT GYAAPEYLSTGHLSAK+DVYSFGVVLLE+LSGRR ID N
Sbjct  224  LARDGPMGDKSHVSTRIMGTQGYAAPEYLSTGHLSAKNDVYSFGVVLLELLSGRRAIDRN  283

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WAKPYL NKR++ RV+D RL+GQY+L  + K+A LAL C+S D + RP M
Sbjct  284  QPVGEHNLVDWAKPYLVNKRRLLRVMDPRLQGQYSLTRASKIALLALDCISIDAKSRPDM  343

Query  531  DDVVKELEQLKESKD  487
             D+VK LE+L   K+
Sbjct  344  KDIVKTLEELHVQKE  358



>gb|KHG15912.1| Protein kinase APK1A, chloroplastic [Gossypium arboreum]
Length=386

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKS+VSTRVMGT+GYAAPEY++TGHL+A+SDVYSFGVVLLEML+G+R +D N
Sbjct  215  LAKDGPTGDKSYVSTRVMGTHGYAAPEYVATGHLTARSDVYSFGVVLLEMLTGKRAVDKN  274

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP  EHNLV+WAKPYL +KRK F+++D+R+EGQYT E + K A LA+ CLS +P+ RP M
Sbjct  275  RPSREHNLVDWAKPYLTSKRKFFQIMDARIEGQYTPEAALKAAYLAVQCLSTEPKVRPKM  334

Query  531  DDVVKELEQLKES  493
              VVK LEQL++S
Sbjct  335  TAVVKALEQLQDS  347



>gb|ACU18313.1| unknown [Glycine max]
Length=186

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GPTGDKSHVSTRVMGT GYAAPEYL+TGHL+ KSDVYSFGVVLLEM+SGRR ID N
Sbjct  46   LARDGPTGDKSHVSTRVMGTRGYAAPEYLATGHLTTKSDVYSFGVVLLEMISGRRAIDKN  105

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +Q  A LA+ C S +P+ RP M
Sbjct  106  QPTGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSQNRAQAAAALAMQCFSVEPKCRPNM  165

Query  531  DDVVKEL  511
            D+VVK +
Sbjct  166  DEVVKAI  172



>ref|XP_009122790.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=389

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD SHVSTRV+GT GYAAPEYL+TGHLSAKSDVYSFGVVLLE+LSGRR ID N
Sbjct  225  LARDGPEGDNSHVSTRVVGTQGYAAPEYLATGHLSAKSDVYSFGVVLLELLSGRRAIDKN  284

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WA+PYL NKR++ RV+D RL+GQY+L  + K+A LAL C+S D + RPTM
Sbjct  285  QPVGEHNLVDWARPYLTNKRRLLRVMDPRLQGQYSLTRALKIALLALDCISLDSKVRPTM  344

Query  531  DDVVKELEQLKESKD  487
            +DVVK LE+L   K+
Sbjct  345  NDVVKTLEELHVQKE  359



>emb|CDY40347.1| BnaA10g27210D [Brassica napus]
Length=390

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LA+ GP GD SHVSTRV+GT GYAAPEYL+TGHLSAKSDVYSFGVVLLE+LSGRR ID N
Sbjct  225  LARDGPEGDNSHVSTRVVGTQGYAAPEYLATGHLSAKSDVYSFGVVLLELLSGRRAIDKN  284

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            +P GEHNLV+WA+PYL NKR++ RV+D RL+GQY+L  + K+A LAL C+S D + RPTM
Sbjct  285  QPVGEHNLVDWARPYLTNKRRLLRVMDPRLQGQYSLTRALKIALLALDCISLDSKVRPTM  344

Query  531  DDVVKELEQLKESKD  487
            +DVVK LE+L   K+
Sbjct  345  NDVVKTLEELHVQKE  359



>ref|XP_002465484.1| hypothetical protein SORBIDRAFT_01g039630 [Sorghum bicolor]
 gb|EER92482.1| hypothetical protein SORBIDRAFT_01g039630 [Sorghum bicolor]
Length=380

 Score =   202 bits (513),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GPTGDKSHVSTRVMGT GYAAPEYL+TGHL+AKSDVYS+GVVLLE+LSG+R +D N
Sbjct  238  LAKDGPTGDKSHVSTRVMGTQGYAAPEYLATGHLTAKSDVYSYGVVLLELLSGQRALDKN  297

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP G+HNLVEWA+PY+ NKR+V  VLDSRL  Q +L  +QK+A LAL CLS D R RP M
Sbjct  298  RPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQCSLPAAQKMATLALQCLSMDARGRPGM  357

Query  531  DDVVKELEQLKESK  490
            D VV  LE L+E+K
Sbjct  358  DQVVTVLEDLQEAK  371



>gb|ABK24429.1| unknown [Picea sitchensis]
Length=465

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 122/160 (76%), Gaps = 6/160 (4%)
 Frame = -1

Query  891  LAKXGPTGDKSHVSTRVMGTYGYAAPEYLSTGHLSAKSDVYSFGVVLLEMLSGRRVIDYN  712
            LAK GP GD +HVSTRVMGTYGYAAPEY+ TGHL++KSDVYSFGVVLLE+L+GRR +D N
Sbjct  274  LAKDGPEGDNTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLELLTGRRSMDKN  333

Query  711  RPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDPRFRPTM  532
            RP GEHNLV WA+PYL +KRK++R++D RLE  Y+++ +Q+ A +A HCLS+DP+ RP M
Sbjct  334  RPSGEHNLVAWARPYLMDKRKLYRLVDPRLEFNYSVKGAQRAAQIAHHCLSRDPKARPLM  393

Query  531  DDVVKELEQLKESKDMTTLSNKHDG------SRHHRRSDG  430
            DDVV+ L  L   KDM + S  H        SRH R ++G
Sbjct  394  DDVVEALTPLLNLKDMASSSLHHQAVQSMRLSRHQRMTNG  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2045999315917