BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5378

Length=1136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...    476   2e-160   Solanum tuberosum [potatoes]
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         475   5e-160   Nicotiana sylvestris
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         473   5e-159   Solanum lycopersicum
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         468   5e-157   Nicotiana tomentosiformis
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         462   8e-155   Nicotiana tomentosiformis
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         462   9e-155   Solanum lycopersicum
gb|ABO93008.1|  putative methyltransferase                              458   1e-154   Solanum tuberosum [potatoes]
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         461   1e-154   Nicotiana sylvestris
gb|ABO92980.1|  putative methyltransferase                              458   2e-153   Solanum tuberosum [potatoes]
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    458   3e-153   Solanum tuberosum [potatoes]
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                455   3e-152   Erythranthe guttata [common monkey flower]
emb|CDP00327.1|  unnamed protein product                                454   7e-152   Coffea canephora [robusta coffee]
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         450   3e-150   Fragaria vesca subsp. vesca
ref|XP_012067633.1|  PREDICTED: probable methyltransferase PMT2 i...    449   1e-149   Jatropha curcas
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         449   1e-149   Sesamum indicum [beniseed]
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                447   3e-149   Erythranthe guttata [common monkey flower]
ref|XP_002522425.1|  ATP binding protein, putative                      446   2e-148   
ref|XP_012067632.1|  PREDICTED: probable methyltransferase PMT2 i...    442   4e-147   Jatropha curcas
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         442   6e-147   Nelumbo nucifera [Indian lotus]
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             442   7e-147   Populus trichocarpa [western balsam poplar]
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         441   1e-146   Populus euphratica
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         440   2e-146   
ref|XP_010089758.1|  putative methyltransferase PMT2                    440   2e-146   Morus notabilis
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         440   3e-146   Populus euphratica
ref|XP_003628359.1|  hypothetical protein MTR_8g055840                  431   9e-146   
gb|KDO82912.1|  hypothetical protein CISIN_1g0105922mg                  428   1e-145   Citrus sinensis [apfelsine]
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    437   4e-145   Cicer arietinum [garbanzo]
emb|CBI31965.3|  unnamed protein product                                434   4e-145   Vitis vinifera
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             436   1e-144   Prunus persica
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         435   2e-144   Eucalyptus grandis [rose gum]
ref|NP_001280936.1|  uncharacterized protein LOC103402903               435   2e-144   Malus domestica [apple tree]
ref|XP_003628358.1|  hypothetical protein MTR_8g055840                  431   3e-144   
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         434   6e-144   Prunus mume [ume]
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         434   8e-144   
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         433   1e-143   Malus domestica [apple tree]
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    433   1e-143   Glycine max [soybeans]
gb|KHN12213.1|  Putative methyltransferase PMT2                         432   1e-143   Glycine soja [wild soybean]
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         433   1e-143   Vitis vinifera
ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         433   2e-143   Sesamum indicum [beniseed]
gb|ACJ85858.1|  unknown                                                 432   3e-143   Medicago truncatula
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  432   3e-143   Medicago truncatula
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             432   4e-143   Citrus clementina [clementine]
gb|KHN01216.1|  Putative methyltransferase PMT2                         428   5e-143   Glycine soja [wild soybean]
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  428   5e-143   Citrus sinensis [apfelsine]
gb|EPS59468.1|  hypothetical protein M569_15338                         431   1e-142   Genlisea aurea
gb|KHG23981.1|  hypothetical protein F383_09020                         431   2e-142   Gossypium arboreum [tree cotton]
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             430   2e-142   Phaseolus vulgaris [French bean]
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  429   3e-142   Medicago truncatula
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         429   4e-142   Pyrus x bretschneideri [bai li]
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    429   4e-142   Glycine max [soybeans]
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    428   1e-141   Cicer arietinum [garbanzo]
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    428   1e-141   Glycine max [soybeans]
gb|KJB60757.1|  hypothetical protein B456_009G324300                    428   1e-141   Gossypium raimondii
gb|KHG10506.1|  hypothetical protein F383_11349                         428   2e-141   Gossypium arboreum [tree cotton]
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    427   3e-141   
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    427   4e-141   Glycine max [soybeans]
gb|KHN17371.1|  Putative methyltransferase PMT2                         426   5e-141   Glycine soja [wild soybean]
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         426   7e-141   Tarenaya hassleriana [spider flower]
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         426   9e-141   Nelumbo nucifera [Indian lotus]
ref|XP_002511570.1|  ATP binding protein, putative                      424   6e-140   Ricinus communis
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             424   9e-140   Populus trichocarpa [western balsam poplar]
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         423   1e-139   Populus euphratica
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         423   1e-139   Populus euphratica
emb|CDY50730.1|  BnaC05g50930D                                          419   1e-139   Brassica napus [oilseed rape]
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             421   9e-139   Eutrema salsugineum [saltwater cress]
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         421   9e-139   Tarenaya hassleriana [spider flower]
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2         421   9e-139   Cucumis sativus [cucumbers]
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         421   1e-138   Cucumis melo [Oriental melon]
emb|CDY16198.1|  BnaA09g29320D                                          419   3e-138   Brassica napus [oilseed rape]
ref|XP_002893375.1|  dehydration-responsive family protein              419   3e-138   
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             419   4e-138   Capsella rubella
gb|KJB80180.1|  hypothetical protein B456_013G084900                    419   4e-138   Gossypium raimondii
ref|NP_564265.1|  putative methyltransferase PMT2                       419   4e-138   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19504.1|  AT1G26850                                              419   5e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         419   6e-138   Brassica rapa
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         418   1e-137   Camelina sativa [gold-of-pleasure]
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         418   1e-137   Camelina sativa [gold-of-pleasure]
emb|CDY45006.1|  BnaCnng12360D                                          416   5e-137   Brassica napus [oilseed rape]
emb|CDY46435.1|  BnaA08g19950D                                          416   5e-137   Brassica napus [oilseed rape]
emb|CBI15236.3|  unnamed protein product                                412   7e-137   Vitis vinifera
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g             415   1e-136   
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         415   1e-136   Brassica rapa
emb|CDY40268.1|  BnaA07g09320D                                          414   5e-136   Brassica napus [oilseed rape]
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         413   8e-136   Vitis vinifera
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         412   3e-135   Brassica rapa
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    412   4e-135   
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    411   4e-135   
gb|AAT38682.2|  Methyltransferase family protein, putative              413   5e-135   Solanum demissum
gb|EPS64080.1|  hypothetical protein M569_10695                         411   5e-135   Genlisea aurea
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             410   8e-135   Phaseolus vulgaris [French bean]
ref|XP_008373610.1|  PREDICTED: probable methyltransferase PMT14        400   1e-134   
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         409   4e-134   Nicotiana sylvestris
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         408   9e-134   Nicotiana tomentosiformis
ref|XP_012089660.1|  PREDICTED: probable methyltransferase PMT14        407   1e-133   Jatropha curcas
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    407   2e-133   Elaeis guineensis
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             407   2e-133   Prunus persica
ref|XP_012080258.1|  PREDICTED: probable methyltransferase PMT2 i...    407   3e-133   
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    407   3e-133   Tarenaya hassleriana [spider flower]
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    406   4e-133   Citrus sinensis [apfelsine]
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         406   7e-133   Phoenix dactylifera
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2         405   9e-133   Populus euphratica
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             405   1e-132   Citrus clementina [clementine]
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    404   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        404   3e-132   Prunus mume [ume]
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             404   3e-132   Prunus persica
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         403   7e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             403   8e-132   Populus trichocarpa [western balsam poplar]
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         403   1e-131   Tarenaya hassleriana [spider flower]
ref|XP_010091504.1|  putative methyltransferase PMT2                    402   1e-131   Morus notabilis
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    402   1e-131   Solanum tuberosum [potatoes]
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         402   2e-131   Solanum lycopersicum
ref|XP_006827213.1|  PREDICTED: probable methyltransferase PMT2         402   2e-131   
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         402   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    402   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN60192.1|  hypothetical protein VITISV_038569                     401   4e-131   Vitis vinifera
gb|KJB51709.1|  hypothetical protein B456_008G228900                    401   5e-131   Gossypium raimondii
ref|XP_012080255.1|  PREDICTED: probable methyltransferase PMT2 i...    401   6e-131   Jatropha curcas
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         400   1e-130   Nicotiana sylvestris
gb|KHG27439.1|  hypothetical protein F383_15139                         401   1e-130   Gossypium arboreum [tree cotton]
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         399   2e-130   Prunus mume [ume]
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        399   4e-130   Populus euphratica
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         398   5e-130   Elaeis guineensis
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        398   8e-130   Nelumbo nucifera [Indian lotus]
emb|CBI33946.3|  unnamed protein product                                394   8e-130   Vitis vinifera
ref|XP_010110495.1|  putative methyltransferase PMT14                   397   1e-129   Morus notabilis
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    397   1e-129   Pyrus x bretschneideri [bai li]
ref|XP_009342549.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    393   3e-129   
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        396   4e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        396   4e-129   Tarenaya hassleriana [spider flower]
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         395   1e-128   Solanum lycopersicum
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    395   1e-128   
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        394   2e-128   Vitis vinifera
gb|ACN26954.1|  unknown                                                 384   2e-128   Zea mays [maize]
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        394   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         394   2e-128   
ref|XP_006578576.1|  PREDICTED: probable methyltransferase PMT2-l...    386   2e-128   
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    394   3e-128   Cicer arietinum [garbanzo]
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    394   3e-128   
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    394   3e-128   Eucalyptus grandis [rose gum]
emb|CDP12320.1|  unnamed protein product                                405   3e-128   Coffea canephora [robusta coffee]
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         394   3e-128   Nicotiana tomentosiformis
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    394   4e-128   Populus euphratica
ref|XP_002528760.1|  ATP binding protein, putative                      393   5e-128   Ricinus communis
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    393   5e-128   Solanum tuberosum [potatoes]
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             392   1e-127   Citrus clementina [clementine]
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        392   2e-127   Eucalyptus grandis [rose gum]
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             390   5e-127   
gb|KHN21029.1|  Putative methyltransferase PMT14                        389   5e-127   Glycine soja [wild soybean]
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             390   6e-127   Phaseolus vulgaris [French bean]
emb|CDP12957.1|  unnamed protein product                                390   7e-127   Coffea canephora [robusta coffee]
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    389   2e-126   Glycine max [soybeans]
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14        389   2e-126   Fragaria vesca subsp. vesca
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    389   2e-126   Glycine max [soybeans]
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          389   3e-126   Sorghum bicolor [broomcorn]
ref|XP_004499422.1|  PREDICTED: probable methyltransferase PMT2-l...    385   3e-126   
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    388   5e-126   Setaria italica
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         387   8e-126   
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        388   9e-126   
gb|KEH33485.1|  methyltransferase PMT2-like protein                     387   9e-126   Medicago truncatula
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2         387   9e-126   Fragaria vesca subsp. vesca
ref|XP_010441570.1|  PREDICTED: probable methyltransferase PMT14        380   1e-125   
gb|KJB08228.1|  hypothetical protein B456_001G071800                    387   2e-125   Gossypium raimondii
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        386   4e-125   Brassica rapa
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        386   4e-125   Solanum lycopersicum
emb|CDY03207.1|  BnaC09g19490D                                          386   5e-125   
ref|XP_003523024.1|  PREDICTED: probable methyltransferase PMT2-l...    385   5e-125   Glycine max [soybeans]
gb|KHN21848.1|  Putative methyltransferase PMT2                         385   7e-125   Glycine soja [wild soybean]
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    385   1e-124   
ref|NP_001152470.1|  ankyrin protein kinase-like                        385   1e-124   
gb|EMS49438.1|  putative methyltransferase PMT2                         384   1e-124   Triticum urartu
ref|XP_004499421.1|  PREDICTED: probable methyltransferase PMT2-l...    384   2e-124   Cicer arietinum [garbanzo]
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         384   2e-124   Brachypodium distachyon [annual false brome]
ref|XP_007138189.1|  hypothetical protein PHAVU_009G187900g             384   2e-124   Phaseolus vulgaris [French bean]
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         384   3e-124   Pyrus x bretschneideri [bai li]
ref|XP_008660000.1|  PREDICTED: probable methyltransferase PMT2 i...    375   3e-124   Zea mays [maize]
gb|EMT27426.1|  hypothetical protein F775_29617                         383   3e-124   
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         382   1e-123   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    382   2e-123   Solanum tuberosum [potatoes]
gb|EAZ09099.1|  hypothetical protein OsI_31366                          381   2e-123   Oryza sativa Indica Group [Indian rice]
emb|CDY35169.1|  BnaA09g18060D                                          384   3e-123   Brassica napus [oilseed rape]
ref|XP_006398351.1|  hypothetical protein EUTSA_v10000856mg             378   3e-123   Eutrema salsugineum [saltwater cress]
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        381   3e-123   Nicotiana tomentosiformis
gb|EMS63414.1|  putative methyltransferase PMT2                         377   4e-123   Triticum urartu
ref|NP_001063174.1|  Os09g0415700                                       380   6e-123   
gb|EMT05545.1|  hypothetical protein F775_20122                         380   7e-123   
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        380   9e-123   Camelina sativa [gold-of-pleasure]
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         380   1e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    379   1e-122   Oryza brachyantha
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             380   1e-122   
ref|NP_001050233.1|  Os03g0379100                                       379   1e-122   
emb|CAH18000.1|  Ankyrin protein kinase-like                            379   1e-122   Poa pratensis
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        378   4e-122   Nicotiana sylvestris
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         378   4e-122   Phoenix dactylifera
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    378   5e-122   Oryza brachyantha
gb|KHN06856.1|  Putative methyltransferase PMT2                         364   5e-122   Glycine soja [wild soybean]
gb|AEX55231.1|  putative cold-regulated protein                         367   1e-121   Allium sativum
dbj|BAH20410.1|  AT4G18030                                              370   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    377   1e-121   
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         377   1e-121   
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    376   2e-121   
gb|ACA66248.1|  putative methyltransferase                              376   4e-121   Nicotiana benthamiana
gb|ACB54686.1|  methyltransferase                                       375   4e-121   Nicotiana benthamiana
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             375   7e-121   Eutrema salsugineum [saltwater cress]
emb|CDY70748.1|  BnaCnng69650D                                          368   1e-120   Brassica napus [oilseed rape]
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    374   2e-120   Setaria italica
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    374   2e-120   
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        372   9e-120   Camelina sativa [gold-of-pleasure]
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    371   1e-119   Oryza brachyantha
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        371   2e-119   
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          370   3e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        371   4e-119   
ref|NP_193537.2|  putative methyltransferase PMT14                      370   5e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001065447.2|  Os10g0569300                                       370   6e-119   
emb|CAA17146.1|  putative protein                                       370   7e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAL86466.1|AC077693_5  hypothetical protein                          371   1e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002868016.1|  dehydration-responsive family protein              369   1e-118   
gb|EAY79581.1|  hypothetical protein OsI_34717                          368   1e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         368   3e-118   Brachypodium distachyon [annual false brome]
gb|EEC68449.1|  hypothetical protein OsI_36659                          367   3e-118   Oryza sativa Indica Group [Indian rice]
gb|EPS60507.1|  hypothetical protein M569_14296                         367   3e-118   Genlisea aurea
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          368   4e-118   Sorghum bicolor [broomcorn]
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2         367   4e-118   Brachypodium distachyon [annual false brome]
dbj|BAH19630.1|  AT4G18030                                              368   4e-118   Arabidopsis thaliana [mouse-ear cress]
gb|EEE52366.1|  hypothetical protein OsJ_34430                          367   7e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        367   9e-118   Cucumis melo [Oriental melon]
gb|KJB08229.1|  hypothetical protein B456_001G071800                    368   1e-117   Gossypium raimondii
emb|CDX78823.1|  BnaA01g08900D                                          366   2e-117   
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        366   2e-117   Brassica rapa
ref|NP_001068227.1|  Os11g0601600                                       367   2e-117   
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14        365   7e-117   Cucumis sativus [cucumbers]
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2         363   1e-116   Zea mays [maize]
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             362   6e-116   
tpg|DAA46388.1|  TPA: hypothetical protein ZEAMMB73_857191              358   1e-114   
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                       359   2e-114   
ref|NP_001152056.1|  methyltransferase                                  359   2e-114   Zea mays [maize]
ref|XP_008668148.1|  PREDICTED: methyltransferase isoform X1            358   4e-114   
gb|AAD14491.1|  Unknown protein                                         356   6e-114   Arabidopsis thaliana [mouse-ear cress]
gb|EMS59423.1|  putative methyltransferase PMT2                         358   9e-114   Triticum urartu
gb|KDO43766.1|  hypothetical protein CISIN_1g026623mg                   343   1e-113   Citrus sinensis [apfelsine]
dbj|BAJ85549.1|  predicted protein                                      355   1e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS46508.1|  putative methyltransferase PMT2                         351   1e-112   Triticum urartu
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          368   1e-111   Medicago truncatula
ref|XP_004979626.1|  PREDICTED: probable methyltransferase PMT2-like    348   2e-110   Setaria italica
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like    333   2e-109   
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15        337   4e-106   Brachypodium distachyon [annual false brome]
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        336   1e-105   
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        335   3e-105   Brachypodium distachyon [annual false brome]
gb|EEC73773.1|  hypothetical protein OsI_08448                          335   6e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        333   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ87212.1|  predicted protein                                      333   1e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16934.1|  unknown                                                 333   2e-104   Picea sitchensis
ref|NP_001047721.1|  Os02g0675700                                       333   3e-104   
dbj|BAJ84848.1|  predicted protein                                      332   3e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB18847.1|  hypothetical protein B456_003G072700                    324   3e-104   Gossypium raimondii
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        332   5e-104   Phoenix dactylifera
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    330   2e-103   Phoenix dactylifera
gb|ACF86888.1|  unknown                                                 316   3e-103   Zea mays [maize]
dbj|BAJ95401.1|  predicted protein                                      330   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...    328   5e-103   
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    330   6e-103   Phoenix dactylifera
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        329   6e-103   Phoenix dactylifera
ref|XP_012086580.1|  PREDICTED: probable methyltransferase PMT18 ...    328   1e-102   Jatropha curcas
ref|XP_012086579.1|  PREDICTED: probable methyltransferase PMT18 ...    328   1e-102   Jatropha curcas
ref|NP_001053603.1|  Os04g0570800                                       328   1e-102   
ref|XP_012086578.1|  PREDICTED: probable methyltransferase PMT18 ...    328   1e-102   
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    327   1e-102   
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    327   3e-102   Setaria italica
gb|KJB18849.1|  hypothetical protein B456_003G072700                    324   3e-102   Gossypium raimondii
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        327   5e-102   Elaeis guineensis
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    327   5e-102   Zea mays [maize]
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        327   5e-102   Elaeis guineensis
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              327   5e-102   
gb|ABK94953.1|  unknown                                                 320   6e-102   Populus trichocarpa [western balsam poplar]
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        327   7e-102   Zea mays [maize]
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        326   1e-101   Malus domestica [apple tree]
gb|KJB18848.1|  hypothetical protein B456_003G072700                    325   3e-101   Gossypium raimondii
ref|XP_010255519.1|  PREDICTED: probable methyltransferase PMT15 ...    318   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18        324   4e-101   Cucumis sativus [cucumbers]
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        324   7e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    323   1e-100   
ref|XP_002298987.1|  dehydration-responsive family protein              320   1e-100   
dbj|BAJ98046.1|  predicted protein                                      323   1e-100   
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        323   1e-100   
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        323   2e-100   
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        323   2e-100   
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        323   2e-100   
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        322   2e-100   
gb|KHN15675.1|  Putative methyltransferase PMT16                        316   2e-100   
ref|XP_010662513.1|  PREDICTED: probable methyltransferase PMT15 ...    315   2e-100   
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        322   3e-100   
emb|CDM86771.1|  unnamed protein product                                322   4e-100   
gb|KHG13750.1|  hypothetical protein F383_08462                         321   6e-100   
dbj|BAK03905.1|  predicted protein                                      323   6e-100   
ref|NP_001141030.1|  uncharacterized protein LOC100273109               312   7e-100   
gb|AFW72783.1|  hypothetical protein ZEAMMB73_970285                    313   1e-99    
ref|XP_011624208.1|  PREDICTED: probable methyltransferase PMT17 ...    320   1e-99    
ref|XP_006846537.2|  PREDICTED: probable methyltransferase PMT17 ...    320   1e-99    
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    320   1e-99    
gb|KHM99141.1|  Putative methyltransferase PMT15                        313   2e-99    
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    320   2e-99    
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        318   3e-99    
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             319   4e-99    
ref|XP_008800812.1|  PREDICTED: probable methyltransferase PMT15        326   5e-99    
gb|EMT22301.1|  hypothetical protein F775_16518                         318   6e-99    
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             319   6e-99    
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        318   9e-99    
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   318   1e-98    
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        317   1e-98    
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    318   1e-98    
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    317   1e-98    
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        318   1e-98    
ref|XP_002511797.1|  ATP binding protein, putative                      317   2e-98    
gb|EAZ35683.1|  hypothetical protein OsJ_19971                          317   2e-98    
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    318   2e-98    
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        317   2e-98    
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    317   2e-98    
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        318   2e-98    
ref|XP_001779831.1|  predicted protein                                  317   2e-98    
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        318   2e-98    
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    317   2e-98    
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    316   3e-98    
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        317   3e-98    
ref|XP_002317647.1|  dehydration-responsive family protein              317   4e-98    
ref|XP_002518966.1|  ATP binding protein, putative                      317   4e-98    
gb|KEH17379.1|  methyltransferase PMT16, putative                       317   4e-98    
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        316   5e-98    
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             316   5e-98    
ref|XP_010529687.1|  PREDICTED: probable methyltransferase PMT18 ...    317   5e-98    
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             316   5e-98    
ref|XP_010529685.1|  PREDICTED: probable methyltransferase PMT18 ...    317   6e-98    
ref|XP_006656589.1|  PREDICTED: probable methyltransferase PMT15-...    314   6e-98    
ref|XP_008383220.1|  PREDICTED: probable methyltransferase PMT15        315   6e-98    
gb|EMS54302.1|  putative methyltransferase PMT17                        316   6e-98    
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    316   6e-98    
gb|EEC79826.1|  hypothetical protein OsI_21282                          316   7e-98    
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                316   8e-98    
gb|KDO82913.1|  hypothetical protein CISIN_1g0105922mg                  310   8e-98    
ref|NP_001056546.2|  Os06g0103900                                       316   8e-98    
dbj|BAC24840.1|  dehydration-responsive protein-like                    315   9e-98    
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             316   1e-97    
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg             315   1e-97    
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        315   1e-97    
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        315   1e-97    
gb|KHN29409.1|  Putative methyltransferase PMT15                        308   1e-97    
emb|CDX94256.1|  BnaC02g29160D                                          315   2e-97    
ref|XP_002874627.1|  dehydration-responsive family protein              315   2e-97    
gb|EEC67295.1|  hypothetical protein OsI_34283                          315   2e-97    
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        315   2e-97    
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        314   2e-97    
ref|NP_192782.1|  putative methyltransferase PMT17                      314   3e-97    
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        314   3e-97    
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    315   3e-97    
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        314   3e-97    
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        315   3e-97    
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        314   3e-97    
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        315   4e-97    
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    314   4e-97    
emb|CDX85977.1|  BnaC06g21570D                                          310   4e-97    
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     313   4e-97    
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        314   4e-97    
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    314   4e-97    
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          315   5e-97    
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             314   5e-97    
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        314   6e-97    
ref|NP_001065036.1|  Os10g0510400                                       313   6e-97    
gb|KHN30834.1|  Putative methyltransferase PMT2                         310   6e-97    
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        313   9e-97    
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        313   1e-96    
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        312   1e-96    
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    313   1e-96    
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18        313   1e-96    
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             312   1e-96    
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        312   2e-96    
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    312   2e-96    
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        312   2e-96    
emb|CDX93797.1|  BnaA09g23970D                                          308   2e-96    
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    312   2e-96    
gb|KFK45055.1|  hypothetical protein AALP_AA1G338100                    311   3e-96    
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        311   3e-96    
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16        312   3e-96    
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        311   4e-96    
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        311   4e-96    
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  311   4e-96    
emb|CDP12267.1|  unnamed protein product                                311   4e-96    
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        311   4e-96    
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             311   4e-96    
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        311   5e-96    
ref|XP_009794887.1|  PREDICTED: probable methyltransferase PMT15        311   6e-96    
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    311   7e-96    
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   311   8e-96    
ref|XP_006306983.1|  hypothetical protein CARUB_v10008557mg             311   8e-96    
emb|CDX84046.1|  BnaC08g07230D                                          310   8e-96    
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                310   8e-96    
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18        310   8e-96    
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             310   9e-96    
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        310   1e-95    
ref|NP_564419.1|  putative methyltransferase PMT18                      310   1e-95    
gb|KJB09867.1|  hypothetical protein B456_001G171500                    310   1e-95    
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             309   1e-95    
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    310   2e-95    
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        310   2e-95    
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    310   2e-95    
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    310   2e-95    
ref|NP_001147806.1|  methyltransferase                                  309   2e-95    
gb|AAF97349.1|AC021045_6  Unknown Protein                               310   2e-95    
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  310   2e-95    
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             310   2e-95    
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    310   2e-95    
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        310   2e-95    
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15        309   3e-95    
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        309   3e-95    
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             309   3e-95    
ref|XP_012083473.1|  PREDICTED: probable methyltransferase PMT15 ...    309   3e-95    
ref|XP_006365768.1|  PREDICTED: probable methyltransferase PMT15-...    309   3e-95    
gb|KJB24074.1|  hypothetical protein B456_004G127200                    308   3e-95    
ref|NP_001266897.1|  hypothetical protein                               301   4e-95    
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    308   5e-95    
ref|XP_001778231.1|  predicted protein                                  308   5e-95    
ref|XP_012083474.1|  PREDICTED: probable methyltransferase PMT15 ...    308   5e-95    
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    311   5e-95    
ref|XP_003533625.1|  PREDICTED: probable methyltransferase PMT15-...    308   5e-95    
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    310   5e-95    
emb|CDY44966.1|  BnaA08g06660D                                          308   6e-95    
ref|XP_002437666.1|  hypothetical protein SORBIDRAFT_10g000440          308   6e-95    
emb|CDP08881.1|  unnamed protein product                                308   7e-95    
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    308   7e-95    
emb|CDX99539.1|  BnaC09g24530D                                          308   8e-95    
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        308   8e-95    
ref|XP_002891032.1|  dehydration-responsive family protein              308   8e-95    
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    308   1e-94    
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             308   1e-94    
gb|EEE61530.1|  hypothetical protein OsJ_15834                          305   1e-94    
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        308   1e-94    
emb|CDP05238.1|  unnamed protein product                                308   1e-94    
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    308   1e-94    
ref|XP_006857883.1|  PREDICTED: probable methyltransferase PMT16        307   2e-94    
gb|KJB60756.1|  hypothetical protein B456_009G324300                    304   2e-94    
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        307   2e-94    
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    306   2e-94    
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    306   2e-94    
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        306   2e-94    
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        307   2e-94    
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        307   3e-94    
ref|XP_008656343.1|  PREDICTED: probable methyltransferase PMT2         306   3e-94    
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        306   3e-94    
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        306   3e-94    
ref|XP_002449806.1|  hypothetical protein SORBIDRAFT_05g023610          305   3e-94    
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15        306   4e-94    
gb|EYU25067.1|  hypothetical protein MIMGU_mgv1a004954mg                302   4e-94    
gb|KGN56550.1|  hypothetical protein Csa_3G123720                       299   4e-94    
ref|XP_010055225.1|  PREDICTED: probable methyltransferase PMT15 ...    306   5e-94    
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        306   6e-94    
gb|KJB18860.1|  hypothetical protein B456_003G072700                    306   6e-94    
ref|XP_002510829.1|  ATP binding protein, putative                      306   6e-94    
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...    306   7e-94    
ref|XP_006586024.1|  PREDICTED: probable methyltransferase PMT2-l...    302   9e-94    
ref|XP_010523726.1|  PREDICTED: probable methyltransferase PMT16        306   9e-94    
ref|XP_010470192.1|  PREDICTED: probable methyltransferase PMT17        301   9e-94    
gb|EPS61626.1|  hypothetical protein M569_13168                         298   1e-93    
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        305   1e-93    
ref|XP_004240739.1|  PREDICTED: probable methyltransferase PMT15 ...    305   1e-93    
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    304   2e-93    
gb|AAX94055.2|  dehydration-induced protein                             305   2e-93    
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        304   2e-93    
ref|XP_012090301.1|  PREDICTED: probable methyltransferase PMT16        305   2e-93    
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18        303   3e-93    
ref|XP_003551650.1|  PREDICTED: probable methyltransferase PMT16-...    301   3e-93    
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          303   4e-93    
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    303   4e-93    
ref|XP_009373685.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    296   4e-93    
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    303   5e-93    
ref|XP_010559094.1|  PREDICTED: probable methyltransferase PMT16        303   6e-93    
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    303   6e-93    
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    303   7e-93    
ref|XP_007139953.1|  hypothetical protein PHAVU_008G072500g             296   8e-93    
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    303   9e-93    
ref|XP_004492680.1|  PREDICTED: probable methyltransferase PMT15-...    311   1e-92    
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...    303   1e-92    
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        303   1e-92    
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    303   1e-92    
gb|ABR16582.1|  unknown                                                 302   1e-92    
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        302   2e-92    
ref|XP_002301329.1|  dehydration-responsive family protein              301   2e-92    
ref|XP_010091548.1|  putative methyltransferase PMT15                   302   2e-92    
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        301   2e-92    
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    301   2e-92    
ref|XP_007139952.1|  hypothetical protein PHAVU_008G072400g             301   3e-92    
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    301   4e-92    
gb|EPS68701.1|  hypothetical protein M569_06064                         301   4e-92    
gb|KJB41226.1|  hypothetical protein B456_007G095700                    301   4e-92    
ref|XP_008677769.1|  PREDICTED: hypothetical protein isoform X1         301   5e-92    
ref|XP_004140852.1|  PREDICTED: probable methyltransferase PMT15        300   5e-92    
ref|XP_004228448.2|  PREDICTED: probable methyltransferase PMT15        300   6e-92    
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        300   9e-92    
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        300   9e-92    
gb|KHM99867.1|  Putative methyltransferase PMT18                        296   1e-91    
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    299   1e-91    
ref|XP_006858634.1|  PREDICTED: probable methyltransferase PMT19        300   1e-91    
emb|CDY01971.1|  BnaC02g27560D                                          293   1e-91    
gb|KHN16709.1|  Putative methyltransferase PMT18                        298   2e-91    



>ref|XP_006366703.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366704.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006366705.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006366706.1| PREDICTED: probable methyltransferase PMT2-like isoform X4 [Solanum 
tuberosum]
Length=612

 Score =   476 bits (1225),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/277 (80%), Positives = 249/277 (90%), Gaps = 0/277 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKKSEKGE AIWQ+RMD DSCR++Q+ S+AT C+S DPDDVWY KM+ CITPS
Sbjct  336   IAKLLCWEKKSEKGETAIWQKRMDADSCRSTQEDSEATLCKSTDPDDVWYNKMETCITPS  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                  DE  + FPERL A+PPRIANGLVSGVS EAYL+D+KKWKKHVSAYK+ NK+IDTG
Sbjct  396   KGNGDDEGLRPFPERLFAVPPRIANGLVSGVSVEAYLEDSKKWKKHVSAYKKSNKLIDTG  455

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMN+GLGGFAA L SPK WVMNV+PTIA+K+TLGVIYERG+IGIYHDWCE FST
Sbjct  456   RYRNIMDMNSGLGGFAAALQSPKLWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFST  515

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLYKD+CDFEDILLEMDRILRPEGAV+ RD+VD LIKV++IIGGMR
Sbjct  516   YPRTYDLIHANGLFSLYKDRCDFEDILLEMDRILRPEGAVILRDDVDVLIKVKKIIGGMR  575

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             WD+KLMDHEDGPLVP KILVAVK+YWT+ D NSTS +
Sbjct  576   WDFKLMDHEDGPLVPVKILVAVKQYWTVEDNNSTSTR  612



>ref|XP_009793104.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=613

 Score =   475 bits (1223),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 223/274 (81%), Positives = 245/274 (89%), Gaps = 0/274 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEKKSEKGE AIWQ+RMD DSCR+ Q+ S ATFC+S DPDDVWYKKM+ CITPS
Sbjct  337   IAKRLCWEKKSEKGETAIWQKRMDADSCRSEQEDSAATFCKSADPDDVWYKKMEGCITPS  396

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                   E  K FPERL A+PPRIANGLVSGVS EAYL+DNKKWKKHVSAY +INK+IDTG
Sbjct  397   KVNGDGEGLKPFPERLFAVPPRIANGLVSGVSVEAYLEDNKKWKKHVSAYTKINKLIDTG  456

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIYERG+IGIYHDWCE FST
Sbjct  457   RYRNIMDMNAGLGGFAAALHSPKMWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFST  516

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+G+FSLYKDKCDFEDILLEMDRILRPEGAV+ RD+VD LIKV++IIGGMR
Sbjct  517   YPRTYDLIHAHGLFSLYKDKCDFEDILLEMDRILRPEGAVIMRDDVDVLIKVKKIIGGMR  576

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             WD+KLMDHED PLVPEKILVAVKKYWT+ D N+T
Sbjct  577   WDFKLMDHEDAPLVPEKILVAVKKYWTVGDNNTT  610



>ref|XP_004228376.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   473 bits (1216),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/277 (79%), Positives = 249/277 (90%), Gaps = 0/277 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKKSEKGE AIWQ+RMD DSCR++Q++S+AT C+S DPDDVWY KM+ CITPS
Sbjct  336   IAKLLCWEKKSEKGETAIWQKRMDADSCRSTQEESEATLCKSTDPDDVWYNKMEACITPS  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                  DE  K FPERL A+PPRIANGLVSGV  EAYL+DN+KWKKHVSAYK+INK+IDTG
Sbjct  396   KGNGDDEGLKPFPERLFAVPPRIANGLVSGVPVEAYLEDNRKWKKHVSAYKKINKLIDTG  455

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMN+GLGGFAA L SPK WVMNV+PTIA K+TLGVIYERG+IGIYHDWCE FST
Sbjct  456   RYRNIMDMNSGLGGFAAALQSPKLWVMNVMPTIAKKNTLGVIYERGLIGIYHDWCEAFST  515

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD++D LIKV++IIGG+R
Sbjct  516   YPRTYDLIHAHGLFSLYKDKCNFEDILLEMDRILRPEGAVILRDDIDVLIKVKKIIGGIR  575

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             WD KL+DHEDGPLVPEKILVAVK+YWT+ D NSTS +
Sbjct  576   WDSKLIDHEDGPLVPEKILVAVKQYWTVGDDNSTSTR  612



>ref|XP_009626042.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=613

 Score =   468 bits (1203),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 218/274 (80%), Positives = 243/274 (89%), Gaps = 0/274 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEKKSEKGE AIWQ+RMD +SC + Q+ S ATFC+S DPDDVWYKKM+ C TPS
Sbjct  337   IAKRLCWEKKSEKGETAIWQKRMDAESCHSEQEDSAATFCKSADPDDVWYKKMEGCTTPS  396

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                  DE  K FPERL A+PPRIANGLVSGVS EAYL+DNKKWKKHVSAY +INK+IDTG
Sbjct  397   KGNGDDEGLKPFPERLYAVPPRIANGLVSGVSVEAYLEDNKKWKKHVSAYTKINKLIDTG  456

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLGGFAA L S K WVMNV+PTI +K+TLGVIYERG+IGIYHDWCE FST
Sbjct  457   RYRNIMDMNAGLGGFAAALHSSKMWVMNVMPTITEKNTLGVIYERGLIGIYHDWCEAFST  516

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+G+FSLYKDKCDFEDILLEMDRILRPEGAV+ RD+V+ LIKV++IIGGMR
Sbjct  517   YPRTYDLIHAHGLFSLYKDKCDFEDILLEMDRILRPEGAVIMRDDVEVLIKVKKIIGGMR  576

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             WD+KLMDHEDGPLVPEK++VAVKKYWT+ D NST
Sbjct  577   WDFKLMDHEDGPLVPEKVVVAVKKYWTVGDYNST  610



>ref|XP_009624681.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=611

 Score =   462 bits (1188),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 213/274 (78%), Positives = 245/274 (89%), Gaps = 0/274 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEK SEKGE AIW++RMD DSCR++Q+ S A+ C++ DPD+VWY KM+ CITP+ 
Sbjct  338   AKLLCWEKISEKGETAIWRKRMDADSCRSAQENSAASICKADDPDNVWYNKMETCITPNN  397

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +  DES K FPERL A+PPRIANG VSGVS E Y +DNKKWKKHVSAYK+INK++DTGR
Sbjct  398   GSGEDESLKPFPERLYAVPPRIANGQVSGVSVEKYEEDNKKWKKHVSAYKKINKLLDTGR  457

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIYERG+IGIYHDWCE FSTY
Sbjct  458   YRNIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTY  517

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD+VD LIKV++IIGGMRW
Sbjct  518   PRTYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDDVDVLIKVKKIIGGMRW  577

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             ++KLMDHEDGPLVPEKILVAVK+YWTLN T S+ 
Sbjct  578   NFKLMDHEDGPLVPEKILVAVKQYWTLNSTTSSQ  611



>ref|XP_004238796.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
 ref|XP_010320682.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   462 bits (1188),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 243/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEK SEKGE AIWQ+R D  SCR++Q+ S A  C+  DPD VWY KM++CITP+ 
Sbjct  337   AKLLCWEKISEKGETAIWQKRKDSASCRSAQENSAAKVCKPSDPDSVWYNKMEMCITPNN  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                 DES K FPERL A+PPRIANGLVSGVS E Y +D+KKWKKHVSAYK+INK++DTGR
Sbjct  397   GNGGDESLKPFPERLYAVPPRIANGLVSGVSVEKYQEDSKKWKKHVSAYKKINKLLDTGR  456

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L  PK WVMNV+PTIA+K+TLGV++ERG+IGIYHDWCE FSTY
Sbjct  457   YRNIMDMNAGLGGFAAALHDPKFWVMNVMPTIAEKNTLGVVFERGLIGIYHDWCEAFSTY  516

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+FSLYKDKCDF+DILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW
Sbjct  517   PRTYDLIHANGLFSLYKDKCDFQDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRW  576

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             ++KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  577   NFKLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  612



>gb|ABO93008.1| putative methyltransferase [Solanum tuberosum]
Length=509

 Score =   458 bits (1178),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 243/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEK SEKGE AIWQ+R D  SCR++Q+ S A  C+  DPD VWY KM++CITP+ 
Sbjct  234   AKLLCWEKISEKGETAIWQKRKDSASCRSAQENSAARVCKPSDPDSVWYNKMEMCITPNN  293

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                 DES K FPERL A+PPRIANGLVSGVS   Y +D+KKWKKHVSAYK+INK++DTGR
Sbjct  294   GNGGDESLKPFPERLYAVPPRIANGLVSGVSVAKYQEDSKKWKKHVSAYKKINKLLDTGR  353

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L +PK WVMNV+PTIA+K+TLGVI+ERG+IGIYHDWCE FSTY
Sbjct  354   YRNIMDMNAGLGGFAAALHNPKFWVMNVMPTIAEKNTLGVIFERGLIGIYHDWCEAFSTY  413

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW
Sbjct  414   PRTYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRW  473

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             ++KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  474   NFKLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  509



>ref|XP_009761475.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=611

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/274 (78%), Positives = 243/274 (89%), Gaps = 0/274 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEK SEKGE AIW++RMD DSCR++Q+ S A  C++ DPD+VWY KM+ CITP+ 
Sbjct  338   AKLLCWEKISEKGETAIWRKRMDADSCRSAQENSAARICKADDPDNVWYNKMETCITPNN  397

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                 DES K FPERL A+PPRIANG VSGVS E Y +DNKKWKKHVSAYK+INK++DTGR
Sbjct  398   GNGEDESLKPFPERLYAVPPRIANGQVSGVSVEKYQEDNKKWKKHVSAYKKINKLLDTGR  457

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIYERG+IGIYHDWCE FSTY
Sbjct  458   YRNIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTY  517

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RDEVD LIKV++IIGGMRW
Sbjct  518   PRTYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDEVDVLIKVKKIIGGMRW  577

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             ++KLMDHEDGPLVPEKILVAVK+YWTLN T S+ 
Sbjct  578   NFKLMDHEDGPLVPEKILVAVKQYWTLNSTTSSQ  611



>gb|ABO92980.1| putative methyltransferase [Solanum tuberosum]
Length=612

 Score =   458 bits (1179),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/276 (77%), Positives = 243/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEK SEKGE AIWQ+R D  SCR++Q+ S A  C+  DPD VWY KM++CITP+ 
Sbjct  337   AKLLCWEKISEKGETAIWQKRKDSASCRSAQENSAARVCKPSDPDSVWYNKMEMCITPNN  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                 DES K FPERL A+PPRIANGLVSGVS   Y +D+KKWKKH+SAYK+INK++DTGR
Sbjct  397   GNGGDESLKPFPERLYAVPPRIANGLVSGVSVAKYQEDSKKWKKHISAYKKINKLLDTGR  456

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVI+ERG+IGIYHDWCE FSTY
Sbjct  457   YRNIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIFERGLIGIYHDWCEAFSTY  516

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++I+GGMRW
Sbjct  517   PRTYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIMGGMRW  576

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             ++KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  577   NFKLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  612



>ref|XP_006366112.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366113.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
Length=612

 Score =   458 bits (1178),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 213/276 (77%), Positives = 243/276 (88%), Gaps = 0/276 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEK SEKGE AIWQ+R D  SCR++Q+ S A  C+  DPD VWY KM++CITP+ 
Sbjct  337   AKLLCWEKISEKGETAIWQKRKDSASCRSAQENSAARVCKPSDPDSVWYNKMEMCITPNN  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                 DES K FPERL A+PPRIANGLVSGVS   Y +D+KKWKKHVSAYK+INK++DTGR
Sbjct  397   GNGGDESLKPFPERLYAVPPRIANGLVSGVSVAKYQEDSKKWKKHVSAYKKINKLLDTGR  456

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L +PK WVMNV+PTIA+K+TLGVI+ERG+IGIYHDWCE FSTY
Sbjct  457   YRNIMDMNAGLGGFAAALHNPKFWVMNVMPTIAEKNTLGVIFERGLIGIYHDWCEAFSTY  516

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW
Sbjct  517   PRTYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRW  576

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             ++KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  577   NFKLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  612



>gb|EYU22421.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=611

 Score =   455 bits (1171),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/272 (78%), Positives = 242/272 (89%), Gaps = 1/272 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSEKGEIAIWQ+ MD DSCR++Q+ S A FC+S D D+VWYKKM+ CITP+
Sbjct  339   VAKLLCWEKKSEKGEIAIWQKSMDTDSCRSAQENSGAEFCKSEDADNVWYKKMEQCITPN  398

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                N +   K FPERL A+PPRIA+G +SGVS EAYL+DNK+WKKHV+AY++INKIID+G
Sbjct  399   -NNNANSDLKPFPERLYAVPPRIASGSISGVSVEAYLEDNKQWKKHVNAYRKINKIIDSG  457

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGV+YERG+IGIYHDWCEGFST
Sbjct  458   RYRNIMDMNAGLGGFAAALQSPKLWVMNVVPTIAKKNTLGVVYERGLIGIYHDWCEGFST  517

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANGVFSLY DKC+FEDILLEMDRILRPEGAV+FRDEVD L+KV++IIGGMR
Sbjct  518   YPRTYDLIHANGVFSLYNDKCNFEDILLEMDRILRPEGAVIFRDEVDVLVKVKKIIGGMR  577

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
             WD K++DHEDGPLVPEKILV VK+YW  N T+
Sbjct  578   WDSKMIDHEDGPLVPEKILVVVKQYWVGNSTS  609



>emb|CDP00327.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   454 bits (1169),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 216/280 (77%), Positives = 244/280 (87%), Gaps = 3/280 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKKSEK EIAIWQ+R+D DSCRA Q+ S ATFC++ DPDDVWYKKM+ CITPS
Sbjct  337   IAKLLCWEKKSEKAEIAIWQKRIDADSCRAEQENSGATFCKASDPDDVWYKKMEECITPS  396

Query  953   PKANID---ESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKII  783
                  +   ES K FPER+ AIP RIA+G V GVSAE+Y +D+KKWKKHV+AYKRINKI+
Sbjct  397   DVKGDEASGESIKPFPERVYAIPQRIASGSVRGVSAESYQEDSKKWKKHVNAYKRINKIL  456

Query  782   DTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEG  603
             D+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGVIYERG+IGIYHDWCEG
Sbjct  457   DSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEG  516

Query  602   FSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIG  423
             FSTYPRTYDLIHANG+FSLYKDKCDFEDILLEMDRILRPEGAV+ RD VD L KV++I+ 
Sbjct  517   FSTYPRTYDLIHANGLFSLYKDKCDFEDILLEMDRILRPEGAVIIRDAVDVLNKVQKIVR  576

Query  422   GMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             G+RWD+KL DHEDGPLVPEKIL+AVKKYW   + NSTS +
Sbjct  577   GIRWDFKLTDHEDGPLVPEKILIAVKKYWVAGENNSTSTE  616



>ref|XP_004297305.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   450 bits (1157),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/272 (78%), Positives = 238/272 (88%), Gaps = 1/272 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSEKGE AIWQ+R++ DSC + Q  S+ATFC   D DDVWYKKM+ CITP P
Sbjct  337   AKLLCWEKKSEKGETAIWQKRVNSDSCSSRQDDSQATFCSFNDADDVWYKKMEGCITPYP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                  E  K FPERL A+PPRIA+G V GVS E+YL+DNK WKKHVSAYKRINK++D+GR
Sbjct  397   DEVAGE-LKPFPERLHAVPPRIASGSVPGVSVESYLEDNKNWKKHVSAYKRINKLLDSGR  455

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRN+MDMNAGLGGF AQLTSPK WVMNVVPTIA+K+TLGVIYERGMIGIYHDWCEGFSTY
Sbjct  456   YRNVMDMNAGLGGFGAQLTSPKLWVMNVVPTIAEKNTLGVIYERGMIGIYHDWCEGFSTY  515

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+FSLY  KC++EDILLEMDRILRPEGAV+FRDEVD LIKVR+I+GGMRW
Sbjct  516   PRTYDLIHANGIFSLYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVRKIVGGMRW  575

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D K++DHEDGPLVPEKILVAVK+YW  N T++
Sbjct  576   DTKMVDHEDGPLVPEKILVAVKQYWVGNSTST  607



>ref|XP_012067633.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Jatropha 
curcas]
 gb|KDP41191.1| hypothetical protein JCGZ_15598 [Jatropha curcas]
Length=617

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 214/282 (76%), Positives = 245/282 (87%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGE+AIWQ+R++ +SC + Q  S+ TFC+S DP+DVWYKKM+ CITP 
Sbjct  337   IAKLLCWEKKYEKGEMAIWQKRVNAESCPSRQDDSQVTFCKSTDPNDVWYKKMETCITPY  396

Query  953   PK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ ++ DE      K FPERL AIPPR+A+G + GVS E Y +DN KWKKHV AYK+INK
Sbjct  397   PEVSSRDEVAGGELKAFPERLYAIPPRVASGSIPGVSVETYQEDNNKWKKHVKAYKKINK  456

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIADKSTLGVIYERG+IGIYHDWC
Sbjct  457   LIDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWC  516

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKVR+I
Sbjct  517   EAFSTYPRTYDLIHANGVFSLYKDKCNTEDILLEMDRILRPEGAVIFRDEVDVLIKVRKI  576

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD K++DHEDGPLVPEKILVAVK+YW + D NSTS++
Sbjct  577   VGGMRWDTKMVDHEDGPLVPEKILVAVKQYW-VADGNSTSSE  617



>ref|XP_011071001.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=612

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/275 (77%), Positives = 239/275 (87%), Gaps = 2/275 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK+E GEIAIWQ+ MD DSCRA+Q+ S A FC+S D DDVWYKKM+ CIT +
Sbjct  337   VAKLLCWEKKAEIGEIAIWQKSMDTDSCRAAQENSGAAFCKSEDADDVWYKKMEPCITRN  396

Query  953   PKANID--ESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
               AN D     K FPERL A+PPRIA+G V GVS + YL+DNK WKKHV+AY++IN+IID
Sbjct  397   DIANSDGVPGLKPFPERLYAVPPRIASGAVPGVSVDEYLEDNKLWKKHVNAYRKINRIID  456

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
             +GRYRNIMDMNAG GGFAA L SPK WVMNVVPTIADK+TLGVIYERG+IGIYHDWCE F
Sbjct  457   SGRYRNIMDMNAGFGGFAAALQSPKLWVMNVVPTIADKNTLGVIYERGLIGIYHDWCEAF  516

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAV+FRDEVD L+KV+++IGG
Sbjct  517   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVIFRDEVDVLVKVKKMIGG  576

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             MRWD K+MDHEDGPLVPEKILV VK+YW  N T+S
Sbjct  577   MRWDSKMMDHEDGPLVPEKILVVVKQYWVGNSTSS  611



>gb|EYU28744.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
 gb|EYU28745.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
Length=609

 Score =   447 bits (1151),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 212/276 (77%), Positives = 244/276 (88%), Gaps = 4/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSEKGEIAIWQ+ +D  +CRA Q+ S ATFC+S D DDVWYK+M+ CITP+ 
Sbjct  338   AKLLCWEKKSEKGEIAIWQKTLDSAACRAKQESSGATFCKSDDTDDVWYKQMEQCITPND  397

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
               NI +  K FPERL A+PPRIA+G V GVS EA+++D+++WKKHV+AY++IN+IID+GR
Sbjct  398   NDNIVD-LKPFPERLYAVPPRIASGSVPGVSVEAFMEDSRQWKKHVNAYRKINQIIDSGR  456

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGV+YERG+IGIYHDWCE FSTY
Sbjct  457   YRNIMDMNAGLGGFAAALHSPKFWVMNVVPTIAEKNTLGVVYERGLIGIYHDWCEAFSTY  516

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAV+FRDEVD L+KVR+IIGGM+W
Sbjct  517   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVIFRDEVDVLVKVRKIIGGMKW  576

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D K+MDHEDGPLVPEKILVAVK+YW     NSTS Q
Sbjct  577   DSKMMDHEDGPLVPEKILVAVKQYWV---GNSTSPQ  609



>ref|XP_002522425.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF39917.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   446 bits (1146),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/282 (73%), Positives = 241/282 (85%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              AKLLCWEKK E+GE+A+WQ+R++ +SC + Q  S+ATFC+S D DDVWYKKM+ CITP 
Sbjct  332   FAKLLCWEKKYEQGEMAVWQKRVNAESCASRQDNSQATFCKSADSDDVWYKKMEACITPY  391

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+    +       K FP+RL A+PPR+++G + GVS E Y +DNK WKKHVSAYK+IN+
Sbjct  392   PEVGSQDEVAGGGLKAFPDRLYAVPPRVSSGSIPGVSVETYQEDNKNWKKHVSAYKKINR  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLGVIYERG+IGIYHDWC
Sbjct  452   LIDSGRYRNIMDMNAGLGGFAAALQSPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWC  511

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYK+KCDFEDILLEMDRILRPEGAV+FRDEVD LIKVR+I
Sbjct  512   EAFSTYPRTYDLIHANGVFSLYKEKCDFEDILLEMDRILRPEGAVIFRDEVDVLIKVRKI  571

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRWD K++DHEDGPLVPEKILVAVK+YW +   NSTSAQ
Sbjct  572   VAGMRWDTKMVDHEDGPLVPEKILVAVKQYW-VTGGNSTSAQ  612



>ref|XP_012067632.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
Length=620

 Score =   442 bits (1138),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 213/285 (75%), Positives = 245/285 (86%), Gaps = 9/285 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGE+AIWQ+R++ +SC + Q  S+ TFC+S DP+DVWYKKM+ CITP 
Sbjct  337   IAKLLCWEKKYEKGEMAIWQKRVNAESCPSRQDDSQVTFCKSTDPNDVWYKKMETCITPY  396

Query  953   PK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ ++ DE      K FPERL AIPPR+A+G + GVS E Y +DN KWKKHV AYK+INK
Sbjct  397   PEVSSRDEVAGGELKAFPERLYAIPPRVASGSIPGVSVETYQEDNNKWKKHVKAYKKINK  456

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIADKSTLGVIYERG+IGIYHDWC
Sbjct  457   LIDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWC  516

Query  608   EGFSTYPRTYDLIHANGVFSLYKD---KCDFEDILLEMDRILRPEGAVVFRDEVDTLIKV  438
             E FSTYPRTYDLIHANGVFSLYKD   +C+ EDILLEMDRILRPEGAV+FRDEVD LIKV
Sbjct  517   EAFSTYPRTYDLIHANGVFSLYKDNECRCNTEDILLEMDRILRPEGAVIFRDEVDVLIKV  576

Query  437   RRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             R+I+GGMRWD K++DHEDGPLVPEKILVAVK+YW + D NSTS++
Sbjct  577   RKIVGGMRWDTKMVDHEDGPLVPEKILVAVKQYW-VADGNSTSSE  620



>ref|XP_010258374.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
 ref|XP_010258376.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=617

 Score =   442 bits (1137),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 205/281 (73%), Positives = 237/281 (84%), Gaps = 5/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIW++ ++ +SCR  Q  S+A  C S +PDDVWYKKM+ C+TP 
Sbjct  336   IAKLLCWEKKYEKGEIAIWRKSLNAESCRGRQDDSRANICASKNPDDVWYKKMEACLTPY  395

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N       E  K FP+RL A+PPR+A+G V GVS E YLDDNK WKKHV AYK+INK
Sbjct  396   PDVNSPDEVAGEELKPFPQRLNAVPPRVASGSVPGVSVETYLDDNKLWKKHVKAYKKINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRN+MDMNAGLG FAA + SPK WVMNVVPTIA+K TLGVIYERG+IGIYHDWC
Sbjct  456   ILDSGRYRNMMDMNAGLGSFAAAIESPKLWVMNVVPTIAEKKTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD LIKV+RI
Sbjct  516   EAFSTYPRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDDVDVLIKVKRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             I GM+W+ K++DHEDGPLVPEKILVAVK+YWT+ + NSTS+
Sbjct  576   IAGMKWNTKMVDHEDGPLVPEKILVAVKQYWTVGENNSTSS  616



>ref|XP_002311593.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
 gb|EEE88960.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
Length=615

 Score =   442 bits (1136),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 211/281 (75%), Positives = 242/281 (86%), Gaps = 8/281 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP-S  954
             AKLLCW+KK EKGE+AIWQ+R++ DSCRA Q  S+ATFC+S D DDVWYKKM+ CITP S
Sbjct  338   AKLLCWDKKYEKGEMAIWQKRVNADSCRARQDDSRATFCKSADVDDVWYKKMEACITPYS  397

Query  953   PKANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
                + DE    + K FPERL AIPPR+A+G + GVS E Y D N +WKKHV+AYK+INK+
Sbjct  398   DSGSSDEVAGGALKVFPERLYAIPPRVASGSIPGVSVETYQDYNNEWKKHVNAYKKINKL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE
Sbjct  458   IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCE  517

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA+GVFSLY+DKCD EDILLEMDRILRPEGAV+FRDEVD L+KVR+++
Sbjct  518   SFSTYPRTYDLIHASGVFSLYRDKCDMEDILLEMDRILRPEGAVIFRDEVDVLVKVRKMV  577

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             GGM+WD K++DHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  578   GGMKWDTKMVDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  615



>ref|XP_011025778.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011025787.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   441 bits (1134),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/281 (75%), Positives = 242/281 (86%), Gaps = 8/281 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP-S  954
             AKLLCW+KK EKGE+AIWQ+R++ DSCRA Q  S+ATFC+S D DDVWYKKM+ CITP S
Sbjct  338   AKLLCWDKKYEKGEMAIWQKRVNADSCRARQDDSRATFCKSADVDDVWYKKMEACITPYS  397

Query  953   PKANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
                + DE    + K FPERL AIPPR+A+G + GVS E Y D N +WKKHV+AYK+INK+
Sbjct  398   DSGSSDEVAGGALKVFPERLYAIPPRVASGSIPGVSVETYQDYNNEWKKHVNAYKKINKL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA++STLGVIYERG+IGIYHDWCE
Sbjct  458   IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAERSTLGVIYERGLIGIYHDWCE  517

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA+GVFSLY+DKCD EDILLEMDRILRPEGAV+FRDEVD L+KVR+++
Sbjct  518   AFSTYPRTYDLIHASGVFSLYRDKCDMEDILLEMDRILRPEGAVIFRDEVDVLVKVRKMV  577

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             GGM+WD K++DHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  578   GGMKWDTKMVDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  615



>ref|XP_010683197.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683199.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683200.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683201.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=610

 Score =   440 bits (1132),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 236/276 (86%), Gaps = 1/276 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCW K+ EKGEIA+WQ+ +D DSCR  Q +SKAT C+S +PDDVWYKKM+ C+TP P
Sbjct  336   AKLLCWVKRHEKGEIAVWQKSLDADSCRRRQDESKATMCKS-NPDDVWYKKMETCVTPFP  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
                  E  K FPERL A+PPR+A+G V GVS +AYL DN  WKKHV AYKRIN ++DTGR
Sbjct  395   NDGAGEQLKPFPERLYAVPPRVASGSVPGVSVDAYLKDNSMWKKHVKAYKRINSLLDTGR  454

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA + S K WVMNV+PTIA+K+TLGVIYERG+IGIYHDWCEGFSTY
Sbjct  455   YRNIMDMNAGLGGFAAAIHSSKLWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEGFSTY  514

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+FSLYK+KC+ EDILLEMDRILRPEGAV+ RDEVD L+KV++I+ GMRW
Sbjct  515   PRTYDLIHANGIFSLYKNKCNLEDILLEMDRILRPEGAVIIRDEVDVLVKVKKIVAGMRW  574

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D +++DHEDGPLVPEKILVAVK+YWT++  N TS+Q
Sbjct  575   DTRMVDHEDGPLVPEKILVAVKQYWTVDGGNVTSSQ  610



>ref|XP_010089758.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB38334.1| putative methyltransferase PMT2 [Morus notabilis]
Length=611

 Score =   440 bits (1132),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/276 (75%), Positives = 240/276 (87%), Gaps = 2/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIWQ+ M+ DSC + Q  S+ATFC+S D D+VWY+KM+ CITP P
Sbjct  338   AKLLCWEKKYEKGEIAIWQKSMNADSCTSRQDDSRATFCKSDDADNVWYEKMEGCITPYP  397

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             +  + E  + FP RL A+PPRIA+G V GVS E Y +DN+ WKKHV+AYK+IN+++DTGR
Sbjct  398   EEAVGE-LQPFPRRLYAVPPRIASGSVPGVSVETYEEDNRVWKKHVNAYKKINRLLDTGR  456

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIYERG++GIYHDWCE FSTY
Sbjct  457   YRNIMDMNAGLGGFAAALHSPKLWVMNVMPTIAEKNTLGVIYERGLVGIYHDWCEPFSTY  516

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVDTL+KV++IIGGMRW
Sbjct  517   PRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDTLVKVKKIIGGMRW  576

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D K++DHEDGPLVPEKILVAVK+YW   D NSTS Q
Sbjct  577   DTKMVDHEDGPLVPEKILVAVKQYWAA-DGNSTSTQ  611



>ref|XP_011027055.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   440 bits (1132),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/281 (74%), Positives = 242/281 (86%), Gaps = 8/281 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP-S  954
             AKLLCW+KK EKGE+AIWQ+R++ DSCRA Q  S+ATFC+S D DDVWYKKM+ CITP S
Sbjct  338   AKLLCWDKKYEKGEMAIWQKRVNADSCRARQDDSRATFCKSADVDDVWYKKMEACITPYS  397

Query  953   PKANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
                + DE    + K FPERL AIPPR+A+G + GVS E Y D N +WKKHV+AYK+INK+
Sbjct  398   DSGSSDEVAGGALKVFPERLYAIPPRVASGSIPGVSVETYQDYNNEWKKHVNAYKKINKL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA++STLGVIYERG+IGIYHDWCE
Sbjct  458   IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAERSTLGVIYERGLIGIYHDWCE  517

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA+GVFSLY+DKCD EDILLEMDR+LRPEGAV+FRDEVD L+KVR+++
Sbjct  518   AFSTYPRTYDLIHASGVFSLYRDKCDMEDILLEMDRLLRPEGAVIFRDEVDVLVKVRKMV  577

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             GGM+WD K++DHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  578   GGMKWDTKMVDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  615



>ref|XP_003628359.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
Length=402

 Score =   431 bits (1109),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 237/277 (86%), Gaps = 2/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AK LCWEKKSEK EIAIWQ+  D +SCR+ Q  S   FC+S DPDDVWYKK+  C+TP+
Sbjct  128   VAKKLCWEKKSEKAEIAIWQKMTDTESCRSRQDDSSVEFCESSDPDDVWYKKLKACVTPT  187

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK +  +  K FP+RL AIPPR+++G + GVS+E Y +DNK WKKHV+AYK+IN ++D+G
Sbjct  188   PKVSGGD-LKPFPDRLYAIPPRVSSGSIPGVSSETYQNDNKMWKKHVNAYKKINSLLDSG  246

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCEGFST
Sbjct  247   RYRNIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFST  306

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMR
Sbjct  307   YPRTYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMR  366

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             W+ KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  367   WNMKLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  402



>gb|KDO82912.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=334

 Score =   428 bits (1101),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/276 (72%), Positives = 240/276 (87%), Gaps = 2/276 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEKKSEKGEIA+WQ++++ +SCRA +  S+A FC+S D DDVWYKKM+ CITP 
Sbjct  61    IANLLCWEKKSEKGEIAVWQKKVNDESCRARRDDSRANFCKSSDADDVWYKKMEGCITPY  120

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+    E  K FPERL AIPPRI++G + GVSAE+Y +D+ KWKKHV+AYK+IN+++D+G
Sbjct  121   PEVAGGE-LKAFPERLYAIPPRISSGSIPGVSAESYQEDSNKWKKHVNAYKKINRLLDSG  179

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAG GGFAA + S K WVMNVVPT+ADK+TLGVIYERG+IGIYHDWCE FST
Sbjct  180   RYRNIMDMNAGFGGFAAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCEAFST  239

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGA++ RDEVD +IKV++I+GGMR
Sbjct  240   YPRTYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMR  299

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             WD K++DHEDGPLVPEKILVAVK+YW  +  NSTS+
Sbjct  300   WDTKMVDHEDGPLVPEKILVAVKQYWVAS-GNSTSS  334



>ref|XP_004490044.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004490045.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=608

 Score =   437 bits (1123),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 202/276 (73%), Positives = 243/276 (88%), Gaps = 3/276 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSEK EIA+WQ+ +D ++CR+ Q+ S  TFC+S D DDVWYK+M+ C+TP+
Sbjct  336   VAKLLCWEKKSEKHEIAVWQKTVDSETCRSRQEDSGVTFCESTDADDVWYKRMEACVTPN  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
              K   D   K FP+RL A+PP+IA+G V GVSAE Y DDNKKWKKHV+AYKRINK++D+G
Sbjct  396   RKVYGD--LKPFPQRLYAVPPKIASGSVPGVSAETYQDDNKKWKKHVNAYKRINKLLDSG  453

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + SPK WVMNVVPTIA+K+TLGVIY+RG+IGIYHDWCEGFST
Sbjct  454   RYRNIMDMNAGLGSFAAAIQSPKLWVMNVVPTIAEKNTLGVIYQRGLIGIYHDWCEGFST  513

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIH++G+FSLY+DKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMR
Sbjct  514   YPRTYDLIHSHGLFSLYEDKCNIEDILLEMDRILRPEGAVIFRDEVDILIKVKKIVGGMR  573

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             WD K++DHEDGPLVPEKIL+AVK+YW + DTN+TS 
Sbjct  574   WDTKMVDHEDGPLVPEKILIAVKQYW-VADTNATST  608



>emb|CBI31965.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   434 bits (1115),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 237/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEKK E+GEIAIWQ+R++  +C   Q  ++ TFC++ + DD WYK M+ CI+P 
Sbjct  233   IARLLCWEKKYEQGEIAIWQKRVNAGACSGRQDDARTTFCKAEETDDTWYKNMEPCISPY  292

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N  E       + FP+RL A+PPR+A+G + GVS E YL+DNK WKKH++AYK+INK
Sbjct  293   PDVNSPEEVSGGELQPFPKRLYAVPPRVASGSIPGVSVETYLEDNKLWKKHLNAYKKINK  352

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLG +YERG+IGIYHDWC
Sbjct  353   IIDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGAVYERGLIGIYHDWC  412

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+GVFSLYKDKCD EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  413   EAFSTYPRTYDLIHAHGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  472

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD KL+DHEDGPLV EKILVAVK+YW ++  NSTS+Q
Sbjct  473   VGGMRWDTKLVDHEDGPLVSEKILVAVKQYWVVSAENSTSSQ  514



>ref|XP_007222021.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
 gb|EMJ23220.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
Length=616

 Score =   436 bits (1121),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/282 (73%), Positives = 240/282 (85%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSEKGE AIWQ+R++ DSC   +  S ATFC+S + D VWYKKM+ CITP 
Sbjct  336   VAKLLCWEKKSEKGETAIWQKRVNTDSCGDRKDDSHATFCKSDEADAVWYKKMEACITPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P +N  +       + FP+RL A+PPRIA+G VSGVS EAY +DN KWKKHV+AY+RINK
Sbjct  396   PDSNNADGAAGGELEPFPKRLYAVPPRIASGSVSGVSVEAYEEDNNKWKKHVNAYRRINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGVIYERG+IGIYHDWC
Sbjct  456   LIDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHA+GVFSLY  KCD+EDIL+EMDRILRPEGAVVFRDEVD LIKV++I
Sbjct  516   EGFSTYPRTYDLIHAHGVFSLYDGKCDWEDILIEMDRILRPEGAVVFRDEVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD K++DHEDGPLVPEK+L+AVK+YW     NSTS Q
Sbjct  576   VGGMRWDTKMVDHEDGPLVPEKVLIAVKQYWVAGG-NSTSTQ  616



>ref|XP_010066916.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 ref|XP_010066917.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 gb|KCW64965.1| hypothetical protein EUGRSUZ_G02508 [Eucalyptus grandis]
Length=615

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/282 (72%), Positives = 236/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A LLCWEKK EKGEIAIWQ+R++ +SCRA Q  S+ATFC+S + +DVWYKKM+ C+TP 
Sbjct  335   VASLLCWEKKYEKGEIAIWQKRINAESCRARQDDSRATFCKSAEDNDVWYKKMEACVTPY  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N  +       K FP+RL A+PPRI +G +SGVS E Y +D+ KWK+HV+AYK++NK
Sbjct  395   PDVNDSDEVAGGELKPFPQRLYAVPPRIVSGSISGVSVETYQEDSNKWKRHVNAYKKMNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNA LGGFAA + SPK W MNVVPTIADKSTLGVIYERG+IGIYHDWC
Sbjct  455   LLDTGRYRNIMDMNARLGGFAAAIESPKLWTMNVVPTIADKSTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLY DKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++I
Sbjct  515   EAFSTYPRTYDLIHANGVFSLYNDKCDAEDILLEMDRILRPEGAVIIRDEVDVLIKVKKI  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD K+MDHEDGPLVPEKILVAVK+YW     NSTS+ 
Sbjct  575   VGGMRWDTKMMDHEDGPLVPEKILVAVKQYWVAGG-NSTSSH  615



>ref|NP_001280936.1| uncharacterized protein LOC103402903 [Malus domestica]
 gb|AAF27920.1|AF220204_1 unknown [Malus domestica]
Length=608

 Score =   435 bits (1118),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 238/276 (86%), Gaps = 4/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSEKGE AIWQ+R+D DSC   Q  S+A FC++ + D VWYKKM+ CITP P
Sbjct  337   AKLLCWEKKSEKGETAIWQKRVDSDSCGDRQDDSRANFCKADEADSVWYKKMEGCITPYP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K +  E  K FP+RL A+PPRI++G V GVS E Y +DN KWKKHV+AYKRINK+IDTGR
Sbjct  397   KVSSGE-LKPFPKRLYAVPPRISSGSVPGVSVEDYEEDNNKWKKHVNAYKRINKLIDTGR  455

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA + SPK WVMNV+PTIA+K+TLGV+YERG+IGIYHDWCEGFSTY
Sbjct  456   YRNIMDMNAGLGGFAAAIESPKLWVMNVMPTIAEKNTLGVVYERGLIGIYHDWCEGFSTY  515

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+GVFS+Y  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRW
Sbjct  516   PRTYDLIHAHGVFSMYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRW  575

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D KL+DHEDGPLVPEK+LVAVK+YW     NSTSAQ
Sbjct  576   DTKLVDHEDGPLVPEKVLVAVKQYWV---GNSTSAQ  608



>ref|XP_003628358.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
Length=507

 Score =   431 bits (1109),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 237/277 (86%), Gaps = 2/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AK LCWEKKSEK EIAIWQ+  D +SCR+ Q  S   FC+S DPDDVWYKK+  C+TP+
Sbjct  233   VAKKLCWEKKSEKAEIAIWQKMTDTESCRSRQDDSSVEFCESSDPDDVWYKKLKACVTPT  292

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK +  +  K FP+RL AIPPR+++G + GVS+E Y +DNK WKKHV+AYK+IN ++D+G
Sbjct  293   PKVSGGD-LKPFPDRLYAIPPRVSSGSIPGVSSETYQNDNKMWKKHVNAYKKINSLLDSG  351

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCEGFST
Sbjct  352   RYRNIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFST  411

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMR
Sbjct  412   YPRTYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMR  471

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             W+ KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  472   WNMKLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  507



>ref|XP_008221626.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
 ref|XP_008221627.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=616

 Score =   434 bits (1116),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 206/282 (73%), Positives = 239/282 (85%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSEKGE AIWQ+R++ DSC   +  S ATFC+S + D VWYKKM+ CITP 
Sbjct  336   VAKLLCWEKKSEKGETAIWQKRVNTDSCGDRKDGSHATFCKSDEADAVWYKKMEACITPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P +N  +       + FP+RL A+PPRIA+G V GVS EAY +DN KWKKHV+AY+RINK
Sbjct  396   PDSNNADGAAGGELEPFPKRLYAVPPRIASGSVPGVSVEAYEEDNNKWKKHVNAYRRINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGVIYERG+IGIYHDWC
Sbjct  456   LIDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHA+G+FSLY  KCD+EDIL+EMDRILRPEGAVVFRDEVD LIKV++I
Sbjct  516   EGFSTYPRTYDLIHAHGIFSLYDGKCDWEDILIEMDRILRPEGAVVFRDEVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD K++DHEDGPLVPEK+LVAVK+YW     NSTS Q
Sbjct  576   VGGMRWDTKMVDHEDGPLVPEKVLVAVKQYWVAGG-NSTSTQ  616



>ref|XP_008339908.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=608

 Score =   434 bits (1115),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 206/276 (75%), Positives = 237/276 (86%), Gaps = 4/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSEKGE AIWQ+R+D DSC   Q  S+A FC++ + D VWYKKM+ CITP P
Sbjct  337   AKLLCWEKKSEKGETAIWQKRVDSDSCGDRQDDSRANFCKADEADSVWYKKMEGCITPYP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K +  E  K FP+RL A+PPRI++G V GVS E Y +DN KWKKHV+AYKRINK+IDTGR
Sbjct  397   KVSSGE-LKPFPKRLYAVPPRISSGSVPGVSVEDYEEDNNKWKKHVNAYKRINKLIDTGR  455

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA + SPK WVMNV+PTIA+K+TLGV+YERG+IGIYHDWCEGFSTY
Sbjct  456   YRNIMDMNAGLGGFAAAIESPKLWVMNVMPTIAEKNTLGVVYERGLIGIYHDWCEGFSTY  515

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+GVFS Y  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRW
Sbjct  516   PRTYDLIHAHGVFSXYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRW  575

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D KL+DHEDGPLVPEK+LVAVK+YW     NSTSAQ
Sbjct  576   DTKLVDHEDGPLVPEKVLVAVKQYWV---GNSTSAQ  608



>ref|XP_008389474.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=606

 Score =   433 bits (1114),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/272 (74%), Positives = 237/272 (87%), Gaps = 1/272 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSEKGE AIWQ+R+D DSC   Q  S+A FC++ + D VWYKKM+ CITP P
Sbjct  335   AKLLCWEKKSEKGETAIWQKRVDSDSCGDRQDASRANFCKADEADSVWYKKMEGCITPYP  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             + +  E  K FP+RL A+PPRI++G V GVSAE Y +DNKKWKKHV+AY+RINK+IDTGR
Sbjct  395   EVSSGE-LKPFPKRLYAVPPRISSGSVPGVSAEDYEEDNKKWKKHVNAYRRINKLIDTGR  453

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA + SPK WVMNVVPTIA+K+TLGV+YERG+IGIYHDWCEGFSTY
Sbjct  454   YRNIMDMNAGLGGFAAAIESPKLWVMNVVPTIAEKNTLGVVYERGLIGIYHDWCEGFSTY  513

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+GVFSLY  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRW
Sbjct  514   PRTYDLIHAHGVFSLYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRW  573

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D K++DHEDGPLVPEK+LV VK+YW  N T++
Sbjct  574   DTKMVDHEDGPLVPEKVLVVVKQYWVGNSTDT  605



>ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   433 bits (1113),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/272 (74%), Positives = 237/272 (87%), Gaps = 2/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSE  EIAIWQ+ +D +SCR+ Q++S   FC+S D +DVWYKKM+VC+TPSP
Sbjct  337   AKLLCWEKKSENSEIAIWQKTLDTESCRSRQEESSVKFCESTDANDVWYKKMEVCVTPSP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K + D  +K FPERL AIPPRIA+G V GVS E Y +DNKKWKKHV+AYK+IN+++DTGR
Sbjct  397   KVSGD--YKPFPERLYAIPPRIASGSVPGVSVETYQEDNKKWKKHVNAYKKINRLLDTGR  454

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCEGFSTY
Sbjct  455   YRNIMDMNAGLGSFAAAIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTY  514

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRW
Sbjct  515   PRTYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRW  574

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             + K++DHEDGPLVPEKIL+AVK+YW  N T++
Sbjct  575   NTKMVDHEDGPLVPEKILIAVKQYWVANATST  606



>gb|KHN12213.1| Putative methyltransferase PMT2 [Glycine soja]
Length=585

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/272 (74%), Positives = 237/272 (87%), Gaps = 2/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSE  EIAIWQ+ +D +SCR+ Q++S   FC+S D +DVWYKKM+VC+TPSP
Sbjct  315   AKLLCWEKKSENSEIAIWQKTLDTESCRSRQEESSVKFCESTDANDVWYKKMEVCVTPSP  374

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K + D  +K FPERL AIPPRIA+G V GVS E Y +DNKKWKKHV+AYK+IN+++DTGR
Sbjct  375   KVSGD--YKPFPERLYAIPPRIASGSVPGVSVETYQEDNKKWKKHVNAYKKINRLLDTGR  432

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCEGFSTY
Sbjct  433   YRNIMDMNAGLGSFAADIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTY  492

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRW
Sbjct  493   PRTYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRW  552

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             + K++DHEDGPLVPEKIL+AVK+YW  N T++
Sbjct  553   NTKMVDHEDGPLVPEKILIAVKQYWVANATST  584



>ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=618

 Score =   433 bits (1114),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 237/282 (84%), Gaps = 5/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEKK E+GEIAIWQ+R++  +C   Q  ++ TFC++ + DD WYK M+ CI+P 
Sbjct  337   IARLLCWEKKYEQGEIAIWQKRVNAGACSGRQDDARTTFCKAEETDDTWYKNMEPCISPY  396

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N  E       + FP+RL A+PPR+A+G + GVS E YL+DNK WKKH++AYK+INK
Sbjct  397   PDVNSPEEVSGGELQPFPKRLYAVPPRVASGSIPGVSVETYLEDNKLWKKHLNAYKKINK  456

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLG +YERG+IGIYHDWC
Sbjct  457   IIDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGAVYERGLIGIYHDWC  516

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+GVFSLYKDKCD EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  517   EAFSTYPRTYDLIHAHGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  576

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD KL+DHEDGPLV EKILVAVK+YW ++  NSTS+Q
Sbjct  577   VGGMRWDTKLVDHEDGPLVSEKILVAVKQYWVVSAENSTSSQ  618



>ref|XP_011075499.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=613

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/280 (74%), Positives = 236/280 (84%), Gaps = 6/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSE+GEIA+WQ+ MD  SCRA Q+ S  T C+    DDVWY+KM+ CITP 
Sbjct  337   VAKLLCWEKKSEQGEIAVWQKTMDSASCRAKQENSGVTLCKPDYADDVWYQKMEPCITPY  396

Query  953   PKANIDES---FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKII  783
               AN   +    K FPERL A+PPRIA+GLV GVS EAY  DNK+WKKHV+AY++INKII
Sbjct  397   DNANSGVAGGYLKPFPERLYAVPPRIASGLVPGVSVEAYQKDNKQWKKHVNAYRKINKII  456

Query  782   DTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEG  603
             D+GRYRNIMDMNAG GGFAA L SPK WVMNVVPTIA+K+TLGVIYERG+IGIYHDWCE 
Sbjct  457   DSGRYRNIMDMNAGFGGFAAALQSPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEA  516

Query  602   FSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIG  423
             FSTYPRTYDLIHA  VFSLYKDKCD EDILLEMDRILRPEGA++ RDEVD L+KV+++IG
Sbjct  517   FSTYPRTYDLIHAYRVFSLYKDKCDLEDILLEMDRILRPEGAIMLRDEVDVLVKVKKMIG  576

Query  422   GMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             GMR+D+K+MDHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  577   GMRYDFKMMDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  613



>gb|ACJ85858.1| unknown [Medicago truncatula]
Length=610

 Score =   432 bits (1111),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 237/277 (86%), Gaps = 2/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AK LCWEKKSEK EIAIWQ+  D +SCR+ Q  S   FC+S DPDDVWYKK+  C+TP+
Sbjct  336   VAKKLCWEKKSEKAEIAIWQKMTDTESCRSRQDDSSVEFCESSDPDDVWYKKLKACVTPT  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK +  +  K FP+RL AIPPR+++G + GVS+E Y +DNK WKKHV+AYK+IN ++D+G
Sbjct  396   PKVSGGD-LKPFPDRLYAIPPRVSSGSIPGVSSETYQNDNKMWKKHVNAYKKINSLLDSG  454

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCEGFST
Sbjct  455   RYRNIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFST  514

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMR
Sbjct  515   YPRTYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMR  574

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             W+ KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  575   WNMKLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  610



>ref|XP_003628357.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
 gb|AET02833.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=610

 Score =   432 bits (1111),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/277 (72%), Positives = 237/277 (86%), Gaps = 2/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AK LCWEKKSEK EIAIWQ+  D +SCR+ Q  S   FC+S DPDDVWYKK+  C+TP+
Sbjct  336   VAKKLCWEKKSEKAEIAIWQKMTDTESCRSRQDDSSVEFCESSDPDDVWYKKLKACVTPT  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK +  +  K FP+RL AIPPR+++G + GVS+E Y +DNK WKKHV+AYK+IN ++D+G
Sbjct  396   PKVSGGD-LKPFPDRLYAIPPRVSSGSIPGVSSETYQNDNKMWKKHVNAYKKINSLLDSG  454

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCEGFST
Sbjct  455   RYRNIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFST  514

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMR
Sbjct  515   YPRTYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMR  574

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             W+ KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  575   WNMKLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  610



>ref|XP_006438677.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
 ref|XP_006483161.1| PREDICTED: probable methyltransferase PMT2-like [Citrus sinensis]
 gb|ESR51917.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
Length=610

 Score =   432 bits (1110),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 197/275 (72%), Positives = 240/275 (87%), Gaps = 1/275 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEKKSEKGEIA+WQ++++ +SCRA +  S+A FC+S D DD+WYKKM+ CITP 
Sbjct  337   IANLLCWEKKSEKGEIAVWQKKVNDESCRARRDDSRANFCKSSDADDIWYKKMEGCITPY  396

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+    E  K FPERL AIPPRI++G + GVSAE+Y +D+ KWKKHV+AYK+IN+++D+G
Sbjct  397   PEVAGGE-LKAFPERLYAIPPRISSGSIPGVSAESYQEDSNKWKKHVNAYKKINRLLDSG  455

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAG GGFAA + SPK WVMNVVPTIADK+TLGVIYERG+IGIYHDWCE FST
Sbjct  456   RYRNIMDMNAGFGGFAAAIQSPKLWVMNVVPTIADKNTLGVIYERGLIGIYHDWCEAFST  515

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGA++ RDEVD +IKV++I+GGMR
Sbjct  516   YPRTYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMR  575

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             WD K++DHEDGPLVPEKILVAVK+YW  +  +++S
Sbjct  576   WDTKMVDHEDGPLVPEKILVAVKQYWVASGNSTSS  610



>gb|KHN01216.1| Putative methyltransferase PMT2 [Glycine soja]
Length=504

 Score =   428 bits (1100),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 199/272 (73%), Positives = 234/272 (86%), Gaps = 2/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSE  EIAIWQ+ +D +SCR+ Q+ S   FC+S D +DVWYKKM+VCITPSP
Sbjct  234   AKLLCWEKKSENSEIAIWQKTVDTESCRSRQEDSSVKFCESTDANDVWYKKMEVCITPSP  293

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K   D  +K FPERL AIPPRIA+G V GVS E Y +D+KKWKKHV+AYK+IN+++DTGR
Sbjct  294   KVYGD--YKPFPERLYAIPPRIASGSVPGVSVETYQEDSKKWKKHVNAYKKINRLLDTGR  351

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE FSTY
Sbjct  352   YRNIMDMNAGLGSFAADIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTY  411

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRW
Sbjct  412   PRTYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRW  471

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D K++DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  472   DTKMVDHEDGPLVPEKVLIAVKQYWVANATST  503



>gb|KDO82910.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
 gb|KDO82911.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=506

 Score =   428 bits (1100),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 196/275 (71%), Positives = 239/275 (87%), Gaps = 1/275 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEKKSEKGEIA+WQ++++ +SCRA +  S+A FC+S D DDVWYKKM+ CITP 
Sbjct  233   IANLLCWEKKSEKGEIAVWQKKVNDESCRARRDDSRANFCKSSDADDVWYKKMEGCITPY  292

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+    E  K FPERL AIPPRI++G + GVSAE+Y +D+ KWKKHV+AYK+IN+++D+G
Sbjct  293   PEVAGGE-LKAFPERLYAIPPRISSGSIPGVSAESYQEDSNKWKKHVNAYKKINRLLDSG  351

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAG GGFAA + S K WVMNVVPT+ADK+TLGVIYERG+IGIYHDWCE FST
Sbjct  352   RYRNIMDMNAGFGGFAAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCEAFST  411

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGA++ RDEVD +IKV++I+GGMR
Sbjct  412   YPRTYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMR  471

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             WD K++DHEDGPLVPEKILVAVK+YW  +  +++S
Sbjct  472   WDTKMVDHEDGPLVPEKILVAVKQYWVASGNSTSS  506



>gb|EPS59468.1| hypothetical protein M569_15338, partial [Genlisea aurea]
Length=611

 Score =   431 bits (1108),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 196/272 (72%), Positives = 232/272 (85%), Gaps = 0/272 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK+SE  EIA+WQ+  D  SCRA Q+ S A FC+S D DDVWYKKM+ CITPS
Sbjct  340   IARLLCWEKRSEVNEIAVWQKTTDSASCRAKQENSGARFCESSDADDVWYKKMEQCITPS  399

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
               A+  E  K FPERL ++PPRIA+G + GVS + +++D+K WKKH SAY++I KIIDTG
Sbjct  400   SGADSSEYLKPFPERLHSVPPRIASGSIPGVSTDTFMEDDKLWKKHASAYRKIIKIIDTG  459

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAG GGFAA L SPK WVMNVVPTIA+++TLG IYERG+IGIYHDWCE FST
Sbjct  460   RYRNIMDMNAGFGGFAASLESPKSWVMNVVPTIAEENTLGAIYERGLIGIYHDWCEAFST  519

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHAN V++LYKD+C+FEDILLEMDRILRPEGAVVFRDEVD L+KV+R+IGGMR
Sbjct  520   YPRTYDLIHANRVYTLYKDRCNFEDILLEMDRILRPEGAVVFRDEVDALVKVKRMIGGMR  579

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
             WD K+MDHEDGPL+PEKILVAVK+YW + ++ 
Sbjct  580   WDSKMMDHEDGPLIPEKILVAVKQYWVVGNST  611



>gb|KHG23981.1| hypothetical protein F383_09020 [Gossypium arboreum]
Length=616

 Score =   431 bits (1107),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 238/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK EKGEIAIWQ+R++ ++CR+ Q  S+A FC++ + +DVWYKKMD C+TP 
Sbjct  336   VAKLLCWEKKHEKGEIAIWQKRVNDEACRSRQHNSQANFCKAEEANDVWYKKMDACLTPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  +  E       K FPERL A+PPR+A+G V GVS E Y +DN+KWKKHV AYK+IN+
Sbjct  396   PDVSNPEEVAGGKLKPFPERLYAVPPRVASGSVPGVSVETYQEDNEKWKKHVGAYKKINR  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNI+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVI+ERG+IGIYHDWC
Sbjct  456   LIDSGRYRNILDMNAGLGGFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  516   EAFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRWD K++DHEDGPLVPEKILVAVK+YW +   NSTS Q
Sbjct  576   TAGMRWDTKMVDHEDGPLVPEKILVAVKRYWVVG-ANSTSVQ  616



>ref|XP_007157631.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
 gb|ESW29625.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
Length=607

 Score =   430 bits (1105),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/273 (74%), Positives = 234/273 (86%), Gaps = 2/273 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSEK EIAIWQ+ +D +SCR+ Q+ S   FC+S D +DVWYKKM+VCITP+
Sbjct  336   VAKLLCWEKKSEKSEIAIWQKTVDSESCRSRQEDSSVKFCESTDANDVWYKKMEVCITPT  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK  +    K FPERL AIP RIA G V GVS EAY DDNKKWKKHV+AYK+IN ++D+G
Sbjct  396   PK--VSAHLKPFPERLYAIPSRIAGGSVPGVSVEAYEDDNKKWKKHVNAYKKINPLLDSG  453

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+ GIYHDWCE FST
Sbjct  454   RYRNIMDMNAGLGSFAAAIESAKLWVMNVVPTIAEKSTLGVIYERGLTGIYHDWCEAFST  513

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIH++G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV+++I GMR
Sbjct  514   YPRTYDLIHSHGLFSLYKDKCNEEDILLEMDRILRPEGAVIFRDEVDALIKVKKLIEGMR  573

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             WD K++DHEDGPLVPEKIL+AVK+YW  N T++
Sbjct  574   WDTKMVDHEDGPLVPEKILIAVKQYWVANATST  606



>ref|XP_003613748.1| hypothetical protein MTR_5g040360 [Medicago truncatula]
 gb|AES96706.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=609

 Score =   429 bits (1104),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 239/277 (86%), Gaps = 3/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKKSEK EIA+WQ+ +D ++CR  Q+ S   FC+S D +DVWYKKM+ C+TP+
Sbjct  336   VAKLLCWEKKSEKNEIAVWQKTVDSETCRRRQEDSGVKFCESTDANDVWYKKMEACVTPN  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
              K + D   K FP+RL A+PP+IA+G V GVSAE Y DDNK+WKKHV+AYK+INK++ +G
Sbjct  396   RKVHGD--LKPFPQRLYAVPPKIASGSVPGVSAETYQDDNKRWKKHVNAYKKINKLLGSG  453

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + SPK WVMNVVPTIA+K TLG IY+RG+IGIYHDWCE FST
Sbjct  454   RYRNIMDMNAGLGSFAAAIQSPKLWVMNVVPTIAEKHTLGAIYQRGLIGIYHDWCEAFST  513

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIH+NG+FSLYKDKC+ E+IL+EMDRILRPEGAV+FRDEVD LIKV++I+GGMR
Sbjct  514   YPRTYDLIHSNGLFSLYKDKCNIENILMEMDRILRPEGAVIFRDEVDILIKVKKIVGGMR  573

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             WD KL+DHEDGPLVPEKIL+AVK+YW + DTN+TS Q
Sbjct  574   WDTKLVDHEDGPLVPEKILIAVKQYW-VADTNTTSTQ  609



>ref|XP_009360348.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=606

 Score =   429 bits (1104),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 200/272 (74%), Positives = 236/272 (87%), Gaps = 1/272 (0%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSEKGE AIWQ+R+D DSC   Q  S+A FC++ + D+VWYKKM+ CITP P
Sbjct  335   AKLLCWEKKSEKGETAIWQKRVDFDSCGDRQDASRANFCKADEADNVWYKKMEGCITPYP  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             + +  E  K FP+RL A+PPRI++G V GVS + Y +DNKKWKKHV+AY RINK+IDTGR
Sbjct  395   EVSSGE-LKPFPKRLYAVPPRISSGSVPGVSVKDYEEDNKKWKKHVNAYGRINKLIDTGR  453

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLGGFAA + SPK WVMNVVPTIA+K+TLGV+YERG+IGIYHDWCEGFSTY
Sbjct  454   YRNIMDMNAGLGGFAAAIESPKLWVMNVVPTIAEKNTLGVVYERGLIGIYHDWCEGFSTY  513

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+GVFSLY  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRW
Sbjct  514   PRTYDLIHAHGVFSLYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRW  573

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D K++DHEDGPLVPEK+LV VK+YW  N T++
Sbjct  574   DTKMVDHEDGPLVPEKVLVVVKQYWVGNSTDT  605



>ref|XP_006602298.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=608

 Score =   429 bits (1103),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/277 (73%), Positives = 233/277 (84%), Gaps = 4/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEK+SEK E+AIWQ+ +D +SCR  Q  S   FCQS D DDVWYKKM+ CITP+
Sbjct  336   IAKQLCWEKRSEKAEMAIWQKVVDSESCRRRQDDSSVEFCQSSDADDVWYKKMETCITPT  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK     + K FP RL AIPPRIA+G V GVS+E Y DDNKKWKKHV+AYK+ N+++D+G
Sbjct  396   PKVT-GGNLKPFPSRLYAIPPRIASGSVPGVSSETYQDDNKKWKKHVNAYKKTNRLLDSG  454

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMN+GLG FAA + S   WVMNVVPTIA+ +TLGVIYERG+IGIYHDWCE FST
Sbjct  455   RYRNIMDMNSGLGSFAAAIHSSNLWVMNVVPTIAEMNTLGVIYERGLIGIYHDWCEAFST  514

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+GVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMR
Sbjct  515   YPRTYDLIHAHGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMR  574

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             WD K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  575   WDTKMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  608



>ref|XP_004511207.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511208.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=610

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/277 (71%), Positives = 234/277 (84%), Gaps = 2/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AK LCWEKKSE  EIAIWQ+  + +SCR+ Q  S   FC+S DPDDVWYKKM+ CITP+
Sbjct  336   VAKKLCWEKKSENAEIAIWQKTTNSESCRSRQDDSSVEFCKSSDPDDVWYKKMEACITPT  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK + D   K FP RL AIPPR+++G + GVS+E Y DDNK WKKHV+AYK+IN ++D+G
Sbjct  396   PKVS-DGDLKPFPSRLYAIPPRVSSGSIPGVSSEKYQDDNKTWKKHVNAYKKINSLLDSG  454

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE FST
Sbjct  455   RYRNIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFST  514

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++I GMR
Sbjct  515   YPRTYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKQLISGMR  574

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             W+ KL+DHEDGPLVPEK+L+AVK+YW + D NSTS +
Sbjct  575   WNSKLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTE  610



>ref|XP_003517972.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   428 bits (1100),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/272 (73%), Positives = 234/272 (86%), Gaps = 2/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKKSE  EIAIWQ+ +D +SCR+ Q+ S   FC+S D +DVWYKKM+VCITPSP
Sbjct  337   AKLLCWEKKSENSEIAIWQKTVDTESCRSRQEDSSVKFCESTDANDVWYKKMEVCITPSP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K   D  +K FPERL AIPPRIA+G V GVS E Y +D+KKWKKHV+AYK+IN+++DTGR
Sbjct  397   KVYGD--YKPFPERLYAIPPRIASGSVPGVSVETYQEDSKKWKKHVNAYKKINRLLDTGR  454

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE FSTY
Sbjct  455   YRNIMDMNAGLGSFAADIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTY  514

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRW
Sbjct  515   PRTYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRW  574

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D K++DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  575   DTKMVDHEDGPLVPEKVLIAVKQYWVANATST  606



>gb|KJB60757.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=616

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 238/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK EKGEIAIWQ+R++ +SCR  +  S+A FC++ + +DVWYKKMDVC+TP 
Sbjct  336   VAKLLCWEKKHEKGEIAIWQKRVNDESCRGREDDSQAKFCKAEEANDVWYKKMDVCVTPY  395

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  +          K FPERL A+PPRIA+G V G+S E Y +DN  WKKHV+AYK+IN+
Sbjct  396   PDVSSSGEVAGGELKPFPERLFAVPPRIASGSVPGISVETYEEDNNIWKKHVNAYKKINR  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNI+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  456   LIDSGRYRNILDMNAGLGGFAAALNSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  516   EAFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRWD K++DHEDGPLVPEK+LVAVK+YWT+   N+TSAQ
Sbjct  576   TAGMRWDTKMVDHEDGPLVPEKVLVAVKQYWTVGG-NTTSAQ  616



>gb|KHG10506.1| hypothetical protein F383_11349 [Gossypium arboreum]
Length=616

 Score =   428 bits (1100),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 238/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK EKGE+AIWQ+R++ +SCR  +  S+A FC++ + +DVWYKKMDVC+TP 
Sbjct  336   VAKLLCWEKKHEKGEMAIWQKRVNDESCRGREDDSQAKFCKAEEANDVWYKKMDVCVTPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  +          K FPERL A+PPRIA+G V GVS E Y +DN  WKKHV+AYK+IN+
Sbjct  396   PDVSSSSEVAGGELKPFPERLFAVPPRIASGSVPGVSVETYEEDNNIWKKHVNAYKKINR  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNI+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  456   LIDSGRYRNILDMNAGLGGFAAALNSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  516   EAFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRWD K++DHEDGPLVPEK+LVAVK+YWT+   N+TSAQ
Sbjct  576   TAGMRWDTKMVDHEDGPLVPEKVLVAVKQYWTVGG-NTTSAQ  616



>ref|XP_007046111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY01943.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=616

 Score =   427 bits (1098),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 202/281 (72%), Positives = 233/281 (83%), Gaps = 6/281 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIWQ+R++ DSCR  Q  S+A+FC++G+ +DVWYKKMD CITP P
Sbjct  337   AKLLCWEKKHEKGEIAIWQKRVNDDSCRGRQDDSQASFCKAGEANDVWYKKMDACITPYP  396

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
               N  +       K FPERL A+PPRIA+G V G S E Y +DN KWKKHV AYK+IN++
Sbjct  397   DVNSPDEVAGRELKPFPERLYAVPPRIASGSVPGFSVETYQEDNHKWKKHVKAYKKINRL  456

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             ID+GRYRNI+DMNA LGGFAA L SPK WVMNV+PTIA K TLGVIYERG+IGIYHDWCE
Sbjct  457   IDSGRYRNILDMNAVLGGFAAALDSPKLWVMNVMPTIAQKDTLGVIYERGLIGIYHDWCE  516

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA G+FSLYKD+C+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I 
Sbjct  517   AFSTYPRTYDLIHAYGLFSLYKDRCNVEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIA  576

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GMRWD K++DHEDGPLVPEKILVAVK+YW +   N+TS Q
Sbjct  577   AGMRWDAKMIDHEDGPLVPEKILVAVKQYWVVGG-NTTSTQ  616



>ref|XP_003532062.1| PREDICTED: probable methyltransferase PMT2-like isoformX1 [Glycine 
max]
 ref|XP_003532063.1| PREDICTED: probable methyltransferase PMT2-like isoformX2 [Glycine 
max]
Length=608

 Score =   427 bits (1097),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/276 (73%), Positives = 232/276 (84%), Gaps = 4/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AK LCWEK+SEK E+AIWQ+ +D +SC+  +  S   FC+S D DDVWYKKM+ CITP+P
Sbjct  337   AKQLCWEKRSEKAEMAIWQKVVDSESCQRRKDDSSVEFCESSDADDVWYKKMEACITPTP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             K     + K FP RL AIPPRIA+GLV GVS+E Y DDNKKWKKHV AYK+ N+++D+GR
Sbjct  397   KVT-GGNLKPFPSRLYAIPPRIASGLVPGVSSETYQDDNKKWKKHVKAYKKTNRLLDSGR  455

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA + S K WVMNVVPTIA+ +TLGVIYERG+IGIYHDWCE FSTY
Sbjct  456   YRNIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYHDWCEAFSTY  515

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+GVFSLYKDKC  EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRW
Sbjct  516   PRTYDLIHAHGVFSLYKDKCKAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRW  575

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  576   DTKMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  608



>gb|KHN17371.1| Putative methyltransferase PMT2 [Glycine soja]
Length=608

 Score =   426 bits (1096),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 201/277 (73%), Positives = 232/277 (84%), Gaps = 4/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEK+SEK E+AIWQ+ +D +SCR  Q  S   FCQS D DDVWYKKM+ CITP+
Sbjct  336   IAKQLCWEKRSEKAEMAIWQKVVDSESCRRRQDDSSVEFCQSSDADDVWYKKMETCITPT  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK     + K FP RL AIPPRIA+G V GVS+E Y DDNKKWKKHV+AYK+ N+++D+G
Sbjct  396   PKVT-GGNLKPFPSRLYAIPPRIASGSVPGVSSETYQDDNKKWKKHVNAYKKTNRLLDSG  454

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMN+GLG FAA + S   WVMNVVPTIA+ +TLGVIYERG+IGIYHDWCE FST
Sbjct  455   RYRNIMDMNSGLGSFAAAIHSSNLWVMNVVPTIAEMNTLGVIYERGLIGIYHDWCEAFST  514

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+GVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++ +GGMR
Sbjct  515   YPRTYDLIHAHGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKRVGGMR  574

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             WD K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  575   WDTKMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  608



>ref|XP_010552579.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   426 bits (1096),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 236/282 (84%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEKK E  EIAIWQ+R++ DSCR+ Q   +A FC++ DPDDVWYKKM+ CITP 
Sbjct  335   IANLLCWEKKYEHDEIAIWQKRVNDDSCRSRQDDPRANFCKTDDPDDVWYKKMEGCITPY  394

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  E       K FPERL AIPPRI +G +SGVS EAY +DN++W+KHV  YKR+N 
Sbjct  395   PEVSSPEDVAGGELKVFPERLNAIPPRILSGSISGVSVEAYEEDNRQWRKHVKEYKRLNS  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+TLGVIYERG+IGIYHDWC
Sbjct  455   LLDTGRYRNIMDMNAGFGGFAAAIESRKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             + FSTYPRTYDLIHAN +FSLYKD+C+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  515   QAFSTYPRTYDLIHANHLFSLYKDRCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             IGGMRWD KL+DHEDGPLVPEK+L+AVK+YW +  +NSTSA 
Sbjct  575   IGGMRWDSKLVDHEDGPLVPEKVLIAVKQYW-VTGSNSTSAN  615



>ref|XP_010257294.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=615

 Score =   426 bits (1095),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 201/282 (71%), Positives = 230/282 (82%), Gaps = 5/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEK  EKGEIAIW++ ++ DSC   Q  S A  C+S   DDVWYKKM+ CITP 
Sbjct  334   IAKLLCWEKTHEKGEIAIWRKSLNADSCHGKQDDSHANMCESTSADDVWYKKMEACITPY  393

Query  953   PKANIDESF-----KKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P     +       K FPERL AIPPRIA+G V GV  + YLDDNK W+KHV AYK+INK
Sbjct  394   PDVKSGDEVSGGEVKPFPERLNAIPPRIASGSVPGVFVDTYLDDNKLWRKHVKAYKKINK  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLG FAA L SPK WVMNVVPTI++K+TLGVIYERG+IGIYHDWC
Sbjct  454   IIDSGRYRNIMDMNAGLGSFAAALESPKLWVMNVVPTISEKNTLGVIYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYK+KC  EDILLEMDRILRPEGAV+FRD+VD LIKV++I
Sbjct  514   EAFSTYPRTYDLIHANGVFSLYKNKCKAEDILLEMDRILRPEGAVIFRDDVDVLIKVKKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GG+RW+ K++DHEDGPLVPEKILVAVK+YW +   NSTS++
Sbjct  574   AGGIRWNTKMVDHEDGPLVPEKILVAVKQYWVVGGDNSTSSE  615



>ref|XP_002511570.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52172.1| ATP binding protein, putative [Ricinus communis]
Length=613

 Score =   424 bits (1089),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 198/281 (70%), Positives = 231/281 (82%), Gaps = 7/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK E GEIAIWQ+R++ D CR   ++ K   CQS +PDDVWYKKM+ C+TP 
Sbjct  334   IAKLLCWEKKHEMGEIAIWQKRINSDVCREQDRQPK--MCQSTNPDDVWYKKMEACVTPY  391

Query  953   PKANIDESFKKFP-----ERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
              K N    F   P     ERL A+P RI++G + GVS E +LDDN+ WKKHV+AYKRINK
Sbjct  392   LKTNGPNEFAGAPWLTFRERLNAVPFRISSGSIPGVSVETFLDDNRLWKKHVNAYKRINK  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRN+MDMNAG+GGFAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  452   ILDSGRYRNVMDMNAGMGGFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  511

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEG V+ RD+VD LIKV+RI
Sbjct  512   EAFSTYPRTYDLIHANGVFSLYKDKCNMEDILLEMDRILRPEGTVILRDQVDVLIKVKRI  571

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             +GGMRW+ K++DHEDGPLVPEK+L AVK+YW   D NSTS+
Sbjct  572   VGGMRWNTKMVDHEDGPLVPEKVLFAVKRYWVAGDNNSTSS  612



>ref|XP_002315803.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
 gb|EEF01974.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
Length=617

 Score =   424 bits (1089),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 197/281 (70%), Positives = 234/281 (83%), Gaps = 6/281 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCW+KK E GE+AIWQ+R++ DSCR  Q  S+AT C+S D DD WYK+M+ C+TP P
Sbjct  338   AKLLCWDKKYENGEMAIWQKRLNADSCRGRQDDSRATLCKSTDTDDAWYKQMEACVTPYP  397

Query  950   KANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
              +   +       K FPERL A+PPR+A+G V GVSA+ Y   NK+WKKHV+AYK+INK+
Sbjct  398   DSGSSDEVAGGQLKVFPERLYAVPPRVASGSVPGVSAKTYQVYNKEWKKHVNAYKKINKL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +D+GRYRNIMDMNAG+GGFAA L SPK WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE
Sbjct  458   LDSGRYRNIMDMNAGMGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCE  517

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA+GVFSLYKD+C+ EDILLEMDRILRPEGAV+FRDEV+ LIKVR+++
Sbjct  518   AFSTYPRTYDLIHASGVFSLYKDRCNMEDILLEMDRILRPEGAVIFRDEVNVLIKVRKMV  577

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             G MRW  K++DHEDGPLVPEK+LVAVK+YW     NSTS Q
Sbjct  578   GQMRWHTKMVDHEDGPLVPEKVLVAVKQYWVAGG-NSTSTQ  617



>ref|XP_011015217.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011015218.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   423 bits (1087),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 234/281 (83%), Gaps = 6/281 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCW+KK E GE+AIWQ+R++ DSCR  Q  S+AT C+S D DD WYKKM+ CITP P
Sbjct  338   AKLLCWDKKYENGEMAIWQKRLNADSCRGRQDDSRATLCKSTDTDDAWYKKMEACITPYP  397

Query  950   KANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
              ++  +       K FPERL A+PPR+A+G V GVSA+ Y   NK+WKKHV+AYK+INK+
Sbjct  398   DSSSSDEVAGGQLKVFPERLYAVPPRVASGSVPGVSAKTYQVYNKEWKKHVNAYKKINKL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +D+GRYRNIMDMNAG+GGFAA L SPK WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE
Sbjct  458   LDSGRYRNIMDMNAGMGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCE  517

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA+GVFSLY+D+C+ EDILLEMDRILRPEGAV+FRDEVD LIKVR+++
Sbjct  518   AFSTYPRTYDLIHASGVFSLYQDRCNMEDILLEMDRILRPEGAVIFRDEVDVLIKVRKMV  577

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               MRW  K++DHEDGPLVPEKILVAVK+YW     NSTS Q
Sbjct  578   RQMRWHTKMVDHEDGPLVPEKILVAVKQYWVAGG-NSTSTQ  617



>ref|XP_011021619.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011021621.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   423 bits (1087),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/281 (71%), Positives = 234/281 (83%), Gaps = 6/281 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCW+KK E GE+AIWQ+R++ DSCR  Q  S+AT C+S D DD WYKKM+ CITP P
Sbjct  338   AKLLCWDKKYENGEMAIWQKRLNADSCRGRQDDSRATLCKSTDTDDAWYKKMEACITPYP  397

Query  950   KANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
              ++  +       K FPERL A+PPR+A+G V GVSA+ Y   NK+WKKHV+AYK+INK+
Sbjct  398   DSSSSDEVAGGQLKVFPERLYAVPPRVASGSVPGVSAKTYQVYNKEWKKHVNAYKKINKL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +D+GRYRNIMDMNAG+GGFAA L SPK WVMNVVPTIA+KSTLGVIYERG+IGIYHDWCE
Sbjct  458   LDSGRYRNIMDMNAGMGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCE  517

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHA+GVFSLY+D+C+ EDILLEMDRILRPEGAV+FRDEVD LIKVR+++
Sbjct  518   AFSTYPRTYDLIHASGVFSLYQDRCNMEDILLEMDRILRPEGAVIFRDEVDVLIKVRKMV  577

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               MRW  K++DHEDGPLVPEKILVAVK+YW     NSTS Q
Sbjct  578   RQMRWHTKMVDHEDGPLVPEKILVAVKQYWVAGG-NSTSTQ  617



>emb|CDY50730.1| BnaC05g50930D [Brassica napus]
Length=496

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 233/276 (84%), Gaps = 6/276 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ D+CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  227   AKLLCWEKKYEHGEIAIWQKRVNDDACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  286

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN ++DTGR
Sbjct  287   ET---RELQAFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSLLDTGR  343

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE FSTY
Sbjct  344   YRNIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTY  403

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRW
Sbjct  404   PRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRW  463

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D KL+DHEDGPLV EK+L+AVK+YW    TNSTSAQ
Sbjct  464   DSKLVDHEDGPLVNEKVLIAVKQYWV---TNSTSAQ  496



>ref|XP_006415973.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
 gb|ESQ34326.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
Length=616

 Score =   421 bits (1082),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 195/282 (69%), Positives = 236/282 (84%), Gaps = 8/282 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP 
Sbjct  338   VAKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDTDDVWYKKMEACITPY  397

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN 
Sbjct  398   PETSSSDEVAGGELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINS  457

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWC
Sbjct  458   LLDTGRYRNIMDMNAGFGGFAAALESTKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWC  517

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RI
Sbjct  518   EAFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRI  577

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             I GMRWD KL+DHEDGPLVPEK+L+AVK+YW    TNSTSA 
Sbjct  578   ISGMRWDSKLVDHEDGPLVPEKVLIAVKQYWV---TNSTSAH  616



>ref|XP_010532828.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   421 bits (1082),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 235/282 (83%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK E GEIA+WQ+R++ +SCR+ Q   +A FC++ DPDDVWYKKM+ CITP 
Sbjct  335   IAKLLCWEKKYEHGEIAVWQKRVNDESCRSRQDDPRANFCKTDDPDDVWYKKMEGCITPY  394

Query  953   PK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  +N DE      K FPERL ++PPRI++G + G+S EAY +D+++W+KHV AYKRIN 
Sbjct  395   PMVSNPDEVAGGKLKVFPERLNSVPPRISSGSIPGISVEAYQEDSREWRKHVKAYKRINS  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAG GGFAA + SPK W MNVVPTIA+K+TLGVIYERG+IGIYHDWC
Sbjct  455   LLDTGRYRNIMDMNAGFGGFAAAIESPKLWTMNVVPTIAEKNTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E  STYPRTYDLIHAN +FSLYKDKCD  DIL+EMDRILRPEGAV+ RDEVD L+KV+++
Sbjct  515   EALSTYPRTYDLIHANHLFSLYKDKCDMGDILVEMDRILRPEGAVIIRDEVDVLVKVKKM  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             IGGMRWD KL+DHEDGPLVPEK+L+AVK+YW     NSTSA 
Sbjct  575   IGGMRWDSKLVDHEDGPLVPEKVLIAVKQYWVAGG-NSTSAN  615



>ref|XP_004138921.1| PREDICTED: probable methyltransferase PMT2 [Cucumis sativus]
 ref|XP_011649048.1| PREDICTED: probable methyltransferase PMT2 [Cucumis sativus]
 gb|KGN61383.1| hypothetical protein Csa_2G108610 [Cucumis sativus]
Length=616

 Score =   421 bits (1082),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 230/280 (82%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIWQ+R++ DSC   Q  S+  FC+S   DDVWY+KM+ C+TP 
Sbjct  336   IAKLLCWEKKFEKGEIAIWQKRVNADSCPDRQDDSRDIFCKSPVSDDVWYEKMETCVTPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P     +       K FP RL  +PPRI++G V G+S EAY +DN KWK+HV AYK+INK
Sbjct  396   PSVESSDEVAGGKLKTFPSRLYDVPPRISSGSVPGISVEAYHEDNNKWKRHVKAYKKINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +IDTGRYRNIMDMNAGLG FAA L S K WVMNVVPTIA+K+TLG I+ERG+IGIYHDWC
Sbjct  456   LIDTGRYRNIMDMNAGLGSFAAALESSKLWVMNVVPTIAEKNTLGAIFERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAVVFRDEVD L+KV+++
Sbjct  516   EAFSTYPRTYDLIHAHGLFSLYKDKCNMEDILLEMDRILRPEGAVVFRDEVDVLVKVKKM  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             IGGMRWD K++DHEDGPLVPEK+L+AVK+YW +   NSTS
Sbjct  576   IGGMRWDAKMVDHEDGPLVPEKVLIAVKQYWVVGGNNSTS  615



>ref|XP_008441700.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
 ref|XP_008441701.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
Length=616

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 230/280 (82%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIWQ+R++ DSC   Q  S+  FC+S   DDVWY+KM+ C+TP 
Sbjct  336   IAKLLCWEKKFEKGEIAIWQKRVNTDSCPDRQDDSRDIFCKSPVSDDVWYEKMETCVTPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P     +       K FP RL  +PPRI++G V G+S EAY +DN KWK+HV AYK+INK
Sbjct  396   PTVESSDEVAGGELKTFPSRLYDVPPRISSGSVPGISVEAYHEDNNKWKRHVKAYKKINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +IDTGRYRNIMDMNAGLG FAA L S K WVMNVVPTIA+K+TLG I+ERG+IGIYHDWC
Sbjct  456   LIDTGRYRNIMDMNAGLGSFAAALESSKLWVMNVVPTIAEKNTLGAIFERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD L+KV+++
Sbjct  516   EAFSTYPRTYDLIHAHGLFSLYKDKCNMEDILLEMDRILRPEGAVIFRDEVDVLVKVKKM  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             IGGMRWD K++DHEDGPLVPEK+L+AVK+YW +   NSTS
Sbjct  576   IGGMRWDAKMVDHEDGPLVPEKVLIAVKQYWVVGGNNSTS  615



>emb|CDY16198.1| BnaA09g29320D [Brassica napus]
Length=606

 Score =   419 bits (1078),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 195/276 (71%), Positives = 233/276 (84%), Gaps = 6/276 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ D+CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  337   AKLLCWEKKYEHGEIAIWQKRVNDDACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN ++DTGR
Sbjct  397   ET---RELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSLLDTGR  453

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE FSTY
Sbjct  454   YRNIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTY  513

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRW
Sbjct  514   PRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRW  573

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             D KL+DHEDGPLV EK+L+AVK+YW    TNSTSAQ
Sbjct  574   DSKLVDHEDGPLVNEKVLIAVKQYWV---TNSTSAQ  606



>ref|XP_002893375.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69634.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   419 bits (1078),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 233/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDSDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQAFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCE  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  578

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  579   AGMRWDSKLVDHEDGPLVPEKVLIAVKQYWVTNSTST  615



>ref|XP_006303579.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
 gb|EOA36477.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
Length=616

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 233/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ D+CR+ Q   +A FC+S D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDDACRSRQDDPRANFCKSDDSDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGI+HDWCE
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIFHDWCE  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  578

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GM+WD KL+DHEDGPLVPEK+L+AVK+YW  N T+S
Sbjct  579   AGMKWDSKLVDHEDGPLVPEKVLIAVKQYWVTNSTSS  615



>gb|KJB80180.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
 gb|KJB80181.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
Length=616

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/282 (69%), Positives = 234/282 (83%), Gaps = 6/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK EKGEIA+W++R++ ++C   Q  S+A FC++ + +DVWYKKMD C+TP 
Sbjct  336   VAKLLCWEKKHEKGEIAVWRKRVNDEACSGRQHNSQANFCKAEEANDVWYKKMDACLTPY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  +  E       K FP+RL A+PPR+A+G V  VS E Y  DN+KWKKHV AYK+IN+
Sbjct  396   PDVSNPEEVAGGKLKPFPKRLYAVPPRVASGSVPVVSVETYQGDNEKWKKHVGAYKKINR  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +ID+GRYRNI+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVI+ERG+IGIYHDWC
Sbjct  456   LIDSGRYRNILDMNAGLGGFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  516   EAFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRWD K++DHEDGPLVPEKILVAVK+YW +   NSTS Q
Sbjct  576   TAGMRWDTKMVDHEDGPLVPEKILVAVKRYWVVG-ANSTSVQ  616



>ref|NP_564265.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 ref|NP_849710.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 sp|B9DFI7.2|PMT2_ARATH RecName: Full=Probable methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AAK59830.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AAN18206.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AEE30749.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AEE30751.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
Length=616

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 233/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQAFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCE  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  578

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  579   AGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVTNSTST  615



>dbj|BAH19504.1| AT1G26850 [Arabidopsis thaliana]
Length=616

 Score =   419 bits (1077),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 233/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQAFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCE  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  578

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  579   AGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVTNSTST  615



>ref|XP_009115418.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   419 bits (1076),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 195/281 (69%), Positives = 235/281 (84%), Gaps = 8/281 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ D+CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  337   AKLLCWEKKYEHGEIAIWQKRVNDDACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  396

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  397   ETSSSDEVAGGELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  456

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE
Sbjct  457   LDTGRYRNIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCE  516

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  517   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  576

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GMRWD KL+DHEDGPLV EK+L+AVK+YW    TNSTSAQ
Sbjct  577   SGMRWDSKLVDHEDGPLVNEKVLIAVKQYWV---TNSTSAQ  614



>ref|XP_010460256.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
 ref|XP_010477804.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   418 bits (1075),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 233/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDSDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGI+HDWCE
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIFHDWCE  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  578

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLVPEK+L+AVK+YW  N T+S
Sbjct  579   SGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVTNSTSS  615



>ref|XP_010498988.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   418 bits (1075),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 191/277 (69%), Positives = 233/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDSDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGI+HDWCE
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIFHDWCE  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  578

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLVPEK+L+AVK+YW  N T+S
Sbjct  579   SGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVTNSTSS  615



>emb|CDY45006.1| BnaCnng12360D [Brassica napus]
Length=605

 Score =   416 bits (1069),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 191/272 (70%), Positives = 231/272 (85%), Gaps = 3/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  336   AKLLCWEKKYEHGEIAIWQKRLNDEACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  395

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             + +     + FP+RL ++PPRI++G VSGV+A+AY DDN++WKKHV AYKRIN ++DTGR
Sbjct  396   ETS---ELQVFPDRLNSVPPRISSGSVSGVTADAYEDDNRQWKKHVKAYKRINGLLDTGR  452

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE FSTY
Sbjct  453   YRNIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTY  512

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRW
Sbjct  513   PRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRW  572

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D KL+DHEDGPLV EK+L+AVK+YW  N T S
Sbjct  573   DSKLVDHEDGPLVNEKVLIAVKQYWVTNSTAS  604



>emb|CDY46435.1| BnaA08g19950D [Brassica napus]
Length=603

 Score =   416 bits (1069),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 231/272 (85%), Gaps = 3/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  334   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDVDDVWYKKMEACITPYP  393

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             + +     + FP+RL A+PPRI++G VSGV+A+AY DDN++WKKHV AYKRIN ++DTGR
Sbjct  394   ETS---ELQVFPDRLNAVPPRISSGSVSGVTADAYEDDNRQWKKHVKAYKRINGLLDTGR  450

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE FSTY
Sbjct  451   YRNIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTY  510

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRW
Sbjct  511   PRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRW  570

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D KL+DHEDGPLV EK+L+AVK+YW  N T S
Sbjct  571   DSKLVDHEDGPLVNEKVLIAVKQYWVTNSTAS  602



>emb|CBI15236.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   412 bits (1060),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 196/281 (70%), Positives = 234/281 (83%), Gaps = 7/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIW++R++ DSC  S++ S  TFC++ + +DVWYK+M+ C+TP 
Sbjct  233   IAKLLCWEKKYEKGEIAIWRKRINHDSC--SEQDSHVTFCEATNANDVWYKQMEACVTPY  290

Query  953   PKAN-IDES----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK    DE     +K FPERL A+P RI++G + GVS E + +D+K WKKHV AYKR NK
Sbjct  291   PKTTEADEVAGGVWKPFPERLNAVPFRISSGSIPGVSDETFQEDDKLWKKHVKAYKRTNK  350

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  351   IIDSGRYRNIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  410

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYK+ C  EDILLEMDRILRPEGAV+FRD++D LIKV++I
Sbjct  411   EAFSTYPRTYDLIHANGVFSLYKNSCSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKI  470

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             +GGMRW+ KL+DHEDGPLV EKIL AVK+YW + + NST+A
Sbjct  471   VGGMRWNTKLVDHEDGPLVSEKILFAVKQYWVVGENNSTAA  511



>ref|XP_002317981.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
 gb|EEE96201.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
Length=610

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 233/279 (84%), Gaps = 4/279 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK E GEIAIWQ+R++ D CR  ++  K T C+S +PDDVWYKKM+ C+TP 
Sbjct  334   VAKLLCWEKKHEIGEIAIWQKRINNDFCR--EQDPKPTMCKSTNPDDVWYKKMEACVTPH  391

Query  953   PKAN--IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
             P+ +     +++ F ERL A+P RI++G + G+S E +L+D++ WKKHV+AYKRIN +ID
Sbjct  392   PETDEVTGAAWQPFSERLNAVPSRISSGSIPGLSVETFLEDSRTWKKHVNAYKRINNVID  451

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
             +GRYRNIMDMNAG+GGFAA L SPK WVMNV+PTI ++ TLGVIYERG+IGIYHDWCE F
Sbjct  452   SGRYRNIMDMNAGMGGFAAALESPKLWVMNVMPTINERDTLGVIYERGLIGIYHDWCEAF  511

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD LIKVRRI+GG
Sbjct  512   STYPRTYDLIHANGVFSLYKDKCNMEDILLEMDRILRPEGAVIFRDKVDVLIKVRRIVGG  571

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             MRW+ K++DHEDGPL  EK+L  VK+YW   + NSTS+Q
Sbjct  572   MRWNAKMVDHEDGPLPSEKVLFTVKQYWVAGENNSTSSQ  610



>ref|XP_009110047.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=611

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 232/277 (84%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  334   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDVDDVWYKKMEACITPYP  393

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G VSGV+A+AY DDN++WKKHV AYKRIN +
Sbjct  394   ETSSSDEVAGGELQVFPDRLNAVPPRISSGSVSGVTADAYEDDNRQWKKHVKAYKRINGL  453

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE
Sbjct  454   LDTGRYRNIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCE  513

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  514   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  573

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLV EK+L+AVK+YW  N T S
Sbjct  574   SGMRWDSKLVDHEDGPLVNEKVLIAVKQYWVTNSTAS  610



>emb|CDY40268.1| BnaA07g09320D [Brassica napus]
Length=606

 Score =   414 bits (1063),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 230/272 (85%), Gaps = 3/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ +   +A FC++ D DDVWYKKM+ CITP P
Sbjct  337   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRRDDPRANFCKTDDTDDVWYKKMEACITPYP  396

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN ++DTGR
Sbjct  397   ET---RELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSLLDTGR  453

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE FSTY
Sbjct  454   YRNIMDMNAGFGGFAAAIESTKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTY  513

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRW
Sbjct  514   PRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRW  573

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             D KL+DHEDGPLV EK+L+AVK+YW  N T+S
Sbjct  574   DSKLVDHEDGPLVNEKVLIAVKQYWVTNSTSS  605



>ref|XP_002275852.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
 ref|XP_010663379.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=610

 Score =   413 bits (1062),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 196/281 (70%), Positives = 234/281 (83%), Gaps = 7/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIW++R++ DSC  S++ S  TFC++ + +DVWYK+M+ C+TP 
Sbjct  330   IAKLLCWEKKYEKGEIAIWRKRINHDSC--SEQDSHVTFCEATNANDVWYKQMEACVTPY  387

Query  953   PKAN-IDES----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK    DE     +K FPERL A+P RI++G + GVS E + +D+K WKKHV AYKR NK
Sbjct  388   PKTTEADEVAGGVWKPFPERLNAVPFRISSGSIPGVSDETFQEDDKLWKKHVKAYKRTNK  447

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  448   IIDSGRYRNIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  507

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYK+ C  EDILLEMDRILRPEGAV+FRD++D LIKV++I
Sbjct  508   EAFSTYPRTYDLIHANGVFSLYKNSCSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKI  567

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             +GGMRW+ KL+DHEDGPLV EKIL AVK+YW + + NST+A
Sbjct  568   VGGMRWNTKLVDHEDGPLVSEKILFAVKQYWVVGENNSTAA  608



>ref|XP_009103114.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   412 bits (1058),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/277 (68%), Positives = 231/277 (83%), Gaps = 5/277 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ +   +A FC++ D DDVWYKKM+ CITP P
Sbjct  337   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRRDDPRANFCKTDDTDDVWYKKMEACITPYP  396

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  397   ETSSSDEVAGGELQVFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  456

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWCE
Sbjct  457   LDTGRYRNIMDMNAGFGGFAAAIESTKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCE  516

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  517   AFSTYPRTYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  576

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL DHEDGPLV EK+L+AVK+YW  N T+S
Sbjct  577   SGMRWDSKLADHEDGPLVNEKVLIAVKQYWVTNSTSS  613



>ref|XP_010937120.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Elaeis 
guineensis]
Length=616

 Score =   412 bits (1058),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 225/280 (80%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SE+GEIA+W++R++ DSC   Q + +   C+S + DDVWYKKM+ C+TP 
Sbjct  335   IAELLCWEKVSEEGEIAVWRKRINTDSCPVRQDEPRVKICESTNADDVWYKKMEACVTPF  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N  E       K FP+RL A+PPRI  GLV G S + Y +DNK WKKHV AYK+INK
Sbjct  395   PEVNSPEEVAGGELKTFPDRLNAVPPRITRGLVPGFSVQKYQEDNKLWKKHVKAYKKINK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              +DTGRYRNIMDMNAGLG FAA + SPK WVMNVVPT+A+KSTL V+YERG+IGIYHDWC
Sbjct  455   YLDTGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTVAEKSTLSVVYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FS+YPRTYDLIHANGVFSLYKD+C  EDILLEMDRILRPEGAV+FRD+ D L KV++I
Sbjct  515   EAFSSYPRTYDLIHANGVFSLYKDRCKMEDILLEMDRILRPEGAVMFRDQDDVLAKVKQI  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             + GMRW+ K+ DHEDGPLVPEKILVAVK+YW   D N T+
Sbjct  575   VSGMRWNTKMADHEDGPLVPEKILVAVKQYWVSGDNNRTA  614



>ref|XP_007039581.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY24082.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=612

 Score =   411 bits (1057),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 197/280 (70%), Positives = 230/280 (82%), Gaps = 10/280 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI+Q++++  SC     +  A  C+S D DDVWYKKM+ C+ P 
Sbjct  335   LAERLCWEKKYEKGDIAIFQKKVNDKSCL----RKSANICESRDADDVWYKKMETCVNPF  390

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK +          KK+P RL A+PPRIA GLV GVSAE+Y +DNK WKKHV+AYKRINK
Sbjct  391   PKVSSSSEVAGGELKKYPARLFAVPPRIAKGLVDGVSAESYQEDNKLWKKHVNAYKRINK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPT+A K+TLGVIYERG+IGIYHDWC
Sbjct  451   LIGTARYRNMMDMNAGLGGFAASLESPKSWVMNVVPTVA-KNTLGVIYERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFSLY++KC+FEDILLEMDRILRPEGAV+FRD+VD L KVR+I
Sbjct  510   EGFSTYPRTYDFIHANGVFSLYQNKCNFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
              GGMRW+ K+MDHEDGPLVPEKILVAVK+YW  +  NSTS
Sbjct  570   AGGMRWNTKMMDHEDGPLVPEKILVAVKQYWVGSSGNSTS  609



>gb|AAT38682.2| Methyltransferase family protein, putative [Solanum demissum]
 gb|AAT38802.2| Methyltransferase family protein, putative [Solanum demissum]
Length=666

 Score =   413 bits (1061),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 208/330 (63%), Positives = 237/330 (72%), Gaps = 54/330 (16%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVW------------  987
             AKLLCWEK SEKGE AIWQ+R D  SCR++Q+ S A  C+  DPD VW            
Sbjct  337   AKLLCWEKISEKGETAIWQKRKDSASCRSAQENSAARVCKPSDPDSVWFPLEHVKKVQYV  396

Query  986   ------------------------YKKMDVCITPSPKANIDESFKKFPERLTAIPPRIAN  879
                                     Y KM++CITP+     DES K FPERL A+PPRIAN
Sbjct  397   NLNCLGGRKFTKYAGQSICHNMIRYNKMEMCITPNTGNGGDESLKPFPERLYAVPPRIAN  456

Query  878   GLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQW  699
             GLVSGVS   Y +D+KKWKKHVS YK+INK++DTGRYRNIMDMNAGLGGFAA L SPK W
Sbjct  457   GLVSGVSVAKYQEDSKKWKKHVSPYKKINKLLDTGRYRNIMDMNAGLGGFAAALHSPKFW  516

Query  698   VMNVVPTIADKSTLGVIYERGMI------------------GIYHDWCEGFSTYPRTYDL  573
             VMNV+PTIA+K+TLGVI+ERG+I                   I    CE FSTYPRTYDL
Sbjct  517   VMNVMPTIAEKNTLGVIFERGLIETLISPGSMCFVYMLELRSILPPKCEAFSTYPRTYDL  576

Query  572   IHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDYKLMD  393
             IHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW++KLMD
Sbjct  577   IHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRWNFKLMD  636

Query  392   HEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             HEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  637   HEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  666



>gb|EPS64080.1| hypothetical protein M569_10695, partial [Genlisea aurea]
Length=606

 Score =   411 bits (1056),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/278 (73%), Positives = 228/278 (82%), Gaps = 8/278 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKS-KATFCQSGDPDD-VWYKKMDVCIT  960
             IAKLLCWEK SEK +IA+WQ+     SCRA Q KS  A FC S D DD VWYKKM+ CI+
Sbjct  335   IAKLLCWEKISEKSDIAVWQKS---GSCRAEQDKSGDAEFCSSKDGDDDVWYKKMEPCIS  391

Query  959   PSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
              S  AN   S K FPERL A+PPRIA G VSGVSAEAY DDN++WKKHV AYKRINK ID
Sbjct  392   SSTAAN---SLKPFPERLFAVPPRIAAGSVSGVSAEAYSDDNEQWKKHVDAYKRINKFID  448

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
             T RYRN MDMNAGLGGFAA L SPK WVMNVVPT A+K+TLGVIYERG+IGIYHDWCE F
Sbjct  449   TVRYRNFMDMNAGLGGFAAALQSPKIWVMNVVPTAAEKNTLGVIYERGLIGIYHDWCEAF  508

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYD IHA+GVFSLYKDKC+FED+LLEMDRILRPEGAVVFRDEVD L+KV+++  G
Sbjct  509   STYPRTYDFIHASGVFSLYKDKCEFEDVLLEMDRILRPEGAVVFRDEVDVLVKVKKMTEG  568

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             MRWD KL+DHEDGPLV +KIL AVK+YW     +S+S+
Sbjct  569   MRWDSKLIDHEDGPLVSQKILFAVKQYWVAAGNSSSSS  606



>ref|XP_007153607.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 ref|XP_007153608.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25601.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25602.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
Length=610

 Score =   410 bits (1055),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 200/277 (72%), Positives = 234/277 (84%), Gaps = 2/277 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCW K+SEK E+AIWQ+ +D +SC+  Q      FC+S D DDVWYKKM+ CITPS
Sbjct  336   IAKKLCWVKRSEKSEMAIWQKVVDSESCQRRQDDDSVEFCKSSDGDDVWYKKMETCITPS  395

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK +  E  K FP RL AIPPRIA+G VSGVS+E Y DDNKKWKKHV+AYK+IN+++D+G
Sbjct  396   PKVS-GEKLKPFPSRLYAIPPRIASGSVSGVSSETYQDDNKKWKKHVNAYKKINRLLDSG  454

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + S K WVMNVVPTIA+ +TLGVIYERG+IGIYHDWCE FST
Sbjct  455   RYRNIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAETNTLGVIYERGLIGIYHDWCEAFST  514

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMR
Sbjct  515   YPRTYDLIHAPGLFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMR  574

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             WD K++DHEDGPLVPEK+L+AVK+YW +   NST+ Q
Sbjct  575   WDTKMVDHEDGPLVPEKVLIAVKQYW-VTGGNSTATQ  610



>ref|XP_008373610.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=325

 Score =   400 bits (1028),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 223/280 (80%), Gaps = 9/280 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCW+KK EKG++AIW+++++  SCR    +     CQ+ D  DVWYKKMD C+TP
Sbjct  48    ALAESLCWDKKYEKGDMAIWKKKVNTKSCR----RKSIDLCQTQDAXDVWYKKMDTCVTP  103

Query  956   SPKANIDESFK----KFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             SP+            KFP RL A+PPRIANGLV GV+ E+Y +DNK WKKHV+ YKRIN 
Sbjct  104   SPEVTNSNEVAVGELKFPARLYAVPPRIANGLVVGVTTESYQEDNKLWKKHVNVYKRING  163

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  164   LIGTTRYRNVMDMNAGLGGFAAALESRKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  222

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPR+YDLIHA+GVF+LYK++C  EDILLEMDRILRPEG V+FRDEVD L KVR+I
Sbjct  223   EGFSTYPRSYDLIHASGVFTLYKNECKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKI  282

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             +GGMRWD K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  283   VGGMRWDTKIMDHEDGPLVPEKILVVVKQYWVAGSGNSTS  322



>ref|XP_009782774.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782775.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782776.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=617

 Score =   409 bits (1051),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 231/282 (82%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEKK EKGEIAIW++R++ + CR  ++ S+ T C+S + ++VWYKKM+ C+TP 
Sbjct  338   IAELLCWEKKHEKGEIAIWRKRVNNEYCR--ERDSRVTLCESSNAENVWYKKMEACVTPY  395

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      K FP+RL  +PPRIA+G V G+S E++ +DNK WKKHV++YKR+NK
Sbjct  396   PQTTNSDEVAGGELKPFPQRLNTVPPRIASGFVPGLSVESFQEDNKLWKKHVNSYKRVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRNI+DMNAGLG FAA L SPK WVMNVVP IA++ TLGVIYERG+IGIYHDWC
Sbjct  456   IVDSGRYRNILDMNAGLGSFAAALESPKLWVMNVVPNIAEQDTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIH NGVFSLYKDKC+ EDILLEMDRILRPEGAV+ RD VD L +V+RI
Sbjct  516   EAFSTYPRTYDLIHGNGVFSLYKDKCNAEDILLEMDRILRPEGAVILRDHVDVLTQVKRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRW+ K++DHEDGPL+PEK+L AVKKYW + D  ST ++
Sbjct  576   ASGMRWNIKMVDHEDGPLIPEKVLFAVKKYWVVGDNKSTVSE  617



>ref|XP_009591906.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009591908.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=617

 Score =   408 bits (1049),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 231/282 (82%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEKK EKGEIAIW++R++ + CR  ++ S+ T C+S + ++VWYKKM+ C+TP 
Sbjct  338   IAELLCWEKKHEKGEIAIWRKRVNNEYCR--ERDSRVTLCESSNAENVWYKKMEACVTPY  395

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      K FP+RL  +PPRIA+G V G+S E++ +DNK WKKHV++YKR+NK
Sbjct  396   PQTTNSDEVAGGELKPFPQRLNTVPPRIASGSVPGLSVESFQEDNKLWKKHVNSYKRVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRNI+DMNAGLG FAA L SPK WVMNVVP IA++ TLGVIYE+G+IGIYHDWC
Sbjct  456   ILDSGRYRNILDMNAGLGSFAAALESPKLWVMNVVPNIAEQDTLGVIYEQGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+ RD VD L +V+RI
Sbjct  516   EAFSTYPRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVILRDHVDVLTQVKRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRW+ K++DHEDGPL+PEK+L  VKKYW   D NST ++
Sbjct  576   ASGMRWNIKMVDHEDGPLIPEKVLFGVKKYWVAGDNNSTVSE  617



>ref|XP_012089660.1| PREDICTED: probable methyltransferase PMT14 [Jatropha curcas]
 gb|KDP22915.1| hypothetical protein JCGZ_01776 [Jatropha curcas]
Length=612

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 230/281 (82%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW++R++  +C    ++   + C+S D DDVWYK+M+ CITP 
Sbjct  335   IAESLCWEKKYEKGDIAIWRKRVNDKNC----QRKFTSICKSNDADDVWYKEMETCITPF  390

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N          KKFPERL A+PPRIANGLV GV+ E+Y +DN+ WKKHV  YKRIN+
Sbjct  391   PEVNNAKEVAGGELKKFPERLFAVPPRIANGLVDGVTTESYQEDNQLWKKHVKEYKRINR  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPT+A K+TLGVIYERG++GIYHDWC
Sbjct  451   LIGTTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTVA-KNTLGVIYERGLVGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLY+++C FEDILLEMDRILRPEG+V+FRD VD L +V++I
Sbjct  510   EGFSTYPRTYDLIHANGVFSLYQNRCKFEDILLEMDRILRPEGSVIFRDGVDVLNEVKKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
              GGMRWD KLMDHEDGPLVPEKILVAVK+YW     NSTS+
Sbjct  570   AGGMRWDIKLMDHEDGPLVPEKILVAVKQYWVGGAGNSTSS  610



>ref|XP_010937119.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 225/281 (80%), Gaps = 6/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SE+GEIA+W++R++ DSC   Q + +   C+S + DDVWYKKM+ C+TP 
Sbjct  335   IAELLCWEKVSEEGEIAVWRKRINTDSCPVRQDEPRVKICESTNADDVWYKKMEACVTPF  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N  E       K FP+RL A+PPRI  GLV G S + Y +DNK WKKHV AYK+INK
Sbjct  395   PEVNSPEEVAGGELKTFPDRLNAVPPRITRGLVPGFSVQKYQEDNKLWKKHVKAYKKINK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              +DTGRYRNIMDMNAGLG FAA + SPK WVMNVVPT+A+KSTL V+YERG+IGIYHDWC
Sbjct  455   YLDTGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTVAEKSTLSVVYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKD-KCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             E FS+YPRTYDLIHANGVFSLYKD +C  EDILLEMDRILRPEGAV+FRD+ D L KV++
Sbjct  515   EAFSSYPRTYDLIHANGVFSLYKDSRCKMEDILLEMDRILRPEGAVMFRDQDDVLAKVKQ  574

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             I+ GMRW+ K+ DHEDGPLVPEKILVAVK+YW   D N T+
Sbjct  575   IVSGMRWNTKMADHEDGPLVPEKILVAVKQYWVSGDNNRTA  615



>ref|XP_007210880.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
 gb|EMJ12079.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
Length=612

 Score =   407 bits (1046),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/280 (70%), Positives = 228/280 (81%), Gaps = 9/280 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCWEKK EKG++AIW+++++  SC    K      CQ+ D DDVWYKKMD C+TP
Sbjct  335   ALAESLCWEKKYEKGDMAIWKKKVNTKSC----KSKSVNVCQTEDADDVWYKKMDTCVTP  390

Query  956   SPK-ANIDE---SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             SP+  N +E      KFP RL A+PPRIANGLV GV+ E+Y +DNK WKKHV+ YKRIN 
Sbjct  391   SPEVTNANEVAVGALKFPARLYAVPPRIANGLVDGVTTESYQEDNKLWKKHVNTYKRINN  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  451   LIGTTRYRNVMDMNAGLGGFAAALESRKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPR+YDLIHA+GVFSLYK++C+ EDILLEMDR+LRPEGAV+FRDEVD L KVR+I
Sbjct  510   EGFSTYPRSYDLIHASGVFSLYKNECNLEDILLEMDRMLRPEGAVIFRDEVDVLNKVRKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             +GGMRWD K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  570   VGGMRWDAKIMDHEDGPLVPEKILVVVKQYWVAGSRNSTS  609



>ref|XP_012080258.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Jatropha 
curcas]
 gb|KDP31241.1| hypothetical protein JCGZ_11617 [Jatropha curcas]
Length=613

 Score =   407 bits (1045),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 228/281 (81%), Gaps = 7/281 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP--  957
             AKLLCWEKK E GEIAIWQ+R++ DSCR      + T CQ  + DDVWYKKM+ C+TP  
Sbjct  335   AKLLCWEKKHEIGEIAIWQKRINYDSCR--DLNPQPTMCQPTNTDDVWYKKMETCVTPYL  392

Query  956   ---SPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
                 P       ++ FPERL A+P RI++G + GVS EAYL+D +  KKHV+AYKRINKI
Sbjct  393   ETHEPNEVAGAPWRPFPERLNAVPFRISSGSIPGVSIEAYLEDFRLCKKHVNAYKRINKI  452

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +D+GRYRNIMDMNAG+GGFAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWCE
Sbjct  453   LDSGRYRNIMDMNAGMGGFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCE  512

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHAN +FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+ D LIKV+RI+
Sbjct  513   AFSTYPRTYDLIHANALFSLYKDKCNMEDILLEMDRILRPEGAVIFRDQEDILIKVKRIV  572

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             GGMRW+ K++DHEDGPLVPEK++ AVK+YW   + N T++Q
Sbjct  573   GGMRWNTKMVDHEDGPLVPEKVMFAVKQYWVAGEYNRTTSQ  613



>ref|XP_010551537.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Tarenaya 
hassleriana]
Length=618

 Score =   407 bits (1045),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/283 (68%), Positives = 232/283 (82%), Gaps = 9/283 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIA+WQ+R++ +SCR+ Q  S+A FC+S DP+DVWYKKM+ CITP P
Sbjct  338   AKLLCWEKKYEHGEIAVWQKRVNDESCRSRQDDSRANFCKSDDPNDVWYKKMEGCITPYP  397

Query  950   KANIDESFKK-----FPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  E         FPERL AIPPRI++G + G+S E Y ++N++W+KHV AYKRIN +
Sbjct  398   EVSSPEEVAGGELMVFPERLNAIPPRISSGSIPGISVEDYEEENRQWRKHVKAYKRINGL  457

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPT--IADKSTLGVIYERGMIGIYHDW  612
             +DTGRYRNIMDMNAG GGFAA + SPK WVMNVVPT  I +K+ LGVI+ERG++GIYHDW
Sbjct  458   LDTGRYRNIMDMNAGFGGFAAAIESPKLWVMNVVPTTKIPEKNMLGVIFERGLVGIYHDW  517

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CE FSTYPRTYDLIH+N +FSLYK+KC  EDILLEMDRILRPEGAV+FRDEVDTLIKV +
Sbjct  518   CEAFSTYPRTYDLIHSNHLFSLYKNKCKPEDILLEMDRILRPEGAVIFRDEVDTLIKV-K  576

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             II GMRW+ KL+DHEDGPLVPEK+L+AVK+YW     NSTSA 
Sbjct  577   IIAGMRWESKLVDHEDGPLVPEKVLIAVKQYWVAGG-NSTSAN  618



>ref|XP_006476610.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476611.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Citrus 
sinensis]
Length=613

 Score =   406 bits (1044),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 230/279 (82%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGE AIWQ+R++ D C+  ++ ++ T C+S D +DVWYKKM+ C+TP 
Sbjct  336   IAKLLCWEKKHEKGETAIWQKRINYDYCQ--EQDTQPTMCESTDAEDVWYKKMEACVTPY  393

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+       +  ++K FPERL A+P RI++G + G+  EAY +DN+ W+KHV++YKRINK
Sbjct  394   PETTGPDKVVGGTWKSFPERLNAVPFRISSGSIKGIGVEAYQEDNRSWRKHVNSYKRINK  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRNIMDMNAGLG FAA + SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  454   ILDSGRYRNIMDMNAGLGSFAAAIESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVF+LYKDKC+ EDILLEMDRILRPEGAV+ RD+ D L+KVR+I
Sbjct  514   EAFSTYPRTYDLIHANGVFTLYKDKCNAEDILLEMDRILRPEGAVIIRDQADVLVKVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             +GGMRW+ K++DHEDGPLV EKIL AVK+YW   +  S+
Sbjct  574   VGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTENVTSS  612



>ref|XP_008781841.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=616

 Score =   406 bits (1043),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 224/282 (79%), Gaps = 5/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SEKGEIAIWQ+R++ DSC   Q +S    C+S + DDVWYKKM+ CI   
Sbjct  335   IAELLCWEKISEKGEIAIWQKRINADSCPGRQDESHVNMCESTNADDVWYKKMEACINRY  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N  E       + FP+RL +IPPRI++G V G SAE+Y  DNK W+KHV AYK++NK
Sbjct  395   PEVNSPEEVAGGELRPFPDRLNSIPPRISSGSVPGFSAESYQKDNKLWQKHVKAYKKVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +++TGRYRNIMDMNAGLG FAA + SPK WVMNVVPTIA+ STLGVIYERG+IGIYHDWC
Sbjct  455   LLNTGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTIAELSTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+GVFSLY++KC  EDILLEMDRILRPEGA++FRD+VD LIKV+R+
Sbjct  515   EAFSTYPRTYDLIHASGVFSLYQNKCKMEDILLEMDRILRPEGAIIFRDDVDVLIKVKRM  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRW  K+ DHEDGPLV EKIL AVK+YW     N T  Q
Sbjct  575   VSGMRWSTKMADHEDGPLVSEKILFAVKQYWVGGSKNKTREQ  616



>ref|XP_011013091.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=610

 Score =   405 bits (1041),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/279 (67%), Positives = 229/279 (82%), Gaps = 4/279 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEKK E GEIAIWQ+R++ D CR  ++  K T C+S +PDDVWYKKM+ C+TP 
Sbjct  334   VAKLLCWEKKHEIGEIAIWQKRINNDFCR--EQDPKPTMCKSTNPDDVWYKKMEACVTPH  391

Query  953   PKAN--IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
             P+ +     +++ F ERL A+P RI +G + G+S E +L D++ WKKHV+AYKRIN +ID
Sbjct  392   PETDEVTGAAWQPFSERLNAVPSRITSGSIPGLSDEIFLGDSRTWKKHVNAYKRINSVID  451

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
             +GRYRNIMDMNAG+GGFA  L SPK WVMNV+PTI ++ TLGVIYERG+IGIYHDWCE F
Sbjct  452   SGRYRNIMDMNAGMGGFAVALESPKLWVMNVMPTINERDTLGVIYERGLIGIYHDWCEAF  511

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD LIKVRRI+ G
Sbjct  512   STYPRTYDLIHANGVFSLYKDKCNMEDILLEMDRILRPEGAVIFRDKVDVLIKVRRIVRG  571

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             MRW+ K++DHEDGPL+ EK+L  VK YW   + NSTS++
Sbjct  572   MRWNAKMVDHEDGPLLSEKVLFTVKLYWVAGENNSTSSR  610



>ref|XP_006439600.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
 gb|ESR52840.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
Length=613

 Score =   405 bits (1040),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 229/279 (82%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGE AIWQ+R++ D C+  ++ ++ T C+S D +DVWYKKM+ C+TP 
Sbjct  336   IAKLLCWEKKHEKGETAIWQKRINYDYCQ--EQDTQPTMCESTDAEDVWYKKMEACVTPY  393

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+       +  ++K FPERL A+P RI++G + G+  EAY +DN+ WKKHV++YKRINK
Sbjct  394   PETTGPDKVVGGTWKSFPERLNAVPFRISSGSIKGIGVEAYQEDNRSWKKHVNSYKRINK  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRNIMDMNAGLG FAA + SPK WVMNV+P IA+K TLGVIYERG+IGIYHDWC
Sbjct  454   ILDSGRYRNIMDMNAGLGSFAAAIESPKLWVMNVMPNIAEKDTLGVIYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVF+LYKDKC+ EDILLEMDRILRPEGAV+ RD+ D L+KVR+I
Sbjct  514   EAFSTYPRTYDLIHANGVFTLYKDKCNAEDILLEMDRILRPEGAVIIRDQADVLVKVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             +GGMRW+ K++DHEDGPLV EKIL AVK+YW   +  S+
Sbjct  574   VGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTENVTSS  612



>ref|XP_009393700.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=616

 Score =   404 bits (1039),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/279 (68%), Positives = 223/279 (80%), Gaps = 5/279 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SEK EIAIW++R++ DSC   Q + +   C+S   DDVWYKKM+ CI P 
Sbjct  335   IAELLCWEKVSEKSEIAIWRKRINSDSCAVRQDEPRVRTCESSYADDVWYKKMEACIVPF  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  E       K FP+RL  +PPRIA+G V G S E+Y +DN+ WKKHV AYKR+NK
Sbjct  395   PEVDNPEEVAGGELKTFPDRLNDVPPRIASGSVPGFSVESYQEDNRLWKKHVKAYKRLNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              IDTGRYRNIMDMNAGLG F+A + SPK WVMNVVPTIADKSTLGVIYERG+IGIYHDWC
Sbjct  455   YIDTGRYRNIMDMNAGLGSFSAAIESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY  KC  EDILLEMDRILRPEGAV+FRD+VD L+KV+R+
Sbjct  515   EGFSTYPRTYDLIHANAVFSLYNKKCKMEDILLEMDRILRPEGAVIFRDQVDILMKVKRM  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             + GMRW+ K++DHEDGPL+ EK+LVAVK+YW    TN T
Sbjct  575   VTGMRWNTKMVDHEDGPLLQEKVLVAVKQYWAGGHTNET  613



>ref|XP_008229546.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229547.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229548.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
Length=612

 Score =   404 bits (1038),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 226/280 (81%), Gaps = 9/280 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCWEKK EKG++AIW+++++  SC    K      CQ+ D DDVWYKKMD C+TP
Sbjct  335   ALAESLCWEKKYEKGDMAIWKKKVNTKSC----KSKSVNVCQTEDADDVWYKKMDTCVTP  390

Query  956   SPKA----NIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             SP+     ++     KFP RL A+PPRIANGLV GV+ E+Y +DNK WKKHV+ YKRIN 
Sbjct  391   SPEVTNANDVAVGALKFPARLYAVPPRIANGLVDGVTTESYQEDNKLWKKHVNTYKRINN  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  451   LIGTTRYRNVMDMNAGLGGFAAALESRKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPR+YDLIHA+GVFSLYK++C+ EDILLEMDRILRPEG V+FRDEVD L KVR+I
Sbjct  510   EGFSTYPRSYDLIHASGVFSLYKNECNLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             +GGMRWD K++DHEDGPLVPEKILV VK+YW     NSTS
Sbjct  570   VGGMRWDAKIVDHEDGPLVPEKILVVVKQYWVAGSGNSTS  609



>ref|XP_007210881.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
 gb|EMJ12080.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
Length=611

 Score =   404 bits (1038),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/282 (67%), Positives = 230/282 (82%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLL WEKK EKGEIAIW+++   D  R   +  + T C+S + DDVWYKKM++CITP 
Sbjct  332   MAKLLNWEKKHEKGEIAIWRKQTSFDYGR--DRNPQPTLCESTNADDVWYKKMELCITPY  389

Query  953   PKA-----NIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+      +   ++K FPERL A+P RI++G + GVSAE Y +DN+ WKKHV+AYKR NK
Sbjct  390   PETSDPNEDAGGAWKPFPERLNALPFRISSGSIPGVSAETYQEDNRSWKKHVNAYKRTNK  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ERG+IGIYHDWC
Sbjct  450   LLDTGRYRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKCD EDILLEMDRILRPEGAV+FRD +D L+KV +I
Sbjct  510   EAFSTYPRTYDLIHANGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRW+ K++DHEDGPLVPEK+L AVK+YW   + NSTS++
Sbjct  570   VRGMRWNTKMVDHEDGPLVPEKVLFAVKRYWVAGEDNSTSSE  611



>ref|XP_009380165.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   403 bits (1036),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 224/277 (81%), Gaps = 5/277 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SEK EIAIW++R++ + C   Q +++   C+S +PDDVWYKKM+ CI   
Sbjct  336   IAELLCWEKVSEKAEIAIWRKRINAELCPRRQDETRINICESANPDDVWYKKMEPCINQY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N  E       K FPERL AIPPRI +G V  +S  +Y +D K+W+KHV AYK+INK
Sbjct  396   PEVNSPEESAGGELKPFPERLNAIPPRITSGSVPDISVNSYQEDIKQWQKHVKAYKKINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA + SPK WVMNVVPTIAD STLGVIYERG+IGIYHDWC
Sbjct  456   LLDTGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTIADISTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLY++KC  EDILLEMDRILRPEGAV+FRD+VD L++V++ 
Sbjct  516   EAFSTYPRTYDLIHANGVFSLYQNKCKMEDILLEMDRILRPEGAVIFRDDVDVLLRVKKT  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
             + GMRWD KL+DHEDGPL+PEKILVAVK+YW    T+
Sbjct  576   VSGMRWDTKLVDHEDGPLIPEKILVAVKQYWVGGSTS  612



>ref|XP_006385609.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
 gb|ERP63406.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
Length=612

 Score =   403 bits (1035),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 193/281 (69%), Positives = 227/281 (81%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI++++ +  +CR    +  A  C+S D DDVWYK+M+ C TP 
Sbjct  335   LAESLCWEKKYEKGDIAIFRKKANNKNCR----RKSANICESKDADDVWYKEMEACKTPL  390

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N          KKFPERL AIPPR+A GLV GV+AE++ +DNK WKKH++AYKR NK
Sbjct  391   PEVNSANEVAGGELKKFPERLFAIPPRVAKGLVKGVTAESFQEDNKLWKKHINAYKRNNK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIYERG++GIYHDWC
Sbjct  451   LIGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I
Sbjct  510   EGFSTYPRTYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
              GGMRWD K+MDHEDGPLVPEKILV VK+YW     NSTS+
Sbjct  570   AGGMRWDTKMMDHEDGPLVPEKILVVVKQYWVGGTGNSTSS  610



>ref|XP_010527898.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/278 (68%), Positives = 228/278 (82%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK+LCWEKK EKGEIA+WQ+R++  SCR  ++  K  FC+  + DDVWYK+M+ CITP 
Sbjct  337   IAKILCWEKKYEKGEIAVWQKRVNDKSCRQRKENPKTKFCKPEEADDVWYKRMEKCITPY  396

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  +         FPERL  +PPRI +G + GVS  AY +DN+ W+KHV+AYK+IN+
Sbjct  397   PEGDSKDEVAGGKLPVFPERLYTVPPRIGSGSIPGVSVAAYEEDNRVWRKHVNAYKKINR  456

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +IDTGRYRNIMDMNAGLGGFAA L S K WVMNV+PTIA K+TLGVIYERG+IG+YHDWC
Sbjct  457   LIDTGRYRNIMDMNAGLGGFAAALESAKLWVMNVMPTIAPKNTLGVIYERGLIGVYHDWC  516

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHAN VFSLYK+KC+ EDILLEMDRILRPEGAV+FRD+V+ LIKV++I
Sbjct  517   EAFSTYPRTYDLIHANRVFSLYKNKCNPEDILLEMDRILRPEGAVIFRDQVEVLIKVKKI  576

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             +  MRWD KL+DHEDGPLV EKILVAVK+YW +N T+S
Sbjct  577   VRRMRWDSKLVDHEDGPLVSEKILVAVKQYWVVNSTSS  614



>ref|XP_010091504.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB44674.1| putative methyltransferase PMT2 [Morus notabilis]
Length=613

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/283 (67%), Positives = 228/283 (81%), Gaps = 9/283 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEKK EKGEIAIW++R + + CR   +  + T C++ + D VWYKKM+ C+TP 
Sbjct  334   IANLLCWEKKHEKGEIAIWRKRENYEQCR--NQDPQPTMCETTESDSVWYKKMEGCVTPY  391

Query  953   PKANID------ESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
             P   ID       + K FPERL ++P RI++G + GVSA+ Y DDN+ WKKHV+AY+RIN
Sbjct  392   PDT-IDWDNVAGGTLKPFPERLNSVPFRISSGSIPGVSAKTYHDDNRLWKKHVNAYRRIN  450

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             K+IDTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGV+YERG+IG+YHDW
Sbjct  451   KLIDTGRYRNIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVVYERGLIGVYHDW  510

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CE FSTYPRTYDLIHANGVFSLYKDKCD  DILLEMDRILRPEGAV+FRD+ D LI+VRR
Sbjct  511   CEAFSTYPRTYDLIHANGVFSLYKDKCDPVDILLEMDRILRPEGAVIFRDQEDVLIRVRR  570

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             I+ GMRW+ K++DHEDGPLVPEK+L AVKKYW   + NS S+ 
Sbjct  571   IVRGMRWNTKIVDHEDGPLVPEKVLFAVKKYWVAGENNSPSSN  613



>ref|XP_006354784.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=615

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/279 (67%), Positives = 229/279 (82%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+LLCWEKK EKGEIAIW++R++ + CR  ++ S+ T C+S +  +VWYKKM+ C+TP 
Sbjct  338   MAELLCWEKKHEKGEIAIWRKRVNNEYCR--ERDSRVTLCESSNAANVWYKKMEACVTPY  395

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      K FP+RL  +PPRIA+G V G+S +++ +DNK WKKHV++YKR+NK
Sbjct  396   PETTNSDEVAGGGLKPFPDRLNTVPPRIASGSVPGLSVDSFKEDNKLWKKHVNSYKRVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D+GRYRNIMDMNAGLG FAA L SPK WVMNVVPTIA++ TLGV+YERG+IGIYHDWC
Sbjct  456   ILDSGRYRNIMDMNAGLGSFAAALESPKLWVMNVVPTIAEQDTLGVVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHAN VFSLYKDKC  EDILLEMDRILRPEGAV+ RD VD L +V+RI
Sbjct  516   EAFSTYPRTYDLIHANRVFSLYKDKCSAEDILLEMDRILRPEGAVILRDHVDVLTQVKRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
               GMRW+ K++DHEDGPL+PEK+L AV+KYW + D NST
Sbjct  576   ATGMRWNIKMVDHEDGPLIPEKVLFAVRKYWVVGDNNST  614



>ref|XP_004241578.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=615

 Score =   402 bits (1033),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 225/279 (81%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+LLCWEKK EKGE AIW++R++ + CR  +  S+ T C+S +  +VWYKKM+ CITP 
Sbjct  338   MAELLCWEKKHEKGETAIWRKRVNNEYCR--EHDSRVTLCESSNAANVWYKKMEACITPY  395

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      + FP+RL  +PPRIA+G V G S EA+ +DNK WKKHV++YKR+NK
Sbjct  396   PETTNSDEVAGGGLQPFPDRLNTVPPRIASGSVPGFSVEAFKEDNKLWKKHVNSYKRVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             I+D GRYRNIMDMNAGLG FAA L SPK WVMNVVPTIA+K TLGV+YERG+IGIYHDWC
Sbjct  456   ILDNGRYRNIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKDTLGVVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHAN VFSLYKDKC  EDILLEMDRILRPEGAV+ RD VD L +V+RI
Sbjct  516   EAFSTYPRTYDLIHANRVFSLYKDKCSVEDILLEMDRILRPEGAVILRDHVDVLTQVKRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
               GMRW+ K++DHEDGPL+PEK+L AV+KYW + D NST
Sbjct  576   ATGMRWNIKMVDHEDGPLIPEKVLFAVRKYWVVGDNNST  614



>ref|XP_006827213.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622152.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622157.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622159.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 ref|XP_011622161.1| PREDICTED: probable methyltransferase PMT2 [Amborella trichopoda]
 gb|ERM94450.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
Length=614

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/276 (67%), Positives = 230/276 (83%), Gaps = 6/276 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK S+ G+IA+W++R++ +SC   + +++ + C+S  PDDVWYKKM+ CITP 
Sbjct  336   IAALLCWEKVSQNGDIAVWRKRVNSESC-PGRDEARVSLCESPKPDDVWYKKMETCITPY  394

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N  +     + +KFP+RL A+PPRIA+G V GV+ E+Y +DNK W+KHV+ YK+INK
Sbjct  395   PEVNSPDEVSGGALEKFPDRLMAVPPRIASGSVPGVTVESYKEDNKLWRKHVNLYKKINK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I +GRYRNIMDMNAGLGGFAA + SPK WVMNVVPTIA+K+TLGVIYERG+IGIYHDWC
Sbjct  455   LIVSGRYRNIMDMNAGLGGFAAAIESPKSWVMNVVPTIAEKNTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+GVFSLY DKC  EDILLEMDRILRPEGAV+FRD+VD L KV+++
Sbjct  515   EAFSTYPRTYDLIHAHGVFSLYNDKCKMEDILLEMDRILRPEGAVIFRDDVDVLNKVKKM  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDT  321
               GMRW+ K++DHEDGPLVP+K+LVAVK+YW  N T
Sbjct  575   ASGMRWNTKMVDHEDGPLVPQKVLVAVKQYWITNGT  610



>ref|XP_009390921.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   402 bits (1032),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/272 (69%), Positives = 224/272 (82%), Gaps = 5/272 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEK SEKGEIAIW++R++ +SC   Q ++    C++ +PDDVWYKKM+ C+   
Sbjct  336   IAKLLCWEKISEKGEIAIWRKRINAESCPGRQDENPINVCKATNPDDVWYKKMESCVNQY  395

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  E       K FP+RL AIPPRIA+G V   S ++Y  D K W+KHV AYK+INK
Sbjct  396   PEVSSAEEVAGGELKPFPQRLKAIPPRIASGSVPDFSVKSYQGDVKLWQKHVKAYKKINK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA + SPK WVMNVVPTIA+ STLGVIY+RG+IGIYHDWC
Sbjct  456   LLDTGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTIAEMSTLGVIYDRGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLY++KC  EDILLEMDRILRPEGAV+FRD+VD LIKV++I
Sbjct  516   EAFSTYPRTYDLIHANGVFSLYRNKCKMEDILLEMDRILRPEGAVIFRDDVDVLIKVKKI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT  333
             +GGMRW+ KL+DHEDGPLVPEKILVAVK+YW 
Sbjct  576   VGGMRWNIKLVDHEDGPLVPEKILVAVKQYWV  607



>ref|XP_009393699.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   402 bits (1032),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 225/280 (80%), Gaps = 6/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SEK EIAIW++R++ DSC   Q + +   C+S   DDVWYKKM+ CI P 
Sbjct  335   IAELLCWEKVSEKSEIAIWRKRINSDSCAVRQDEPRVRTCESSYADDVWYKKMEACIVPF  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  E       K FP+RL  +PPRIA+G V G S E+Y +DN+ WKKHV AYKR+NK
Sbjct  395   PEVDNPEEVAGGELKTFPDRLNDVPPRIASGSVPGFSVESYQEDNRLWKKHVKAYKRLNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              IDTGRYRNIMDMNAGLG F+A + SPK WVMNVVPTIADKSTLGVIYERG+IGIYHDWC
Sbjct  455   YIDTGRYRNIMDMNAGLGSFSAAIESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLY-KDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             EGFSTYPRTYDLIHAN VFSLY K++C  EDILLEMDRILRPEGAV+FRD+VD L+KV+R
Sbjct  515   EGFSTYPRTYDLIHANAVFSLYNKNRCKMEDILLEMDRILRPEGAVIFRDQVDILMKVKR  574

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             ++ GMRW+ K++DHEDGPL+ EK+LVAVK+YW    TN T
Sbjct  575   MVTGMRWNTKMVDHEDGPLLQEKVLVAVKQYWAGGHTNET  614



>emb|CAN60192.1| hypothetical protein VITISV_038569 [Vitis vinifera]
Length=605

 Score =   401 bits (1030),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 228/281 (81%), Gaps = 11/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIW++R++ DSC  S++ S  TFC++ + +DVWYK+M+ C+TP 
Sbjct  329   IAKLLCWEKKYEKGEIAIWRKRINHDSC--SEQDSHVTFCEATNANDVWYKQMEACVTPY  386

Query  953   PKANIDESF-----KKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK    +       K FPERL A+P RI++G + GVS E + +D+K WKKHV AYKR NK
Sbjct  387   PKTTEADEVAGGVXKPFPERLNAVPFRISSGSIPGVSDETFQEDDKLWKKHVKAYKRTNK  446

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWC
Sbjct  447   IIDSGRYRNIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWC  506

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFS     C  EDILLEMDRILRPEGAV+FRD++D LIKV++I
Sbjct  507   EAFSTYPRTYDLIHANGVFSF----CSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKI  562

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             +GGMRW+ KL+DHEDGPLV EKIL AVK+YW + + NST+A
Sbjct  563   VGGMRWNTKLVDHEDGPLVSEKILFAVKQYWVVGENNSTAA  603



>gb|KJB51709.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51710.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51711.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=613

 Score =   401 bits (1030),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 227/282 (80%), Gaps = 11/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI++++++  SCR    ++ A  C+    DDVWYKKM+ CITP 
Sbjct  335   LAEQLCWEKKYEKGDIAIFRKKVNDKSCR----RNSANMCKPRGSDDVWYKKMETCITPF  390

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK +          KKFP RL A+PP I+ GLV GVS E+Y +DNK WKKHV+AYKRIN+
Sbjct  391   PKVSSASEVAGGELKKFPARLFAVPPHISKGLVEGVSVESYQEDNKLWKKHVNAYKRINR  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPTI  K TLGVIYERG+IGIYHDWC
Sbjct  451   LIGTARYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIG-KDTLGVIYERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLY+DKC FEDILLEMDRILRPEGAV+FRD+VD L KVR+I
Sbjct  510   EGFSTYPRTYDLIHANGVFSLYQDKCSFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT-LNDTNSTSA  306
              GGMRWD K+ DHEDGPLVPEKILVAVK+YW  +   NSTS+
Sbjct  570   AGGMRWDTKMNDHEDGPLVPEKILVAVKQYWVGVIKGNSTSS  611



>ref|XP_012080255.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
 ref|XP_012080256.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
 ref|XP_012080257.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
Length=617

 Score =   401 bits (1030),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 191/285 (67%), Positives = 228/285 (80%), Gaps = 11/285 (4%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWY----KKMDVCI  963
             AKLLCWEKK E GEIAIWQ+R++ DSCR      + T CQ  + DDVWY    KKM+ C+
Sbjct  335   AKLLCWEKKHEIGEIAIWQKRINYDSCR--DLNPQPTMCQPTNTDDVWYAMWYKKMETCV  392

Query  962   TP-----SPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR  798
             TP      P       ++ FPERL A+P RI++G + GVS EAYL+D +  KKHV+AYKR
Sbjct  393   TPYLETHEPNEVAGAPWRPFPERLNAVPFRISSGSIPGVSIEAYLEDFRLCKKHVNAYKR  452

Query  797   INKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYH  618
             INKI+D+GRYRNIMDMNAG+GGFAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYH
Sbjct  453   INKILDSGRYRNIMDMNAGMGGFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYH  512

Query  617   DWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKV  438
             DWCE FSTYPRTYDLIHAN +FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+ D LIKV
Sbjct  513   DWCEAFSTYPRTYDLIHANALFSLYKDKCNMEDILLEMDRILRPEGAVIFRDQEDILIKV  572

Query  437   RRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +RI+GGMRW+ K++DHEDGPLVPEK++ AVK+YW   + N T++Q
Sbjct  573   KRIVGGMRWNTKMVDHEDGPLVPEKVMFAVKQYWVAGEYNRTTSQ  617



>ref|XP_009772034.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009772035.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=615

 Score =   400 bits (1028),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 226/280 (81%), Gaps = 7/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKGEIAIW++R++ + C  S++ S+ T C+S   ++VWYKKM+ C+TP 
Sbjct  337   IAEFLCWEKKYEKGEIAIWRKRVNNEYC--SERDSRVTLCESSKSENVWYKKMEACVTPY  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      K FPERL AIPPRIA+G V GVS E++ +DNK WKKHV AYKR+NK
Sbjct  395   PETRNSDEVAGGELKPFPERLNAIPPRIASGSVPGVSVESFQEDNKLWKKHVKAYKRVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              +DTGRYRNI+DMNAGLG FAA L SPK WVMNV+PT A+  TLGV+YERG+IGIYHDWC
Sbjct  455   FLDTGRYRNILDMNAGLGSFAAALESPKLWVMNVMPTKAESDTLGVLYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD  D L +V+ I
Sbjct  515   EAFSTYPRTYDLIHANGVFSLYKDKCNVEDILLEMDRILRPEGAVIFRDHADILGQVKLI  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW  K++D+EDGPL+PEK+L AVK+YW + D NST+
Sbjct  575   ATGMRWKTKMVDNEDGPLIPEKVLFAVKRYWVVGDNNSTA  614



>gb|KHG27439.1| hypothetical protein F383_15139 [Gossypium arboreum]
Length=643

 Score =   401 bits (1030),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/282 (70%), Positives = 226/282 (80%), Gaps = 11/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI++++++  SCR    ++ A  C+    DDVWYKKM+ CITP 
Sbjct  365   LAEQLCWEKKYEKGDIAIFRKKVNDKSCR----RNSANMCKPRGSDDVWYKKMETCITPF  420

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK +          KKFP RL A+PPRI+ GLV GVS E Y +DNK WKKHV+AYKRIN+
Sbjct  421   PKVSSASEVAGGELKKFPARLFAVPPRISKGLVEGVSVETYQEDNKLWKKHVNAYKRINR  480

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPTI  K TLGVIYERG+IGIYHDWC
Sbjct  481   LIGTARYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIG-KDTLGVIYERGLIGIYHDWC  539

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDL+HANGVFSLY+DKC FEDILLEMDRILRPEGAV+FRD+VD L KVR+I
Sbjct  540   EGFSTYPRTYDLMHANGVFSLYQDKCSFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKI  599

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLN-DTNSTSA  306
              GGMRWD K+ DHEDGPLVPEKILVAVK+YW      NSTS+
Sbjct  600   AGGMRWDTKMNDHEDGPLVPEKILVAVKQYWVGGIKGNSTSS  641



>ref|XP_008239959.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=611

 Score =   399 bits (1026),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 227/282 (80%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLL WEKK EKGEIAIW+++   D  R   +  + T C S + DDVWYKKM++CITP 
Sbjct  332   MAKLLNWEKKHEKGEIAIWRKQTSFDYGRG--RDPQPTLCDSTNADDVWYKKMELCITPY  389

Query  953   PKA-----NIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+      +   ++K FPERL A+P RI +G + GVS E Y +DN+ WKKHV+AYKR NK
Sbjct  390   PETSDPNEDAGGAWKPFPERLNALPFRIFSGSIPGVSPETYQEDNRSWKKHVNAYKRTNK  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ERG+IGIYHDWC
Sbjct  450   LLDTGRYRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKCD EDILLEMDRILRPEGAV+FRD +D L+KV +I
Sbjct  510   EAFSTYPRTYDLIHANGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRW+ K++DHEDGPLVPEK+L AVK+YW   + NSTS++
Sbjct  570   VRGMRWNTKMVDHEDGPLVPEKVLFAVKRYWVAGEDNSTSSE  611



>ref|XP_011032031.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
 ref|XP_011032032.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
Length=612

 Score =   399 bits (1024),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 227/281 (81%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI++++ +  +CR    +  A+ C+S D DDVWYK+M+ C TP 
Sbjct  335   LAESLCWEKKYEKGDIAIFRKKANNKNCR----RKSASICESKDADDVWYKEMEACKTPL  390

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N          KKFPERL AIPPR+A GLV GV+AE++ +DNK WKK ++AYKR NK
Sbjct  391   PEVNSANEVAGGELKKFPERLFAIPPRVAKGLVKGVTAESFQEDNKLWKKRINAYKRNNK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIYERG++GIYHDWC
Sbjct  451   LIGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I
Sbjct  510   EGFSTYPRTYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
              GGMRWD K+MDHEDGPLVPEKI+V VK+YW     NSTS+
Sbjct  570   AGGMRWDTKMMDHEDGPLVPEKIVVVVKQYWVGGTGNSTSS  610



>ref|XP_010917038.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=616

 Score =   398 bits (1023),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/281 (66%), Positives = 220/281 (78%), Gaps = 5/281 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A+ LCWEK SEKGEIAIW++R++ DSC   Q + +   C+S + DDVWYKKM+ CI   P
Sbjct  336   AEFLCWEKISEKGEIAIWRKRINADSCPGRQDEPRLNMCKSTNADDVWYKKMEACINRYP  395

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + N  +       + FPERL AIPPRI++G V G S E+Y  DNK W+KHV AYK++NK+
Sbjct  396   EVNSPKEVAGGELRPFPERLNAIPPRISSGSVPGFSVESYQKDNKLWQKHVKAYKKVNKL  455

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +D GRYRNIMDMNAGLG FAA + SPK WVMNVVPTIA+ STLGVIYERG+IGIYHDWCE
Sbjct  456   LDIGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTIAELSTLGVIYERGLIGIYHDWCE  515

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHANGVFS+Y++KC  EDILLEMDRILRPEGA++FRD+VD LIKV+ ++
Sbjct  516   AFSTYPRTYDLIHANGVFSMYQNKCKMEDILLEMDRILRPEGAIIFRDDVDVLIKVKSMV  575

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GMRW  K+ DHEDGPLV EKIL AVK+YW     N TS Q
Sbjct  576   SGMRWSTKMADHEDGPLVSEKILFAVKQYWVGGSKNKTSEQ  616



>ref|XP_010275323.1| PREDICTED: probable methyltransferase PMT14 [Nelumbo nucifera]
Length=613

 Score =   398 bits (1022),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 225/280 (80%), Gaps = 10/280 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+LLCWEKK EKG++AIW+++++ +SC     +  A FC S D DDVWYKKM  CITP 
Sbjct  336   LAELLCWEKKYEKGDLAIWRKKVNAESCH----RKSANFCVSAD-DDVWYKKMKKCITPL  390

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK          + KKFP RL AIPPRI+  LV GV+AE+Y DDNK WKKHV++YKR NK
Sbjct  391   PKVTSQNEVAGGALKKFPARLFAIPPRISKRLVPGVTAESYQDDNKLWKKHVNSYKRTNK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I +GRYRNIMDMNAGLG FAA + SPK WVMNVVPTIA+K+TLGVIYERG+IGIYHDWC
Sbjct  451   LIGSGRYRNIMDMNAGLGSFAAAIESPKSWVMNVVPTIAEKNTLGVIYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+GVFS+Y++KC+  DILLEMDRILRPEGAV+ RD VD L KVR+I
Sbjct  511   EAFSTYPRTYDLIHASGVFSMYQNKCEAVDILLEMDRILRPEGAVIIRDNVDVLNKVRKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GM+WD K++DHEDGPLVPEKILVAVK+YW     NSTS
Sbjct  571   ANGMKWDTKMVDHEDGPLVPEKILVAVKQYWVGGSGNSTS  610



>emb|CBI33946.3| unnamed protein product [Vitis vinifera]
Length=509

 Score =   394 bits (1013),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 223/281 (79%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCW+K  EKG++AI++++++  SCR    +  A  C+S D DDVWYKKM+ C+TP 
Sbjct  233   MAEQLCWKKVYEKGDLAIFRKKINAKSCR----RKSANVCESKDADDVWYKKMETCVTPY  288

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            KKFP RL AIPPRIA GLV GV+ E+Y +DNK WKKHV+ YKRINK
Sbjct  289   PEVTSANEVAGGELKKFPARLFAIPPRIAAGLVEGVTVESYEEDNKLWKKHVNTYKRINK  348

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  349   LLGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  407

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  408   EGFSTYPRTYDFIHASGVFSLYQNTCKLEDILLEMDRILRPEGAVMFRDEVDVLIKVKKI  467

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
               GMRW+  +MDHEDGPLVPEKILV VK+YW     NSTSA
Sbjct  468   AKGMRWNTNMMDHEDGPLVPEKILVVVKQYWVGGGDNSTSA  508



>ref|XP_010110495.1| putative methyltransferase PMT14 [Morus notabilis]
 gb|EXC26713.1| putative methyltransferase PMT14 [Morus notabilis]
Length=612

 Score =   397 bits (1021),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 224/280 (80%), Gaps = 10/280 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAI+++ ++  SCR    +  +  C++ D DDVWYK+M+ C+TP 
Sbjct  334   IAEFLCWEKKYEKGDIAIFRKNVNAKSCR----RKSSDMCKTTDADDVWYKEMEACVTPL  389

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            KKFP RL A+PP+IA GLVSGV+ E+Y +DN  W+KHV AYKRINK
Sbjct  390   PEVTAANEVAGGELKKFPARLYAVPPKIAKGLVSGVTLESYQEDNTIWRKHVDAYKRINK  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIAD S LGVIYERG+IGIYHDWC
Sbjct  450   LIGTSRYRNVMDMNAGLGGFAAALESRKSWVMNVVPTIADNS-LGVIYERGLIGIYHDWC  508

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIH NGVFSLY+DKC+ EDILLEMDRILRPEG+V+ RDEVD L KV++I
Sbjct  509   EGFSTYPRTYDLIHGNGVFSLYQDKCELEDILLEMDRILRPEGSVLLRDEVDVLNKVKKI  568

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRWD KL+DHEDGPLVPEKILVAVK+YW ++  NSTS
Sbjct  569   SAGMRWDIKLLDHEDGPLVPEKILVAVKQYWVVSKGNSTS  608



>ref|XP_009371899.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Pyrus 
x bretschneideri]
Length=615

 Score =   397 bits (1020),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 225/280 (80%), Gaps = 9/280 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCW+KK EKG++AIW+++++  SCR    +     CQ+ D DDVWYKKMD C+TP
Sbjct  338   ALAESLCWDKKYEKGDMAIWKKKVNTKSCR----RKSIDVCQTEDADDVWYKKMDTCVTP  393

Query  956   SPK-ANIDE---SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             SP+  N +E      KFP RL A+PPRI NGLV GV+ ++Y +DNK WKKHV+ YKRIN 
Sbjct  394   SPEVTNANEVAVGELKFPARLYAVPPRIVNGLVVGVTTKSYQEDNKLWKKHVNVYKRING  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  454   LIGTTRYRNVMDMNAGLGGFAAALESRKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPR+YDLIHA+GVFSLYK+ C  EDILLEMDRILRPEG V+FRDEVD L KVR+I
Sbjct  513   EGFSTYPRSYDLIHASGVFSLYKNGCKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             +GGMRWD K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  573   VGGMRWDAKIMDHEDGPLVPEKILVVVKQYWVAGSGNSTS  612



>ref|XP_009342549.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT14 
[Pyrus x bretschneideri]
Length=509

 Score =   393 bits (1009),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 224/281 (80%), Gaps = 9/281 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCWEKK EKG++ IW+++++  SCR    +     CQ+ D DDVWYKKMD C+TP
Sbjct  232   ALAESLCWEKKYEKGDMVIWKKKVNTKSCR----RKSVDVCQTEDTDDVWYKKMDTCVTP  287

Query  956   SPK-ANIDE---SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             SP+  N +E      KFP RL A+PP IANGLV G + E+Y +DNK WKKHV+ YKRIN+
Sbjct  288   SPEVTNANEVAVGELKFPARLYAVPPXIANGLVVGFTTESYQEDNKLWKKHVNVYKRINR  347

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RY N+MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  348   LIGTTRYWNVMDMNAGLGGFAAALESQKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  406

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EG STYPR+YDLIHA+GVFSLYK++C  EDILLEMDRILRPEG V+FRDEVD L KVR+I
Sbjct  407   EGSSTYPRSYDLIHASGVFSLYKNECKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKI  466

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             +GGMRWD K+MDHEDGPLVPEKILV VK+YW     NSTS+
Sbjct  467   VGGMRWDAKIMDHEDGPLVPEKILVVVKQYWVAGSGNSTSS  507



>ref|XP_010695192.1| PREDICTED: probable methyltransferase PMT14 [Beta vulgaris subsp. 
vulgaris]
Length=612

 Score =   396 bits (1018),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 226/281 (80%), Gaps = 10/281 (4%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A+ LCWEKK EKG+IAI++++++ +SC    K+    FC++ DPDDVWYKKM+ C+TP P
Sbjct  336   AEQLCWEKKYEKGDIAIFRKKINAESC----KRKPQNFCETQDPDDVWYKKMETCVTPFP  391

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +          +KFP RL A PPRIA GLV+GV+ E+Y +DN KWKKHV AYK +N++
Sbjct  392   EVSSSSEVAGGKLEKFPARLFATPPRIAKGLVTGVTEESYQEDNAKWKKHVKAYKNLNRL  451

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             + + RYRNIMDMNAGLGGFAA + SPK WVMNVVP IAD +TLG IYERG+IGIYHDWCE
Sbjct  452   VGSARYRNIMDMNAGLGGFAAAIDSPKVWVMNVVPNIAD-NTLGAIYERGLIGIYHDWCE  510

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
             GFSTYPRTYDLIHAN +FS+Y+DKC++EDILLEMDRILRPEG V+FRD VD LIKV++I 
Sbjct  511   GFSTYPRTYDLIHANHLFSMYQDKCEYEDILLEMDRILRPEGVVIFRDAVDPLIKVKQIA  570

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GMRWD KL+DHEDGP VPEKIL+AVK+YW   + NSTS+ 
Sbjct  571   RGMRWDLKLVDHEDGPFVPEKILIAVKQYWVAGEMNSTSSN  611



>ref|XP_010559283.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010559284.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   396 bits (1017),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 223/282 (79%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEK  EKG+IAIW+++ +  SC     ++  T C+  D DDVWYK+M+ C+TP 
Sbjct  336   IAESLCWEKTYEKGDIAIWRKKTNDKSC----DRTSVTICKGKDTDDVWYKEMETCVTPF  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL A+PPRIA G V GV +E+Y +DNK WKK ++ YKRIN+
Sbjct  392   PKVSSEEEVAGGKLKKFPERLFALPPRIAKGQVEGVDSESYQEDNKLWKKRLNTYKRINR  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPTIA K+TLG+IYERG+IGIYHDWC
Sbjct  452   LIGTTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGIIYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VR++
Sbjct  511   EGFSTYPRTYDLIHANGVFSLYQNSCKIEDILLEMDRILRPEGMVIFRDEVDVLNDVRKM  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRWD KLMDHEDGPLVPEKILVAVK+YW     N TS++
Sbjct  571   ANGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGGGNGTSSE  612



>ref|XP_004235979.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=616

 Score =   395 bits (1015),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 230/279 (82%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             I +LLCWEKK EKGEIAIW++R++ + C  S++ S+ T C   + ++VWYKKM+ C+TP 
Sbjct  337   ITELLCWEKKYEKGEIAIWRKRVNSEFC--SKRDSRVTLCDLSNSENVWYKKMEACVTPY  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N+++      K FPERL AIPPRIA+G ++GVS E++ +DNK WKKHV AYKR+NK
Sbjct  395   PETINLEQVSGGELKPFPERLNAIPPRIASGSLTGVSVESFQEDNKSWKKHVKAYKRVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DT RYRNI+DMNAGLG FAA L S K WVMNVVPTIA++ TLG+IY+RG+IGIYHDWC
Sbjct  455   LLDTRRYRNILDMNAGLGSFAAALESSKLWVMNVVPTIAERDTLGIIYDRGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANG+FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD L +V+R+
Sbjct  515   EAFSTYPRTYDLIHANGIFSLYKDKCNTEDILLEMDRILRPEGAVIFRDDVDILGQVKRV  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             + GMRW  K++DHEDGPL+ +K+L AVK+YW + + NST
Sbjct  575   VSGMRWKTKMVDHEDGPLISKKVLFAVKRYWVVGENNST  613



>ref|XP_007037318.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY21819.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=615

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/282 (66%), Positives = 228/282 (81%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK E GEIA+W++R +   CR  Q+ +K T C+  +PDDVWYKK + C TP 
Sbjct  336   IAKLLCWEKKHEMGEIAVWRKRTNYALCR--QQDAKLTACEMRNPDDVWYKKTEACATPY  393

Query  953   PK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  DE     +K+FPERL A+P RI++G + GVS E Y +D + WKKHV+AYKRIN 
Sbjct  394   PETSGPDEVAGGEWKQFPERLNAVPFRISSGSIPGVSVETYQEDVRLWKKHVNAYKRINS  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             IID+GRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLG+IYERG+IGIYHDWC
Sbjct  454   IIDSGRYRNIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGIIYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA  +FSLYK+KC+ EDILLEMDRILRPEG V+ RD+VD L+KV++I
Sbjct  514   EAFSTYPRTYDLIHAKSIFSLYKNKCNVEDILLEMDRILRPEGTVIIRDQVDELMKVKKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRW+ +++DHEDGPLV EKIL AVK+YW   ++N+TS +
Sbjct  574   VGGMRWNTRMVDHEDGPLVSEKILFAVKRYWVAGESNTTSME  615



>ref|XP_002282093.2| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663982.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663986.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
Length=611

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 223/281 (79%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCW+K  EKG++AI++++++  SCR    +  A  C+S D DDVWYKKM+ C+TP 
Sbjct  335   MAEQLCWKKVYEKGDLAIFRKKINAKSCR----RKSANVCESKDADDVWYKKMETCVTPY  390

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            KKFP RL AIPPRIA GLV GV+ E+Y +DNK WKKHV+ YKRINK
Sbjct  391   PEVTSANEVAGGELKKFPARLFAIPPRIAAGLVEGVTVESYEEDNKLWKKHVNTYKRINK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  451   LLGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD LIKV++I
Sbjct  510   EGFSTYPRTYDFIHASGVFSLYQNTCKLEDILLEMDRILRPEGAVMFRDEVDVLIKVKKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
               GMRW+  +MDHEDGPLVPEKILV VK+YW     NSTSA
Sbjct  570   AKGMRWNTNMMDHEDGPLVPEKILVVVKQYWVGGGDNSTSA  610



>gb|ACN26954.1| unknown [Zea mays]
Length=328

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/272 (65%), Positives = 212/272 (78%), Gaps = 5/272 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK SEKGE+AIW++R++ +SC + Q++S    C+S +PDDVWYKKM  C+TP 
Sbjct  49    IADLLCWEKVSEKGEMAIWRKRVNTESCPSRQEESAVQMCESTNPDDVWYKKMKACVTPL  108

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P    +      + K FP RL A+PPRIANGLV GVS++A+  DNK WKKHV +Y  +NK
Sbjct  109   PDVKDENDVAGGAIKPFPARLNAVPPRIANGLVPGVSSQAFQKDNKMWKKHVKSYSSVNK  168

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +YERG+IGIYHDWC
Sbjct  169   YLLTGRYRNIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWC  228

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +
Sbjct  229   EAFSTYPRTYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSL  288

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT  333
               GMRWD K++DHEDGPLV EKIL AVK+YW 
Sbjct  289   ALGMRWDTKMVDHEDGPLVREKILYAVKQYWV  320



>ref|XP_010529126.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010529127.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 228/284 (80%), Gaps = 12/284 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW+++ + +SC     ++   FC+  D DDVWYK+M+ C+TP 
Sbjct  336   IAESLCWEKKYEKGDIAIWRKKPNDESC----DRTSVNFCEGKDTDDVWYKEMETCVTPF  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + ++       KKFPERL A+PPRI+ G V GV+AE++ +DNK WKK +S YKR+N+
Sbjct  392   PKVSSEDEVAGGKLKKFPERLFAVPPRISKGQVEGVNAESFEEDNKLWKKRLSTYKRVNR  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T R+RN+MDMNAGLGGFAA + SPK WVMNV+PTIA K+TLGVIYERG+IGIYHDWC
Sbjct  452   LIGTTRFRNVMDMNAGLGGFAAAVESPKSWVMNVIPTIA-KNTLGVIYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLYK+ C  EDILLEMDRILRPEG V+FRDEVD L  VR+I
Sbjct  511   EGFSTYPRTYDLIHANGVFSLYKNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTL--NDTNSTSAQ  303
               GMRWD KLMDHEDGPLVPEKILVAVK+YW    N T+S+S +
Sbjct  571   ADGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGGNSTSSSSEE  614



>ref|XP_008393149.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=609

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 226/282 (80%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLL WEKK EKGEIAIW+++   +  R    +S    C+S + DDVWYKKM++C+TP 
Sbjct  330   VAKLLNWEKKHEKGEIAIWRKQTTSEYRRDQDPQS--NMCESNNADDVWYKKMELCVTPX  387

Query  953   PKA---NIDES--FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+    N D    +K FPERL A+P RI++G V  VSAE + +DNK WKKHV+AYKR NK
Sbjct  388   PETSXFNEDAGGPWKPFPERLNALPSRISSGFVPDVSAETFQEDNKAWKKHVNAYKRTNK  447

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +++TGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ERG+IGIYHDWC
Sbjct  448   LMBTGRYRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWC  507

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKCD EDILLEMDRILRPEGAV+FRD  D L+KV ++
Sbjct  508   EAFSTYPRTYDLIHANGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDHXDVLVKVSKL  567

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
               GMRW+ K++DHEDGPLVPEK+L AVK+YW   + NST+++
Sbjct  568   ARGMRWNTKMVDHEDGPLVPEKVLFAVKRYWVAGEDNSTTSE  609



>ref|XP_006578576.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Glycine 
max]
Length=375

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 222/275 (81%), Gaps = 6/275 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIW++++  D    S++ ++   C++ + DDVWYKKM  C+TPS 
Sbjct  107   AKLLCWEKKYEKGEIAIWRKKLHND---CSEQDTQPQICETKNSDDVWYKKMKDCVTPSK  163

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +     +K F ERL  +P RI +G V GVS EA+ +DN+ WKKHV+AYKRINKII +GR
Sbjct  164   PSG---PWKPFQERLNVVPSRITSGFVPGVSEEAFEEDNRLWKKHVNAYKRINKIISSGR  220

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ERG+IGIYHDWCE FSTY
Sbjct  221   YRNIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTY  280

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVFSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L++V+ I+ GMRW
Sbjct  281   PRTYDLIHANGVFSLYKNVCNVEDILLEMDRILRPEGAVIFRDQADVLMQVKGIVKGMRW  340

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             + K++DHEDGPLV EK+L AVK+YW   D +++SA
Sbjct  341   NTKMVDHEDGPLVSEKVLFAVKQYWVAGDNSTSSA  375



>ref|XP_004508998.1| PREDICTED: probable methyltransferase PMT14-like [Cicer arietinum]
Length=611

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/281 (67%), Positives = 225/281 (80%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++++  SC   Q+KS    C+    DDVWYKKM+VC TP 
Sbjct  336   LAESLCWEKKYEKGDIAIWRKKINAKSC---QRKS-PDLCELDSADDVWYKKMEVCKTPI  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            KKFP RL A+PPRIA G + GV+ E+Y +DNK WKKHV+ YKRIN+
Sbjct  392   PEVTSKSEVAGGELKKFPARLLAVPPRIAKGFIPGVTTESYQEDNKLWKKHVTEYKRINR  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIAD +TLGVIYERG+IGIYHDWC
Sbjct  452   LLGTTRYRNLMDMNAGLGGFAAALESQKSWVMNVVPTIAD-NTLGVIYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGA++ RDEVD L KV++I
Sbjct  511   EGFSTYPRTYDLIHANGLFSLYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             +GGMRW+ K+MDHEDGPLVPEKILVA K+YW     N+TS+
Sbjct  571   VGGMRWEAKMMDHEDGPLVPEKILVATKEYWVGISKNNTSS  611



>ref|XP_009371893.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371894.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371895.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371896.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371897.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371898.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
Length=616

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 226/281 (80%), Gaps = 10/281 (4%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCW+KK EKG++AIW+++++  SCR    +     CQ+ D DDVWYKKMD C+TP
Sbjct  338   ALAESLCWDKKYEKGDMAIWKKKVNTKSCR----RKSIDVCQTEDADDVWYKKMDTCVTP  393

Query  956   SPK-ANIDE---SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             SP+  N +E      KFP RL A+PPRI NGLV GV+ ++Y +DNK WKKHV+ YKRIN 
Sbjct  394   SPEVTNANEVAVGELKFPARLYAVPPRIVNGLVVGVTTKSYQEDNKLWKKHVNVYKRING  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIYERG+IGIYHDWC
Sbjct  454   LIGTTRYRNVMDMNAGLGGFAAALESRKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKD-KCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             EGFSTYPR+YDLIHA+GVFSLYK+ +C  EDILLEMDRILRPEG V+FRDEVD L KVR+
Sbjct  513   EGFSTYPRSYDLIHASGVFSLYKNGRCKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRK  572

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             I+GGMRWD K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  573   IVGGMRWDAKIMDHEDGPLVPEKILVVVKQYWVAGSGNSTS  613



>ref|XP_010029610.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029618.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83590.1| hypothetical protein EUGRSUZ_B00481 [Eucalyptus grandis]
Length=614

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 226/279 (81%), Gaps = 9/279 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A+ LCWEKK E+GEIAIWQ+R +        K  +   C+S +PDDVWYKKM+ CITP P
Sbjct  337   AERLCWEKKHERGEIAIWQKRTNCHG-----KDLEPAMCKSTNPDDVWYKKMEACITPYP  391

Query  950   KANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKII  783
             +    E    ++K FPERL AIP R+++G + GVSA+++ +DNK W+KHV+ YK  NKI+
Sbjct  392   ETTHLEEVVGAWKPFPERLNAIPYRVSSGSIPGVSADSFQEDNKTWRKHVNFYKTENKIM  451

Query  782   DTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEG  603
              +GRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA + TLGVIYERG+IGIYHDWCE 
Sbjct  452   SSGRYRNIMDMNAGLGSFAAALESPKLWVMNVMPTIAKRDTLGVIYERGLIGIYHDWCEA  511

Query  602   FSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIG  423
             FSTYPRTYDLIHA+GVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDE+D L+KV+RI+G
Sbjct  512   FSTYPRTYDLIHAHGVFSLYKDKCNMEDILLEMDRILRPEGAVIFRDELDVLLKVKRIVG  571

Query  422   GMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             GMRW+ K++DHEDGPL+ EK+L AVK+YW   +++STSA
Sbjct  572   GMRWNTKMVDHEDGPLITEKVLFAVKQYWVAGESSSTSA  610



>emb|CDP12320.1| unnamed protein product [Coffea canephora]
Length=1044

 Score =   405 bits (1042),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/279 (67%), Positives = 223/279 (80%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEKK EKGE AIW++R++ D C  S+  S+ T C+S D DD+WYKKM+ C+TP 
Sbjct  335   IAELLCWEKKHEKGETAIWRKRINEDYC--SRGDSRVTKCRSVDADDIWYKKMENCVTPY  392

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+    E       K FPERL AIPPR+  G + GVS +++ +DN+ WK H+SAY+RINK
Sbjct  393   PETRSQEEVAGGELKPFPERLHAIPPRVDGGSIPGVSIDSFQEDNRLWKMHMSAYRRINK  452

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++D+GRYRN+MDMNAGLG FAA   SPK WVMNV+PTIAD+ TLGVI+ERG+IGIYHDWC
Sbjct  453   LLDSGRYRNVMDMNAGLGSFAAAFESPKLWVMNVMPTIADRDTLGVIFERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA GVFSLYKDKC+ EDILLEMDRILRPEGAV+ RD  D L +V+RI
Sbjct  513   EAFSTYPRTYDLIHAEGVFSLYKDKCNMEDILLEMDRILRPEGAVILRDHADVLTEVKRI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             I GMRW+ K+ DHEDGPLVPEKILVAVKKYW   D NST
Sbjct  573   IAGMRWNMKMYDHEDGPLVPEKILVAVKKYWVAGDKNST  611



>ref|XP_009595709.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009595710.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=615

 Score =   394 bits (1011),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 227/280 (81%), Gaps = 7/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEKK EKGEIAIW++R++ + C  S++ S+ T C+S   ++VWYKKM+ C+T  
Sbjct  337   IAELLCWEKKYEKGEIAIWRKRVNNEYC--SERDSRVTLCESLKSENVWYKKMEACVTLY  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      K FPERL AIPPRIA+G V GVS +++ +++K WKKHV AYKR+NK
Sbjct  395   PETTNSDEVAGGELKPFPERLNAIPPRIASGSVPGVSVDSFQEEDKLWKKHVKAYKRVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              +DTGRYRNI+DMNAGLG FAA L SPK WVMNV+PT A+  TLGV+YERG+IGIYHDWC
Sbjct  455   FLDTGRYRNILDMNAGLGSFAAALESPKLWVMNVMPTKAESDTLGVLYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD VD L +V+RI
Sbjct  515   EAFSTYPRTYDLIHANGVFSLYKDKCNVEDILLEMDRILRPEGAVIFRDHVDILGQVKRI  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW  K +D+EDGPL+PEK+L AVK+YW + D NST+
Sbjct  575   ATGMRWKTKTVDNEDGPLIPEKLLFAVKRYWVVGDNNSTA  614



>ref|XP_011018632.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
 ref|XP_011018633.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
Length=612

 Score =   394 bits (1011),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 226/281 (80%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI++++++  +C     +  A+ C+S D DDVWYK+M+ C TP 
Sbjct  335   LAESLCWEKKYEKGDIAIFRKKVNDKNCH----RKSASVCESKDADDVWYKEMETCKTPL  390

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK            KKFPERL A+PP+IA GLV GV+AE++ +DN+  +KH+ AYKRINK
Sbjct  391   PKVTSANEVAGGVLKKFPERLHAVPPQIAKGLVEGVTAESFEEDNRLLRKHLHAYKRINK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRNIMDMNA LGGFAA L SPK WVMNVVPTIA K+TLGVIYERG++GIYHDWC
Sbjct  451   LIGTTRYRNIMDMNARLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I
Sbjct  510   EGFSTYPRTYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
              GGMRWD K+MDHEDGPLVPEKILVAVK+YW     NSTS+
Sbjct  570   TGGMRWDTKMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSS  610



>ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33582.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   393 bits (1010),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 225/282 (80%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK E G+IAIW+++++  +C    ++     C S D D+VWYK+M  C+TP 
Sbjct  335   IAESLCWEKKYENGDIAIWRKQINDKNC----QRKATNICISKDFDNVWYKEMQTCVTPL  390

Query  953   PK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK A+  E      KKFPERL A+PPRIA GLV GV+ E+YL+DNK WKKHV  YKRINK
Sbjct  391   PKVASAKEVAGGELKKFPERLFAVPPRIAKGLVEGVTEESYLEDNKLWKKHVKEYKRINK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPT A ++TLGVIYERG++GIYHDWC
Sbjct  451   LIGTVRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTAA-QNTLGVIYERGLVGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHA+GVFSLY+  C  EDILLEMDRILRPEG+V+FRDEVD L +V+RI
Sbjct  510   EGFSTYPRTYDLIHADGVFSLYQKICKLEDILLEMDRILRPEGSVIFRDEVDVLNEVKRI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GGMRWD K+MDHEDGPLVPEKILVAVK+YW     NSTS +
Sbjct  570   AGGMRWDTKMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSNE  611



>ref|XP_006364604.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=616

 Score =   393 bits (1010),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 181/279 (65%), Positives = 225/279 (81%), Gaps = 7/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIW++R++ + C  S++ S+ T C   + ++VWYKKM+ C+TP 
Sbjct  337   IAKLLCWEKKYEKGEIAIWRKRVNSEYC--SERDSRVTLCDLSNSENVWYKKMEACVTPY  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+    E       K FPERL AIPPRIA+G ++GVS E++ +DNK WKKHV AYKR+NK
Sbjct  395   PETINSEQVSGGELKPFPERLNAIPPRIASGSLTGVSVESFQEDNKSWKKHVKAYKRVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DT RYR+++DMNAGLG FAA L S K WVMNVVPTIA++ TL VIY+RG+IGIYHDWC
Sbjct  455   LLDTRRYRSVLDMNAGLGSFAAALESSKLWVMNVVPTIAERDTLAVIYDRGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYD IHANG+FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+ D L +V+RI
Sbjct  515   EAFSTYPRTYDFIHANGIFSLYKDKCNTEDILLEMDRILRPEGAVIFRDDADILGRVKRI  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             + GMRW  K++DHEDGPL+ +K+L AVK+YW + D NST
Sbjct  575   VSGMRWKTKMVDHEDGPLISKKVLFAVKRYWVVGDNNST  613



>ref|XP_006436790.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
 ref|XP_006485402.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485403.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Citrus 
sinensis]
 gb|ESR50030.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
Length=609

 Score =   392 bits (1007),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 225/280 (80%), Gaps = 10/280 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++ +  SC    K+  A  C+S DPDDVWYK+M+ CITP 
Sbjct  334   LAESLCWEKKYEKGDIAIWRKKKNDKSC----KRKSANKCKSRDPDDVWYKQMETCITPF  389

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ +  +       KKFP RL  +PPRIANG V GV+ ++Y +D+K WKKHV+AYK++N 
Sbjct  390   PEVSSTKEVAGGELKKFPSRLFDVPPRIANGEVEGVTGKSYQEDSKLWKKHVNAYKKMNS  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPT A K+TLGVIYERG+IGIYHDWC
Sbjct  450   LIGTRRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTTA-KNTLGVIYERGLIGIYHDWC  508

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD L KVR+ 
Sbjct  509   EGFSTYPRTYDLIHANGVFSLYENTCKPEDILLEMDRILRPEGAVIFRDEVDALNKVRKF  568

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRWD K+MDHEDGPL+PEKIL+AVK+YW  +  NSTS
Sbjct  569   AEGMRWDTKMMDHEDGPLMPEKILIAVKQYWVGSAGNSTS  608



>ref|XP_010053567.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 ref|XP_010053568.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 gb|KCW77890.1| hypothetical protein EUGRSUZ_D02155 [Eucalyptus grandis]
Length=613

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/281 (67%), Positives = 225/281 (80%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG++AIW+++++  SC    +++ A  CQS D DDVWY+KM+ CITP 
Sbjct  336   LAEQLCWEKKYEKGDLAIWRKKVNDRSC----QRNSAAICQSKDADDVWYEKMESCITPF  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK    +       KKFP RL A+PPRIA G V GV+A+ Y +DNK W+KHVS YK++N 
Sbjct  392   PKVASSKEVAGGELKKFPARLNAVPPRIAKGSVPGVTADLYNEDNKIWRKHVSRYKQLNT  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVP IA K+TLGVIYERG+IGIYHDWC
Sbjct  452   LIGSMRYRNVMDMNAGLGGFAAALESPKLWVMNVVPNIA-KNTLGVIYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHA+G+FSLYK KC FEDILLEMDRILRPEGA++ RDEVDT+ +VR+I
Sbjct  511   EGFSTYPRTYDLIHASGIFSLYKGKCKFEDILLEMDRILRPEGAIILRDEVDTMNEVRKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
              G MRWD KL+DHEDGPLVPEKILV VK+YW  +  NSTS 
Sbjct  571   TGRMRWDVKLVDHEDGPLVPEKILVGVKQYWVGSSGNSTSG  611



>ref|XP_006368452.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
 gb|ERP65021.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
Length=612

 Score =   390 bits (1003),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 224/281 (80%), Gaps = 10/281 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAI++++++  +C     +  A+ C+S D DDVWYK+M  C TP 
Sbjct  335   LAESLCWEKKYEKGDIAIFRKKVNDKTCH----RKSASVCESKDADDVWYKEMKTCKTPL  390

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK            KKFPERL A+PP+IA GLV GV+AE++ +DNK  +KH+ AYKRINK
Sbjct  391   PKVTSANEVAGGRLKKFPERLHAVPPQIAKGLVEGVTAESFEEDNKLLRKHLHAYKRINK  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRNIMDMNA LGGFAA L SPK WVMNVVPTIA K+TLGVIYERG++GIYHDWC
Sbjct  451   LIGTTRYRNIMDMNARLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I
Sbjct  510   EGFSTYPRTYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
               GMRWD K+MDHEDGPLVPEKILVAVK+YW     NSTS+
Sbjct  570   TEGMRWDTKMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSS  610



>gb|KHN21029.1| Putative methyltransferase PMT14 [Glycine soja]
Length=561

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 224/282 (79%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++++  SC    K+     C   + DDVWY+KM+VC TP 
Sbjct  284   LAESLCWEKKYEKGDIAIWRKKINAKSC----KRKSPNVCGLDNADDVWYQKMEVCKTPL  339

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            +KFP RL A+PPRIA G + GV+AE+Y +DNK WKKHV+AYKR+NK
Sbjct  340   PEVTSKNEVAGGELQKFPARLFAVPPRIAQGAIPGVTAESYQEDNKLWKKHVNAYKRMNK  399

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVP+IA+ +TLGV+YERG+IGIYHDWC
Sbjct  400   LIGTTRYRNVMDMNAGLGGFAAALESQKSWVMNVVPSIAE-NTLGVVYERGLIGIYHDWC  458

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANG+FS+Y+DKC+ EDILLEMDRILRPEGA++ RDEVD L +V++I
Sbjct  459   EGFSTYPRTYDLIHANGLFSIYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNQVKKI  518

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD KL+DHEDGPLVPEKILVA+K YW     N TS +
Sbjct  519   VGGMRWDAKLVDHEDGPLVPEKILVALKVYWVGTSKNKTSNE  560



>ref|XP_007155749.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
 gb|ESW27743.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
Length=613

 Score =   390 bits (1003),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 228/282 (81%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++++ +SC    K+  +  C   + DDVWY+KM+ C TP 
Sbjct  336   LAESLCWEKKYEKGDIAIWRKKINAESC----KRKSSNLCDLANADDVWYQKMEACKTPL  391

Query  953   PK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N +E      KKFP RL A+PPRIA G V GV+A++Y +DNK WKKHV++YKRIN+
Sbjct  392   PEVTNKNEVAGGELKKFPARLFAVPPRIAQGNVPGVTAKSYQEDNKLWKKHVNSYKRINQ  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWC
Sbjct  452   LIGTTRYRNLMDMNAGLGGFAAALDSPKSWVMNVVPTIAE-NTLGVVYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANG+FSLY+ KC+ EDILLEMDRILRPEGA++ RDEVD L KV++I
Sbjct  511   EGFSTYPRTYDLIHANGLFSLYRGKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRW+ K++DHEDGPLVPEKILVAVK+YW       +S +
Sbjct  571   VGGMRWEAKMVDHEDGPLVPEKILVAVKEYWVATTKKDSSNE  612



>emb|CDP12957.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   390 bits (1002),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 228/280 (81%), Gaps = 10/280 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+LLCWEKK EKG++AI++++++  SC     +  A  C+SGD DDVWYKKM+ CITPS
Sbjct  335   LAELLCWEKKYEKGDVAIFRKKINSRSC----GRKSANMCESGDADDVWYKKMEACITPS  390

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  ++ E      KKFP RL A+PPR+   +V GV+ E+Y +DNK WKKHVS YK+IN 
Sbjct  391   PEVKSVAEVAGGELKKFPARLFAVPPRVEKLMVPGVTVESYEEDNKLWKKHVSVYKKINS  450

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RYRNIMDMNAGLGGFAA L SPK WVMNVVPTIA ++TLG+IYERG+IG+YHDWC
Sbjct  451   LLGTTRYRNIMDMNAGLGGFAANLESPKLWVMNVVPTIA-QNTLGIIYERGLIGMYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDL+HA+G+FSLY+DKC+FE+ILLEMDRILRPEG V+ RD VD L +VR+I
Sbjct  510   EGFSTYPRTYDLLHASGLFSLYQDKCEFEEILLEMDRILRPEGTVIIRDGVDALNEVRKI  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
              GGMRWD KL+DHEDGPLVPEKI VAVK+YW  +  NST+
Sbjct  570   AGGMRWDIKLVDHEDGPLVPEKIFVAVKQYWVGSAGNSTT  609



>ref|XP_003524439.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Glycine 
max]
 ref|XP_006579671.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Glycine 
max]
Length=613

 Score =   389 bits (1000),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 224/282 (79%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++++  SC    K+     C   + DDVWY+KM+VC TP 
Sbjct  336   LAESLCWEKKYEKGDIAIWRKKINAKSC----KRKSPNVCGLDNADDVWYQKMEVCKTPL  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            +KFP RL A+PPRIA G + GV+AE+Y +DNK WKKHV+AYKR+NK
Sbjct  392   PEVTSKNEVAGGELQKFPARLFAVPPRIAQGAIPGVTAESYQEDNKLWKKHVNAYKRMNK  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVP+IA+ +TLGV+YERG+IGIYHDWC
Sbjct  452   LIGTTRYRNVMDMNAGLGGFAAALESQKSWVMNVVPSIAE-NTLGVVYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANG+FS+Y+DKC+ EDILLEMDRILRPEGA++ RDEVD L +V++I
Sbjct  511   EGFSTYPRTYDLIHANGLFSIYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNQVKKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             +GGMRWD KL+DHEDGPLVPEKILVA+K YW     N TS +
Sbjct  571   VGGMRWDAKLVDHEDGPLVPEKILVALKVYWVGTSKNKTSNE  612



>ref|XP_004300275.1| PREDICTED: probable methyltransferase PMT14 [Fragaria vesca subsp. 
vesca]
Length=608

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/276 (66%), Positives = 223/276 (81%), Gaps = 5/276 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCW KK EKG+IAIW+++ + +SC    ++  A  C++ D DDVWYKKMD C+TP 
Sbjct  336   LAESLCWVKKYEKGDIAIWKKKANTNSC----QRESANICRTKDADDVWYKKMDTCVTPP  391

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                ++     KFP RL A+PPRIANGLV+GV+ E+Y +DNK WKK V++YKRINK+I T 
Sbjct  392   SANDVAVGQLKFPARLYAVPPRIANGLVAGVTIESYQEDNKLWKKRVNSYKRINKLIGTT  451

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRN+MDMNAGLGGFAA L S   WVMNVVP+IA K+TLGV+YERG+IGIYHDWCEGFST
Sbjct  452   RYRNVMDMNAGLGGFAAALESKNSWVMNVVPSIA-KNTLGVVYERGLIGIYHDWCEGFST  510

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+GVFSLY+++C  EDILLEMDRILRPEG V+ RDEV+ L KV++I G MR
Sbjct  511   YPRTYDLIHASGVFSLYRNECKVEDILLEMDRILRPEGTVILRDEVNVLNKVKKIAGAMR  570

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             WD K+MDHEDGPLVPEK+LV VK+YW  +  NSTS+
Sbjct  571   WDTKMMDHEDGPLVPEKVLVVVKQYWVESSGNSTSS  606



>ref|XP_006600888.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Glycine 
max]
 ref|XP_006600889.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Glycine 
max]
 gb|KHN01668.1| Putative methyltransferase PMT14 [Glycine soja]
Length=613

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/282 (66%), Positives = 224/282 (79%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++++  SC    K+     C   + DDVWY+KM+VC TP 
Sbjct  336   LAESLCWEKKYEKGDIAIWRKKINDKSC----KRKSPNSCDLDNADDVWYQKMEVCKTPL  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            +KFP RL A+PPRIA G++ GV+AE+Y +DNK WKKHV+AYKR+NK
Sbjct  392   PEVTSKTEVAGGELQKFPARLFAVPPRIAQGIIPGVTAESYQEDNKLWKKHVNAYKRMNK  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA+ +TLGV+YERG+IGIYHDWC
Sbjct  452   LIGTTRYRNVMDMNAGLGGFAAVLESQKSWVMNVVPTIAE-NTLGVVYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGA++ RDEVD L KV++I
Sbjct  511   EGFSTYPRTYDLIHANGLFSLYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRW+ KL+DHEDGPLVPEKILVAVK YW     N TS +
Sbjct  571   VRGMRWEAKLVDHEDGPLVPEKILVAVKVYWVGTSKNKTSTE  612



>ref|XP_002460211.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
 gb|EER96732.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
Length=618

 Score =   389 bits (999),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/281 (65%), Positives = 218/281 (78%), Gaps = 7/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK SEKGE+AIW++R++ +SC + Q++S    C+S +PDDVWYKKM  C+TP 
Sbjct  339   IADLLCWEKVSEKGEMAIWRKRVNTESCPSRQEESTVQMCESTNPDDVWYKKMKACVTPL  398

Query  953   PKANIDES------FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
             P    DES       K FP RL A+PPRIANGL+ GVS++A+  DNK WKKHV AY  +N
Sbjct  399   PDVK-DESEVAGGAIKPFPARLNAVPPRIANGLIPGVSSQAFQKDNKMWKKHVKAYSSVN  457

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             K + TGRYRNIMDMNAG GGFAA + SPK WVMNVVPTIA   TLG +YERG+IGIYHDW
Sbjct  458   KYLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDW  517

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CE FSTYPRTYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L KV  
Sbjct  518   CEAFSTYPRTYDLIHASGLFTLYKNKCSMEDILLEMDRILRPEGAVIIRDDVDILTKVNS  577

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             +  GMRW+ K++DHEDGPLV EKIL AVK+YW   +  + +
Sbjct  578   LALGMRWNTKMVDHEDGPLVREKILYAVKQYWVGGNQTAVA  618



>ref|XP_004499422.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=502

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/274 (65%), Positives = 223/274 (81%), Gaps = 6/274 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIW++ ++ D C   ++ S+ T C+S + DDVWYKKM+ C+TP+ 
Sbjct  234   AKLLCWEKKHEKGEIAIWRKALNNDEC---EQDSQPTICESTNSDDVWYKKMENCVTPAK  290

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +    S+K FPERL  +P RI +G V GVS E + +D + WKKHV+AYKR+NKIID+GR
Sbjct  291   PSG---SWKPFPERLKVVPSRITSGSVPGVSTEVFQEDVRLWKKHVNAYKRVNKIIDSGR  347

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRN+MDMNAGLG FAA + SPK WVMNVVPTIA+K+ LGVI+ERG+IGIYHDWCE FSTY
Sbjct  348   YRNVMDMNAGLGSFAAAIDSPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTY  407

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+F+LYK++C+ EDILLEMDRILRPEGAV+FRD+V  L +V+RI  GMRW
Sbjct  408   PRTYDLIHANGLFTLYKNQCNAEDILLEMDRILRPEGAVIFRDQVGVLKQVKRIAKGMRW  467

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             + K++DHEDGPL+ EK+L AVK+YW   +  ++S
Sbjct  468   NTKMVDHEDGPLISEKVLYAVKQYWVAGNNTTSS  501



>ref|XP_004956815.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
 ref|XP_004956816.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=615

 Score =   388 bits (997),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 216/280 (77%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK SEKGE+AIW++R++ +SC + Q +S    C+S +PDDVWYKKM  C+TP 
Sbjct  336   IADLLCWEKVSEKGEMAIWRKRVNTESCPSRQGESTVQMCESTNPDDVWYKKMKACVTPV  395

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P           + K FP+RL A+PPRIANGL+ G+S++A+  DNK WKKHV AY  +NK
Sbjct  396   PDVKDGSEVAGGAIKPFPDRLNAVPPRIANGLIPGISSQAFQKDNKMWKKHVKAYSAVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRN+MDMNAG GGFAA + SPK WVMNVVPTIA   TLG +YERG+IGIYHDWC
Sbjct  456   YLLTGRYRNVMDMNAGFGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L KV  +
Sbjct  516   EAFSTYPRTYDLIHASGLFTLYKNKCSMEDILLEMDRILRPEGAVIVRDDVDVLTKVNSL  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW+ KL+DHEDGPLV EKIL AVK+YW   +  + +
Sbjct  576   AQGMRWNTKLVDHEDGPLVGEKILYAVKQYWVGGNQTAVA  615



>ref|XP_010919849.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=613

 Score =   387 bits (995),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 177/280 (63%), Positives = 224/280 (80%), Gaps = 6/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A++LCWEKK EKG+IAIW++ ++ D+C   +  S  T C++ + DDVWYKKM+VCITP 
Sbjct  335   LAEMLCWEKKYEKGDIAIWKKEVNADACHRRKDLSVRT-CKTANSDDVWYKKMEVCITPF  393

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N  +       K+FP+RL+A+PPRIA G V GV+ +AY +D   WKKHV+AYK++N 
Sbjct  394   PAVNNQDEVAGGQLKRFPDRLSAVPPRIAGGYVPGVTKQAYEEDKTLWKKHVNAYKKMNN  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I +GRYRNIMDMNAG G FAA + SPK WVMNVVPTI++  TLG+IYERG+IGIYHDWC
Sbjct  454   LISSGRYRNIMDMNAGFGSFAAAIESPKSWVMNVVPTISEIDTLGIIYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLYK+KC+ EDILLEMDRILRPEG+V+ RD+VD L KV+++
Sbjct  514   EAFSTYPRTYDLIHASGLFSLYKNKCEMEDILLEMDRILRPEGSVILRDDVDVLNKVKKM  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             + GMRW  K++DHEDGPLVPEKIL+ VK+YW  N  N TS
Sbjct  574   VSGMRWKTKMLDHEDGPLVPEKILITVKQYWVGNGGNYTS  613



>ref|XP_010494834.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=621

 Score =   388 bits (996),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 216/271 (80%), Gaps = 9/271 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEKK EKG+IAIW+++ +  SC    + S    C+  D DDVWYK+M+VC+TP 
Sbjct  340   IAKSLCWEKKYEKGDIAIWRKKTNDRSC---DRPSSVKTCKGKDTDDVWYKEMEVCVTPF  396

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK +  E       KKFPERL ++PP IA GL+ GV+AE+Y +DNK WKK  S YKRIN+
Sbjct  397   PKVSNKEEVAGGKLKKFPERLFSVPPCIAKGLIEGVNAESYHEDNKLWKKRTSTYKRINR  456

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPTIA K+TL V+YERG+IGIYHDWC
Sbjct  457   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLSVVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VRRI
Sbjct  516   EGFSTYPRTYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
               GMRWD KLMDHEDGPLVPEKILVAVK+YW
Sbjct  576   TKGMRWDTKLMDHEDGPLVPEKILVAVKQYW  606



>gb|KEH33485.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=606

 Score =   387 bits (994),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 223/274 (81%), Gaps = 5/274 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIW++ +++D C   ++ ++ T C+S + DDVWYKKMD C+TP+ 
Sbjct  338   AKLLCWEKKHEKGEIAIWRKALNIDEC--GEQNTQPTICESSNSDDVWYKKMDNCVTPAK  395

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +    ++K FPERL  +P RI +G V  VS + + DD++ WKKHV+AYKR+NKIID+GR
Sbjct  396   PSG---AWKPFPERLNVVPTRITSGSVPHVSTQLFEDDSRLWKKHVNAYKRVNKIIDSGR  452

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRN+MDMNAG G FAA L SPK WVMNVVPTIA+K+TLGV++ERG+IGIYHDWCE FSTY
Sbjct  453   YRNVMDMNAGFGSFAAALDSPKLWVMNVVPTIAEKATLGVVFERGLIGIYHDWCEAFSTY  512

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVF+LYK+ C+ EDILLEMDRILRPEGAV+FRD+V  L +V+RI  GMRW
Sbjct  513   PRTYDLIHANGVFTLYKNACNAEDILLEMDRILRPEGAVIFRDQVGVLKQVKRIAKGMRW  572

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             + K++DHEDGPL+ EK+L AVK+YW   D  +++
Sbjct  573   NTKMVDHEDGPLISEKVLYAVKRYWVAGDNTTST  606



>ref|XP_004299370.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   387 bits (994),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 219/281 (78%), Gaps = 9/281 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLL WEKK EKGEIAIW++R+         +  + T C S + DDVWYKKM++C+TPSP
Sbjct  331   AKLLGWEKKHEKGEIAIWRKRLGFHH----DQDPQPTMCDSRNADDVWYKKMELCVTPSP  386

Query  950   KANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             +  + +     ++K +PERL  +P  I+ G V GVSA+ + DDNK WKKHVSAYKR NK+
Sbjct  387   ETIVHDEDGGIAWKPYPERLNVLPSGISTGSVPGVSADTFQDDNKAWKKHVSAYKRTNKL  446

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG G FAA L SPK WVMNV+PTIA+K TLGVIYERG+IGIYHDWCE
Sbjct  447   LDTGRYRNIMDMNAGFGSFAAALDSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCE  506

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIHANG+FSLYKDKCD EDILLEMDRILRPEGA + RD +D L KV R +
Sbjct  507   AFSTYPRTYDLIHANGIFSLYKDKCDAEDILLEMDRILRPEGAAIIRDHMDVLAKVSRTV  566

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
              GMRW  K++DHEDGPLV EK+L AVK+YW  ++ NSTS +
Sbjct  567   KGMRWKTKIVDHEDGPLVTEKVLFAVKQYWVADENNSTSTE  607



>ref|XP_010441570.1| PREDICTED: probable methyltransferase PMT14, partial [Camelina 
sativa]
Length=404

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/271 (68%), Positives = 215/271 (79%), Gaps = 9/271 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEKK EKG+IAIW+++ +  SC    + S    C+  D DDVWY +M+VC+TP 
Sbjct  126   IAKSLCWEKKYEKGDIAIWRKKTNDRSC---DRPSSLKTCKGKDTDDVWYNEMEVCVTPF  182

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL ++PP I  GL  GV+AE+Y +D+K WKK +SAYKRIN+
Sbjct  183   PKVSNNEEVAGGKLKKFPERLFSVPPCITKGLTEGVTAESYHEDSKLWKKRLSAYKRINR  242

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPT+A K+TL V+YERG+IGIYHDWC
Sbjct  243   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTVA-KNTLSVVYERGLIGIYHDWC  301

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VRRI
Sbjct  302   EGFSTYPRTYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRRI  361

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
               GMRWD KLMDHE+ PLVPEKILVAVK+YW
Sbjct  362   TKGMRWDTKLMDHENSPLVPEKILVAVKQYW  392



>gb|KJB08228.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=617

 Score =   387 bits (994),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 220/271 (81%), Gaps = 3/271 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK  E G+IA+W++R + D CR  Q+ +K   C+   PDDVWYKKM+ C+TP 
Sbjct  336   IARLLCWEKLDELGDIAVWKKRTNYDLCR--QQDTKPNLCEPSYPDDVWYKKMEACVTPY  393

Query  953   PKANID-ESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDT  777
             PK+    E +K FP+RL AIPPRI++G V GVS + Y +D + W+KHV +YK IN +ID+
Sbjct  394   PKSTKSYEEWKPFPDRLNAIPPRISSGSVPGVSVDMYQEDIQIWEKHVKSYKSINNLIDS  453

Query  776   GRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFS  597
             GR+RNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI +RG+IGIYHDWCE FS
Sbjct  454   GRFRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVISDRGLIGIYHDWCEAFS  513

Query  596   TYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGM  417
             TYPRTYDLIHANG+FSLYKDKC  EDILLEMDRILRPEG+V+ RD V+ L+KV++I+GGM
Sbjct  514   TYPRTYDLIHANGIFSLYKDKCKAEDILLEMDRILRPEGSVIIRDNVNVLVKVKKIVGGM  573

Query  416   RWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             RWD +++DHEDGPLV EK+L AVKKYW + D
Sbjct  574   RWDARMVDHEDGPLVSEKVLFAVKKYWVVGD  604



>ref|XP_009114343.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=624

 Score =   386 bits (991),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 220/280 (79%), Gaps = 7/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW+++ +  SCR S    K   C+  D DD+W K M+VC+TP 
Sbjct  343   IAESLCWEKKYEKGDIAIWRKKTNDRSCRMSSSYVKT--CKGKDTDDIWNKTMEVCVTPF  400

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK + D   KKFPERL ++PP +  GLV GV+ E+Y +DNK WKK VS YKRIN++I + 
Sbjct  401   PKVSSDVEVKKFPERLFSVPPCVTKGLVEGVNVESYQEDNKLWKKRVSNYKRINRLIGSS  460

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRN+MDMNAGLGGFAA L S + WVMNVVPTIA K+TL V++ERG+IGIYHDWCEGFST
Sbjct  461   RYRNVMDMNAGLGGFAAALESSESWVMNVVPTIA-KNTLSVVFERGLIGIYHDWCEGFST  519

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHAN VFSLY+++C+ EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMR
Sbjct  520   YPRTYDLIHANNVFSLYQNRCNVEDILLEMDRILRPEGTVLFRDEVDVLNDVRKIAKGMR  579

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLND----TNSTSA  306
             WD KLMDHEDGPLVPEKILVAVK+YW   D     NSTS 
Sbjct  580   WDTKLMDHEDGPLVPEKILVAVKQYWVAGDGGNVRNSTST  619



>ref|XP_004245869.1| PREDICTED: probable methyltransferase PMT14 [Solanum lycopersicum]
Length=616

 Score =   386 bits (991),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 224/279 (80%), Gaps = 10/279 (4%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A+LLCWEKK EKG++AIW++ ++  SCR    ++ A  CQ+ D D+VWYKKMD CITP P
Sbjct  339   AELLCWEKKYEKGDVAIWRKNINGKSCR----RASANICQTKDADNVWYKKMDACITPYP  394

Query  950   KA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
                N DE      KKFP RL A+PPRIAN LVSGV+ E+Y +DNK WKKHV++YKR   +
Sbjct  395   DVKNSDEVAGGELKKFPARLFAVPPRIANDLVSGVTVESYEEDNKLWKKHVTSYKRSISL  454

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             + T RY NIMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWCE
Sbjct  455   LGTTRYHNIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCE  513

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
             GFSTYPRTYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEGAV+ RD V+ L KVR+I 
Sbjct  514   GFSTYPRTYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGAVILRDGVEVLNKVRKIA  573

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
              G+RWD KL+DHEDGPLVPEKI VAVK+Y+   D + ++
Sbjct  574   AGLRWDTKLLDHEDGPLVPEKIFVAVKQYFVEGDEDQST  612



>emb|CDY03207.1| BnaC09g19490D [Brassica napus]
Length=622

 Score =   386 bits (991),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 219/280 (78%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW+++ +  SC  S   S    C+  D DDVW K M+VC+TP 
Sbjct  343   IAESLCWEKKYEKGDIAIWRKKTNDRSCNKSSSSSSFKTCKGQDTDDVWNKTMEVCVTPF  402

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK + D    KFPERL ++PPR+  GLV GV+ E+Y +DNK W+K VS YKRIN++I + 
Sbjct  403   PKVSSDVEVMKFPERLFSVPPRVTKGLVEGVNVESYQEDNKLWRKRVSNYKRINRLIGST  462

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRN+MDMNAGLGGFAA L S + WVMNVVPTIA K+TL V++ERG+IGIYHDWCEGFST
Sbjct  463   RYRNVMDMNAGLGGFAAALESTESWVMNVVPTIA-KNTLSVVFERGLIGIYHDWCEGFST  521

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHAN VFSLY+++C+ EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMR
Sbjct  522   YPRTYDLIHANNVFSLYQNRCNVEDILLEMDRILRPEGTVLFRDEVDVLNDVRKIANGMR  581

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLND----TNSTSA  306
             WD KLMDHEDGPLVPEKILVAVKKYW   D     NSTS 
Sbjct  582   WDTKLMDHEDGPLVPEKILVAVKKYWVAGDGVSVGNSTST  621



>ref|XP_003523024.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Glycine 
max]
Length=606

 Score =   385 bits (989),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 222/275 (81%), Gaps = 6/275 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIW++++  D    S++ ++   C++ + DDVWYKKM  C+TPS 
Sbjct  338   AKLLCWEKKYEKGEIAIWRKKLHND---CSEQDTQPQICETKNSDDVWYKKMKDCVTPSK  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +     +K F ERL  +P RI +G V GVS EA+ +DN+ WKKHV+AYKRINKII +GR
Sbjct  395   PSG---PWKPFQERLNVVPSRITSGFVPGVSEEAFEEDNRLWKKHVNAYKRINKIISSGR  451

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ERG+IGIYHDWCE FSTY
Sbjct  452   YRNIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTY  511

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVFSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L++V+ I+ GMRW
Sbjct  512   PRTYDLIHANGVFSLYKNVCNVEDILLEMDRILRPEGAVIFRDQADVLMQVKGIVKGMRW  571

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             + K++DHEDGPLV EK+L AVK+YW   D +++SA
Sbjct  572   NTKMVDHEDGPLVSEKVLFAVKQYWVAGDNSTSSA  606



>gb|KHN21848.1| Putative methyltransferase PMT2 [Glycine soja]
Length=606

 Score =   385 bits (988),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 221/275 (80%), Gaps = 6/275 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIW++++  D    S++ ++   C++ + DDVWYKKM  C+TPS 
Sbjct  338   AKLLCWEKKYEKGEIAIWRKKLHND---CSEQDTQPQICETKNSDDVWYKKMKDCVTPSK  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +     +K F ERL  +P RI +G V GVS EA+ +DN+ WKKHV+AYKRINKII +GR
Sbjct  395   PSG---PWKPFQERLNVVPSRITSGFVPGVSEEAFEEDNRLWKKHVNAYKRINKIISSGR  451

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ERG+IGIYHDWCE FSTY
Sbjct  452   YRNIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTY  511

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVFSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L++V+ I+ GMRW
Sbjct  512   PRTYDLIHANGVFSLYKNVCNVEDILLEMDRILRPEGAVIFRDQADVLMQVKGIVKGMRW  571

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
             + K++DHEDGPLV EK+L AVK+YW   D  ++SA
Sbjct  572   NTKMVDHEDGPLVSEKVLFAVKQYWVAGDNTTSSA  606



>ref|XP_008651354.1| PREDICTED: uncharacterized protein LOC100279910 isoform X1 [Zea 
mays]
 tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays]
Length=615

 Score =   385 bits (988),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/271 (66%), Positives = 212/271 (78%), Gaps = 5/271 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK SEKGE+AIW++R++ +SC + Q++S    C+S +PDDVWYKKM  C+TP 
Sbjct  336   IADLLCWEKVSEKGEMAIWRKRVNTESCPSRQEESAVQMCESTNPDDVWYKKMKACVTPL  395

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P    +      + K FP RL A+PPRIANGLV GVS++A+  DNK WKKHV +Y  +NK
Sbjct  396   PDVKDENDVAGGAIKPFPARLNAVPPRIANGLVPGVSSQAFQKDNKMWKKHVKSYSSVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +YERG+IGIYHDWC
Sbjct  456   YLLTGRYRNIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +
Sbjct  516   EAFSTYPRTYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSL  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
               GMRWD K++DHEDGPLV EKIL AVK+YW
Sbjct  576   ALGMRWDTKMVDHEDGPLVREKILYAVKQYW  606



>ref|NP_001152470.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG47777.1| ankyrin protein kinase-like [Zea mays]
Length=615

 Score =   385 bits (988),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/271 (66%), Positives = 212/271 (78%), Gaps = 5/271 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK SEKGE+AIW++R++ +SC + Q++S    C+S +PDDVWYKKM  C+TP 
Sbjct  336   IADLLCWEKVSEKGEMAIWRKRVNTESCPSRQEESAVQMCESTNPDDVWYKKMKACVTPL  395

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P    +      + K FP RL A+PPRIANGLV GVS++A+  DNK WKKHV +Y  +NK
Sbjct  396   PDVKDENDVAGGAIKPFPARLNAVPPRIANGLVPGVSSQAFQKDNKMWKKHVKSYSSVNK  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +YERG+IGIYHDWC
Sbjct  456   YLLTGRYRNIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +
Sbjct  516   EAFSTYPRTYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSL  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
               GMRWD K++DHEDGPLV EKIL AVK+YW
Sbjct  576   ALGMRWDTKMVDHEDGPLVREKILYAVKQYW  606



>gb|EMS49438.1| putative methyltransferase PMT2 [Triticum urartu]
Length=614

 Score =   384 bits (987),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/280 (64%), Positives = 217/280 (78%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLLCWEK SEKGE AIW++R++ +SC +  ++S    C+S + DDVWYKKM  C+TP 
Sbjct  335   MAKLLCWEKVSEKGETAIWRKRVNTESCPSRLEESTVQMCESTNADDVWYKKMKACVTPL  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P   N  E    + + FP RL AIPPRI+NGL+ GVS++AY  DNK WKKHV AY  +NK
Sbjct  395   PDVENPSEVAGGAIEPFPSRLNAIPPRISNGLIPGVSSQAYQKDNKMWKKHVKAYSNVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + SPK WVMNVVPTIA  +TLG +YERG+IGIYHDWC
Sbjct  455   YLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNVVPTIAKIATLGAVYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LY +KC  EDILLEMDRILRPEGAV+ RD+VD L KV ++
Sbjct  515   EAFSTYPRTYDLIHASGLFTLYSNKCSMEDILLEMDRILRPEGAVIMRDDVDVLTKVNKL  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW+ KL+DHEDGPLV EK+L AVK+YW   +  + S
Sbjct  575   ARGMRWNTKLVDHEDGPLVREKVLYAVKQYWVGGNQTAAS  614



>ref|XP_004499421.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
Length=606

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/276 (65%), Positives = 226/276 (82%), Gaps = 7/276 (3%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK EKGEIAIW++ ++ D C   ++ S+ T C+S + DDVWYKKM+ C+TP+ 
Sbjct  338   AKLLCWEKKHEKGEIAIWRKALNNDEC---EQDSQPTICESTNSDDVWYKKMENCVTPAK  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              +    S+K FPERL  +P RI +G V GVS E + +D + WKKHV+AYKR+NKIID+GR
Sbjct  395   PSG---SWKPFPERLKVVPSRITSGSVPGVSTEVFQEDVRLWKKHVNAYKRVNKIIDSGR  451

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRN+MDMNAGLG FAA + SPK WVMNVVPTIA+K+ LGVI+ERG+IGIYHDWCE FSTY
Sbjct  452   YRNVMDMNAGLGSFAAAIDSPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTY  511

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+F+LYK++C+ EDILLEMDRILRPEGAV+FRD+V  L +V+RI  GMRW
Sbjct  512   PRTYDLIHANGLFTLYKNQCNAEDILLEMDRILRPEGAVIFRDQVGVLKQVKRIAKGMRW  571

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + K++DHEDGPL+ EK+L AVK+YW   + N+TS++
Sbjct  572   NTKMVDHEDGPLISEKVLYAVKQYWVAGN-NTTSSE  606



>ref|XP_003578117.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=614

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/280 (64%), Positives = 215/280 (77%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SEKGE AIW++R++ +SC + Q++     C+S + DD WYKKM  C+TP 
Sbjct  335   IAELLCWEKVSEKGETAIWRKRINTESCPSRQEEPTVQMCESTNADDAWYKKMKACVTPL  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P   N  E    + K FP RL  IPPRIANGL+ GVS +AY  DNK WKKHV AY  +NK
Sbjct  395   PDVENASEVAGGAIKPFPSRLNTIPPRIANGLIQGVSTQAYQKDNKMWKKHVKAYSSVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + SPK WVMNVVPT A  +TLG +YERG+IGIYHDWC
Sbjct  455   YLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNVVPTSAKIATLGAVYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L+KV ++
Sbjct  515   EAFSTYPRTYDLIHASGLFTLYKNKCSNEDILLEMDRILRPEGAVIMRDDVDVLMKVNKL  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW+ KL+DHEDGPLV EK+L AVK+YW   +  + S
Sbjct  575   ARGMRWNTKLVDHEDGPLVREKVLYAVKQYWVGGNQTAAS  614



>ref|XP_007138189.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
 gb|ESW10183.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
Length=607

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/277 (65%), Positives = 226/277 (82%), Gaps = 6/277 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAKLLCWEKK EKGEIAIW++++    C  ++++ + T C++ + DDVWYKKM+ C+TPS
Sbjct  337   IAKLLCWEKKYEKGEIAIWKKKLQSGDC--TEREIQPTTCENTNSDDVWYKKMENCVTPS  394

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
                     +K F ERL A+P RI +G V GVS EA+ +DN+ WKKHV+AYKRINK++ +G
Sbjct  395   KPGG---PWKTFLERLNAVPSRITSGSVPGVSVEAFEEDNRLWKKHVNAYKRINKLLSSG  451

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FST
Sbjct  452   RYRNIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFVRGLIGIYHDWCEAFST  511

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L+KV++I+ GMR
Sbjct  512   YPRTYDLIHANGLFSLYKNGCNAEDILLEMDRILRPEGAVIFRDQADVLLKVKKIVKGMR  571

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             W+ K++DHEDGP+V EK+L AVK+YW   D N+TS++
Sbjct  572   WNTKMVDHEDGPMVSEKMLFAVKQYWVAGD-NTTSSE  607



>ref|XP_009369302.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=611

 Score =   384 bits (985),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 226/282 (80%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLL WEKK EKGEIAIW+ ++     R  Q   +   C+S + DDVWY+KM++C+TP 
Sbjct  332   VAKLLNWEKKYEKGEIAIWR-KLTTSEYRRDQD-PQLNMCESNNADDVWYQKMELCVTPY  389

Query  953   PK---ANIDES--FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+   AN D    +K FPERL A+P RI++  V  VSAE + +DNK WKKHV+AYKR NK
Sbjct  390   PETSDANEDAGGPWKPFPERLNALPFRISSDSVPDVSAETFQEDNKAWKKHVNAYKRTNK  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ERG+IGIYHDWC
Sbjct  450   LMDTGRYRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD +D L+KV ++
Sbjct  510   EAFSTYPRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKL  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRW+ K++DHEDGPLVPEK+L AVK+YW   +  +T+++
Sbjct  570   VRGMRWNTKMVDHEDGPLVPEKVLFAVKQYWVAGEDKATTSE  611



>ref|XP_008660000.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Zea mays]
Length=383

 Score =   375 bits (964),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW +R++  SC   Q       C      DVWYKKM+VC+TP 
Sbjct  106   FAQLLCWKKVSEKDGIAIWTKRLNDKSCSMKQDNPNGGKCDLTSDSDVWYKKMEVCMTPL  165

Query  953   PKAN-IDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N +DE      + FP+RL A+PPRI +G V G S E+Y +DN  W+KHV AYK+IN 
Sbjct  166   PEVNSVDEVAGGQLEPFPKRLYAVPPRITDGSVPGFSVESYEEDNNLWRKHVKAYKKINN  225

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIYERG+IG+YHDWC
Sbjct  226   LLDTGRYRNIMDMNAGLGSFAAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWC  285

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIH+N +FSLY++KC FEDILLEMDRILRPEGA++ RD+VD L+KV +I
Sbjct  286   EGFSTYPRTYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKI  345

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                MRW  +L DHE GP VPEKIL AVK+YWT   T+S
Sbjct  346   ANAMRWKTRLADHEGGPHVPEKILFAVKQYWTAEKTSS  383



>gb|EMT27426.1| hypothetical protein F775_29617 [Aegilops tauschii]
Length=614

 Score =   383 bits (984),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 217/280 (78%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+LLCWEK SEKGE AIW++R++ +SC +  ++S    C+S + DDVWYKKM  C+TP 
Sbjct  335   MAELLCWEKVSEKGETAIWRKRVNTESCPSRLEESTVQMCESTNADDVWYKKMKACVTPL  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P   N  E    + K FP RL A+PP+I+NGL+ GVS+EAY  DNK WKKHV AY  +NK
Sbjct  395   PDVQNPSEVAGGAIKPFPSRLNAVPPKISNGLIPGVSSEAYQKDNKMWKKHVKAYSNVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + SPK WVMNVVPTIA  +TLG +YERG+IGIYHDWC
Sbjct  455   YLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNVVPTIAKIATLGAVYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LY +KC  EDILLEMDRILRPEGAV+ RD+VD L KV ++
Sbjct  515   EAFSTYPRTYDLIHASGLFTLYSNKCSMEDILLEMDRILRPEGAVIMRDDVDVLTKVNKL  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW+ KL+DHEDGPLV EK+L AVK+YW   +  + S
Sbjct  575   ARGMRWNTKLVDHEDGPLVREKVLYAVKQYWVGGNQTAAS  614



>ref|XP_010668105.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/280 (66%), Positives = 221/280 (79%), Gaps = 10/280 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+LLCWEKKS+KGEIAIW++R   ++CR  ++ S+ T C S    DVWYKKM+ CITP 
Sbjct  330   MAELLCWEKKSQKGEIAIWRKR---ENCR--ERVSRVTMCDSQYTTDVWYKKMEACITPY  384

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+    +      +K FP+RL A P RI +G V GVS EAY DD K W KHV  YKR+NK
Sbjct  385   PETRSSDGISGGEWKPFPDRLNATPYRIESGAVHGVSVEAYQDDIKLWTKHVKHYKRVNK  444

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA + SPK WVMNVVPTI++K TLGV+YERG+IGIYHDWC
Sbjct  445   LLDTGRYRNIMDMNAGLGSFAAAIDSPKLWVMNVVPTISEKDTLGVLYERGLIGIYHDWC  504

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA G+FSLYK+KC+ EDILLEMDR+LRPEGAV+FRDEVD L+KV+RI
Sbjct  505   EAFSTYPRTYDLIHAYGLFSLYKNKCNTEDILLEMDRMLRPEGAVIFRDEVDVLMKVKRI  564

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRW+ K++DHEDGPL  EK+L  VK+YW  +  NSTS
Sbjct  565   AAGMRWNTKMIDHEDGPLHTEKVLFIVKQYWVASGNNSTS  604



>ref|XP_006358580.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358581.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/279 (66%), Positives = 221/279 (79%), Gaps = 10/279 (4%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A+LLCWEKK EKG++AIW++ ++  SCR    ++ A  CQ+ D D+VWYKKMD CITP P
Sbjct  339   AELLCWEKKYEKGDVAIWRKNINGKSCR----RTSANICQTKDADNVWYKKMDACITPYP  394

Query  950   KA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
                N DE      KKFP RL A+PPRIAN +V GV+ E+Y +DNK WKKHV++YKR   +
Sbjct  395   DVKNSDEVAGGELKKFPARLFAVPPRIANEMVPGVTVESYQEDNKLWKKHVTSYKRSISL  454

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             + T RY NIMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWCE
Sbjct  455   LGTTRYHNIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCE  513

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
             GFSTYPRTYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEGAV+ RD V+ L KVR+I 
Sbjct  514   GFSTYPRTYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGAVILRDGVEVLNKVRKIA  573

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
              G+RWD KL+DHEDGPLVPEKI VAVK+Y    D   ++
Sbjct  574   AGLRWDTKLLDHEDGPLVPEKIFVAVKQYVVEGDEEQST  612



>gb|EAZ09099.1| hypothetical protein OsI_31366 [Oryza sativa Indica Group]
Length=616

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/281 (63%), Positives = 215/281 (77%), Gaps = 5/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK  E GE+AIW++R++ +SC + Q +S    C S + DDVWYKKM  C+TP 
Sbjct  335   IADLLCWEKVKEIGEMAIWRKRLNTESCPSRQDESSVQMCDSTNADDVWYKKMKPCVTPI  394

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N        + K FP RL A+PPRIANGL+ GVS++AY  D K WKKHV AY  +NK
Sbjct  395   PDVNDPSEVAGGAIKPFPSRLNAVPPRIANGLIPGVSSQAYQKDIKMWKKHVKAYSSVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + SPK WVMNVVPTI+  STLG IYERG+IGIYHDWC
Sbjct  455   YLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNVVPTISKMSTLGAIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK+KC+ EDILLEMDR+LRPEGAV+ RD+VD L KV R+
Sbjct  515   EAFSTYPRTYDLIHASGLFTLYKNKCNMEDILLEMDRVLRPEGAVIMRDDVDILTKVNRL  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
               GM+W+ +L+DHEDGP+V EK+L AVK+YW   +  + +A
Sbjct  575   ALGMKWNTRLVDHEDGPMVREKVLYAVKQYWVGGNQTAAAA  615



>emb|CDY35169.1| BnaA09g18060D [Brassica napus]
Length=725

 Score =   384 bits (987),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 219/280 (78%), Gaps = 5/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW+++ +  SCR S   S    C+  D DD+W K M+VC+TP 
Sbjct  442   IAESLCWEKKYEKGDIAIWRKKTNDRSCRMSSSSSSVKTCKGKDTDDIWNKTMEVCVTPF  501

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             PK + D   KKFPERL ++PP +  GLV GV+ E+Y +DNK WKK VS YKRIN++I + 
Sbjct  502   PKVSSDVEVKKFPERLFSVPPCVTKGLVEGVNVESYQEDNKLWKKRVSNYKRINRLIGSS  561

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRN+MDMNAGLGGFAA L S + WVMNVVPTIA K++L V++ERG+IGIYHDWCEGFST
Sbjct  562   RYRNVMDMNAGLGGFAAALESSESWVMNVVPTIA-KNSLSVVFERGLIGIYHDWCEGFST  620

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHAN VFSLY+++C+ EDILLEMDRILRPEG V+ RDEVD L  VR+I  GMR
Sbjct  621   YPRTYDLIHANNVFSLYQNRCNVEDILLEMDRILRPEGTVILRDEVDALNDVRKIAKGMR  680

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLND----TNSTSA  306
             WD KLMDHEDGPLVPEKILVAVK+YW   D     NSTS 
Sbjct  681   WDTKLMDHEDGPLVPEKILVAVKQYWVAGDGGNVRNSTST  720



>ref|XP_006398351.1| hypothetical protein EUTSA_v10000856mg [Eutrema salsugineum]
 gb|ESQ39804.1| hypothetical protein EUTSA_v10000856mg [Eutrema salsugineum]
Length=521

 Score =   378 bits (970),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 215/273 (79%), Gaps = 10/273 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW+++ +  SC  S   S    C+  D DDVWYK+M+VC+TP 
Sbjct  233   IAESLCWEKKYEKGDIAIWRKKTNDISCDRSS--SSVQTCKGKDNDDVWYKEMEVCVTPF  290

Query  953   PKANIDES-------FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRI  795
             PK + +E         KKFPERL ++PP I  GLV GV+AE+Y +DNK WKK VS YKRI
Sbjct  291   PKVSNEEEEEVAGGKLKKFPERLFSVPPCITRGLVDGVNAESYQEDNKLWKKRVSNYKRI  350

Query  794   NKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHD  615
             N++I + RYRN+MDMNAGLGGFAA L S K WVMNVVPTIA+ +TL V++ERG+IGIYHD
Sbjct  351   NRLIGSTRYRNVMDMNAGLGGFAAALESSKCWVMNVVPTIAN-NTLSVVFERGLIGIYHD  409

Query  614   WCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVR  435
             WCEGFSTYPRTYDLIHAN VFSLY+  C  EDILLEMDRILRPEG V+FRDEVD L  VR
Sbjct  410   WCEGFSTYPRTYDLIHANNVFSLYQHSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVR  469

Query  434   RIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
             +I  GMRWD KLMDHEDGPLVPEKILVAVK+YW
Sbjct  470   KITNGMRWDTKLMDHEDGPLVPEKILVAVKRYW  502



>ref|XP_009587333.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana tomentosiformis]
Length=617

 Score =   381 bits (978),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/280 (65%), Positives = 226/280 (81%), Gaps = 9/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCWEKK EKG++AIW+++++  SC  S++KS A  CQ+ D D+VWYKKMD CITP 
Sbjct  338   FAELLCWEKKYEKGDVAIWRKKINGKSC--SRRKS-ANVCQTKDTDNVWYKKMDTCITPY  394

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  N DE      KKFP RL A+PPR+AN +V GV+ E+Y +DNK WKKHV++YKRI  
Sbjct  395   PEVQNSDEVAGGELKKFPARLFAVPPRVANEMVPGVTIESYQEDNKLWKKHVTSYKRIVS  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RY NIMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWC
Sbjct  455   LLGTTRYHNIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I
Sbjct  514   EGFSTYPRTYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               G+RW+ KL+DHEDGPLVPEKI VAVK+Y    D +  +
Sbjct  574   AAGLRWETKLVDHEDGPLVPEKIFVAVKQYHVEGDDDQNT  613



>gb|EMS63414.1| putative methyltransferase PMT2 [Triticum urartu]
Length=511

 Score =   377 bits (968),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/272 (66%), Positives = 210/272 (77%), Gaps = 5/272 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW++ ++  SC   Q  SK   C+     DVWYKKM+ CITP 
Sbjct  233   FAELLCWKKISEKDGIAIWRKTLNGKSCPRKQDNSKVAKCELTSESDVWYKKMEACITPL  292

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  ++ E      + FP+RL A+PPRIA G V G S + Y +DNK W+KHV+AYK+ N 
Sbjct  293   PEVKSVSEVAGGELEPFPQRLNAVPPRIARGFVPGFSVQTYQEDNKLWQKHVNAYKKTND  352

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNVVP IAD STLGVIYERG+IG+YHDWC
Sbjct  353   LLDTGRYRNIMDMNAGLGSFAAVLESPKLWVMNVVPFIADTSTLGVIYERGLIGMYHDWC  412

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLY++KC FEDILLEMDRILRPEGAV+ RD VD L+KV +I
Sbjct  413   EGFSTYPRTYDLIHANGVFSLYQNKCKFEDILLEMDRILRPEGAVIIRDMVDALVKVEKI  472

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT  333
                MRW+ +L DHE GP VPEKIL AVK+YWT
Sbjct  473   ANAMRWETRLADHEGGPRVPEKILFAVKQYWT  504



>ref|NP_001063174.1| Os09g0415700 [Oryza sativa Japonica Group]
 dbj|BAD28913.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAD29253.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF25088.1| Os09g0415700 [Oryza sativa Japonica Group]
 gb|EAZ44732.1| hypothetical protein OsJ_29364 [Oryza sativa Japonica Group]
Length=616

 Score =   380 bits (976),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 175/281 (62%), Positives = 214/281 (76%), Gaps = 5/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK  E GE+AIW++R++ +SC + Q +S    C S + DDVWYKKM  C+TP 
Sbjct  335   IADLLCWEKVKEIGEMAIWRKRLNTESCPSRQDESSVQMCDSTNADDVWYKKMKPCVTPI  394

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N        + K FP RL A+PPRIANGL+ GVS++AY  D K WKKHV AY  +NK
Sbjct  395   PDVNDPSEVAGGAIKPFPSRLNAVPPRIANGLIPGVSSQAYQKDIKMWKKHVKAYSSVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + SPK WVMN VPTI+  STLG IYERG+IGIYHDWC
Sbjct  455   YLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNAVPTISKMSTLGAIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK+KC+ EDILLEMDR+LRPEGAV+ RD+VD L KV R+
Sbjct  515   EAFSTYPRTYDLIHASGLFTLYKNKCNMEDILLEMDRVLRPEGAVIMRDDVDILTKVNRL  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
               GM+W+ +L+DHEDGP+V EK+L AVK+YW   +  + +A
Sbjct  575   ALGMKWNTRLVDHEDGPMVREKVLYAVKQYWVGGNQTAAAA  615



>gb|EMT05545.1| hypothetical protein F775_20122 [Aegilops tauschii]
Length=612

 Score =   380 bits (975),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 179/272 (66%), Positives = 211/272 (78%), Gaps = 5/272 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW++R++  SC   Q  SK   C+     DVWYKKM+ CITP 
Sbjct  334   FAELLCWKKISEKDGIAIWRKRLNDKSCPRKQDNSKVAKCELTSESDVWYKKMEACITPL  393

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  ++ E      + FP+RL A+PPRIA G V G S + Y +DNK W+KHV+AYK+ N 
Sbjct  394   PEVKSVSEVAGGELEPFPQRLNAVPPRIARGFVPGFSVQTYQEDNKLWQKHVNAYKKTND  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNVVP IAD STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNIMDMNAGLGSFAAVLESPKLWVMNVVPFIADTSTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANGVFSLY++KC FEDILLEMDRILRPEGAV+ RD VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHANGVFSLYQNKCKFEDILLEMDRILRPEGAVIIRDTVDALVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT  333
                MRW+ +L DHE GP VPEK+L AVK+YWT
Sbjct  574   ANAMRWETRLADHEGGPRVPEKMLFAVKQYWT  605



>ref|XP_010481446.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=618

 Score =   380 bits (975),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 183/271 (68%), Positives = 214/271 (79%), Gaps = 9/271 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK LCWEKK EKG+IAIW+++ +  SC    + S    C+  D DDVWY++M+VC+TP 
Sbjct  340   IAKSLCWEKKYEKGDIAIWRKKTNDRSC---DRPSSVKICKGKDTDDVWYREMEVCVTPF  396

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK +  E       KKFPERL ++PP I  GL+  V+AE+Y +DNK WKK +SAYKRIN+
Sbjct  397   PKVSNKEEVAGGKLKKFPERLFSVPPCITKGLIESVTAESYHEDNKLWKKRMSAYKRINR  456

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPTIA K+TL  +YERG+IGIYHDWC
Sbjct  457   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLSAVYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VRRI
Sbjct  516   EGFSTYPRTYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRRI  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
               GMR+D KLMDHEDGPLVPEKILV VK+YW
Sbjct  576   TKGMRYDTKLMDHEDGPLVPEKILVVVKQYW  606



>ref|XP_009413462.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=615

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/271 (65%), Positives = 215/271 (79%), Gaps = 5/271 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK  E  E AIW++R++ +SC   Q +     C++ +PDDVWYKKM  CI   
Sbjct  336   IAELLCWEKIYEMAEFAIWRKRINAESCTQRQDEIGVNICETTNPDDVWYKKMQPCINRY  395

Query  953   PKANIDESF-----KKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+    E F     K FP+RL A+PPRI++G V G S ++Y +D + W+KHV  YK+IN 
Sbjct  396   PEVGNPEEFAGGELKPFPQRLNAVPPRISSGSVPGFSVKSYHEDIRLWQKHVETYKKIND  455

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNI+DMNA LG FAA + SPK WVMNVVPTIA+ STLGVIYERG+IGIYHDWC
Sbjct  456   LLDTGRYRNILDMNARLGSFAAAIESPKLWVMNVVPTIAEISTLGVIYERGLIGIYHDWC  515

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLY++KC  EDILLEMDRILRPEGAV+ RD+VD L+KV+++
Sbjct  516   EAFSTYPRTYDLIHANGVFSLYQNKCKMEDILLEMDRILRPEGAVILRDDVDVLMKVKKM  575

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
             + GMRW+ KL+DHEDGPLVPEKILVAVK+YW
Sbjct  576   VTGMRWNTKLLDHEDGPLVPEKILVAVKQYW  606



>ref|XP_006650137.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=611

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              AKLLCW K SEK  IAIW++R++  SC   Q+      CQ  + +DVWYKKM+VC+TP 
Sbjct  334   FAKLLCWNKISEKDGIAIWRKRLNDKSCLMKQENPNFGKCQLANDNDVWYKKMEVCVTPL  393

Query  953   PKANI-----DESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            + FP+RL  +PPRIA+G   G S ++Y DDNK W+KHV+AYK++N 
Sbjct  394   PEVKTMTEVAGGQLEPFPQRLNTVPPRIAHGFAPGFSVQSYQDDNKLWQKHVNAYKKMND  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L S K WVMNVVPTIAD STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNIMDMNAGLGSFAAALESTKLWVMNVVPTIADTSTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY+++C FEDILLEMDRILRPEGAV+ RD+VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHANSVFSLYENRCKFEDILLEMDRILRPEGAVIVRDKVDVLVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                MRW  +L DHE GP VPEKILVAVK+YW +   +S
Sbjct  574   ANAMRWKTRLADHEGGPHVPEKILVAVKQYWVVESKSS  611



>ref|XP_006280182.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 ref|XP_006280183.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13080.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13081.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
Length=622

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/280 (65%), Positives = 218/280 (78%), Gaps = 9/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAIW+++ +  SC    + S    C+  D DD+WYK+M+VC+TP 
Sbjct  342   IAESLCWEKKYEKGDIAIWRKKTNDRSC---DRPSSVKTCKGKDADDIWYKEMEVCVTPF  398

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK +  +       KKFPERL ++PP I+ GL+ GV+A+ Y +DNK WKK +S YKRIN+
Sbjct  399   PKVSNKQEVAGGKLKKFPERLFSVPPCISKGLIEGVNADTYQEDNKLWKKRMSTYKRINR  458

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPTIA K+TL V+YERG+IGIYHDWC
Sbjct  459   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLSVVYERGLIGIYHDWC  517

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VR+I
Sbjct  518   EGFSTYPRTYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRKI  577

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               GMRWD KLMDHEDGPLVPEKILVAVK YW      +++
Sbjct  578   TKGMRWDTKLMDHEDGPLVPEKILVAVKHYWVAGGKENST  617



>ref|NP_001050233.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|AAL58254.1|AC084762_28 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96247.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12147.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|EAZ27118.1| hypothetical protein OsJ_11050 [Oryza sativa Japonica Group]
 gb|EEC75363.1| hypothetical protein OsI_11805 [Oryza sativa Indica Group]
Length=611

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW K SEK  IAIW++R++  SC   Q+  K   C+    +DVWYKKM+VC+TP 
Sbjct  334   FAELLCWNKISEKDGIAIWRKRINDKSCPMKQENPKVDKCELAYDNDVWYKKMEVCVTPL  393

Query  953   PKANI-----DESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            + FP+RL A+PPRI +G V G S ++Y DDNK W+KH++AYK+IN 
Sbjct  394   PEVKTMTEVAGGQLEPFPQRLNAVPPRITHGFVPGFSVQSYQDDNKLWQKHINAYKKINN  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L S K WVMNVVPTIAD STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNIMDMNAGLGSFAAALESTKLWVMNVVPTIADTSTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHANAVFSLYENKCKFEDILLEMDRILRPEGAVIIRDKVDVLVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                MRW  +L DHE GP VPEKIL AVK+YW +   +S
Sbjct  574   ANAMRWQTRLTDHEGGPHVPEKILFAVKQYWVVESKSS  611



>emb|CAH18000.1| Ankyrin protein kinase-like [Poa pratensis]
Length=613

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/280 (65%), Positives = 215/280 (77%), Gaps = 6/280 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK SEKGE AIW++R++ +SC +  ++S    C+S + DDVWYK M  C+TP 
Sbjct  334   IAELLCWEKVSEKGETAIWRKRVNTESCPSRHEESTVQMCKSTNADDVWYKTMKACVTPL  393

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P   N  E    + K FP RL AIPPRIANGL+ GVS++AY  DNK WKKHV AY  +NK
Sbjct  394   PDVENPSEVAGGAIKPFPSRLNAIPPRIANGLIPGVSSQAYEKDNKMWKKHVKAYSNVNK  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + SPK WVMNVVPTI   +TLG +Y RG+IGIYHDWC
Sbjct  454   YLLTGRYRNIMDMNAGFGGFAAAIESPKSWVMNVVPTIGKIATLGSVYGRGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L KV + 
Sbjct  514   EAFSTYPRTYDLIHASGLFTLYKNKCSLEDILLEMDRILRPEGAVIMRDDVDILTKVDKF  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT-LNDTNST  312
               GMRW+ +L+DHEDGPLV EK+L AVK+YW   N T ST
Sbjct  574   ARGMRWNTRLVDHEDGPLVREKVLYAVKQYWVGGNQTAST  613



>ref|XP_009793368.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana sylvestris]
Length=617

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 180/280 (64%), Positives = 224/280 (80%), Gaps = 9/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCWEKK EKG++AIW+++++  SC  S++KS A+ CQ+ D D+VWYKKMD CITP 
Sbjct  338   FAELLCWEKKYEKGDVAIWRKKINGKSC--SRRKS-ASICQTKDTDNVWYKKMDACITPY  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P     +       KKFP RL A+PPR+AN +V GV+ E+Y +DNK WKKHV++YKRI  
Sbjct  395   PDVQSSDEVAGGELKKFPARLFAVPPRVANEMVPGVTIESYQEDNKLWKKHVASYKRIIS  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RY NIMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWC
Sbjct  455   LLGTTRYHNIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I
Sbjct  514   EGFSTYPRTYDLLHANRLFTLYEDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               G+RW+ KL+DHEDGPLVPEKI VAVK+Y    D +  +
Sbjct  574   AAGLRWETKLVDHEDGPLVPEKIFVAVKQYHVEGDDDQNT  613



>ref|XP_008784684.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=612

 Score =   378 bits (970),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/280 (62%), Positives = 223/280 (80%), Gaps = 8/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A++LCWEKK EKG++AIW+++   ++C   +K      C++ + DDVWYKKM+VCITP 
Sbjct  336   LAEMLCWEKKYEKGDLAIWKKK--ANACH-RRKDLSPRMCKTANSDDVWYKKMEVCITPF  392

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N  +       ++FP+RL A+PPRIA G V GV+ EAY +D K WKKHV+AYK++N 
Sbjct  393   PAVNNQDEVAGGQLRRFPDRLFAVPPRIAGGYVPGVTKEAYEEDKKLWKKHVNAYKKMNN  452

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I +GRYRNIMDMNAG G FAA + SPK WVMNVVPTI++ +TLG+IYERG+IG+YHDWC
Sbjct  453   LISSGRYRNIMDMNAGFGSFAAAIESPKSWVMNVVPTISEINTLGIIYERGLIGMYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+FSLY++KC+ EDILLEMDRILRPEG+V+ RD+VD L KV++ 
Sbjct  513   EAFSTYPRTYDLIHASGLFSLYENKCEMEDILLEMDRILRPEGSVILRDDVDVLNKVKKT  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             + GMRW  K++DHEDGPLVPEKIL+AVK+YW  +  N TS
Sbjct  573   VSGMRWKTKMLDHEDGPLVPEKILIAVKQYWAGSGRNYTS  612



>ref|XP_006660624.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=616

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/281 (62%), Positives = 212/281 (75%), Gaps = 5/281 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA LLCWEK SEKGE+AIW++R++ +SC + Q +S    C S + DD+WYKKM  C+TP 
Sbjct  335   IADLLCWEKVSEKGEMAIWRKRLNTESCPSRQDESSVQMCDSTNTDDIWYKKMKPCVTPI  394

Query  953   PKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P  N        + K FP RL A+PPRIANGL+ GVS+ AY  DNK WKKHV AY  +NK
Sbjct  395   PDVNDPSEVAGGAIKPFPSRLNAVPPRIANGLIPGVSSRAYQKDNKMWKKHVKAYSSVNK  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
              + TGRYRNIMDMNAG GGFAA + S + WVMNVVPTI+  STLG IYERG+IGIYHDWC
Sbjct  455   YLLTGRYRNIMDMNAGFGGFAAAIESQRSWVMNVVPTISKISTLGAIYERGLIGIYHDWC  514

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHA+G+F++YK KC  EDILLEMDRILRPEGAV+ RD+VD L KV  +
Sbjct  515   EAFSTYPRTYDLIHASGLFTMYKTKCSMEDILLEMDRILRPEGAVIMRDDVDVLTKVNGL  574

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  306
               GM+W  +++DHEDGP+V EK+L AVK+YW   +  + +A
Sbjct  575   ALGMKWSTRMVDHEDGPMVREKVLYAVKQYWAGGNQTAAAA  615



>gb|KHN06856.1| Putative methyltransferase PMT2 [Glycine soja]
Length=221

 Score =   364 bits (934),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 194/225 (86%), Gaps = 4/225 (2%)
 Frame = -1

Query  977  MDVCITPSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR  798
            M+ CITP+PK     + K FP RL AIPPRIA+GLV GVS+E Y DDNKKWKKHV AYK+
Sbjct  1    MEACITPTPKVT-GGNLKPFPSRLYAIPPRIASGLVPGVSSETYQDDNKKWKKHVKAYKK  59

Query  797  INKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYH  618
             N+++D+GRYRNIMDMNAGLG FAA + S K WVMNVVPTIA+ +TLGVIYERG+IGIYH
Sbjct  60   TNRLLDSGRYRNIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYH  119

Query  617  DWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKV  438
            DWCE FSTYPRTYDLIHA+GVFSLYKDKC  EDILLEMDRILRPEGAV+FRDEVD LIKV
Sbjct  120  DWCEAFSTYPRTYDLIHAHGVFSLYKDKCKAEDILLEMDRILRPEGAVIFRDEVDVLIKV  179

Query  437  RRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
            ++I+GGMRWD K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  180  KKIVGGMRWDTKMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  221



>gb|AEX55231.1| putative cold-regulated protein [Allium sativum]
Length=324

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 210/268 (78%), Gaps = 0/268 (0%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
               AKLLCWEK SE  EIAIW++R+D +SC   Q+++  + C   D DDVWYKKM+VCI  
Sbjct  48    ATAKLLCWEKISEMDEIAIWRKRVDANSCTVKQEENPVSMCTLKDADDVWYKKMEVCINH  107

Query  956   SPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDT  777
              P++      K FPERLTAIPPRIA   +  +S+E+Y++D K WK +V+AYK++NK ID+
Sbjct  108   FPESYNAVDLKPFPERLTAIPPRIATNTIQEMSSESYMEDIKLWKNYVAAYKQVNKYIDS  167

Query  776   GRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFS  597
             GRYRNIMDMNAG+G FAA + SPK WVMNVVPTI++KSTLG++YERG+IGIYHDWCE FS
Sbjct  168   GRYRNIMDMNAGVGSFAAAIESPKLWVMNVVPTISEKSTLGIVYERGLIGIYHDWCEAFS  227

Query  596   TYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGM  417
             TYPRTYDLIHANGVFSLYKDKC  EDILLEMDRILRPEG+V+ RD+VD ++K++++  GM
Sbjct  228   TYPRTYDLIHANGVFSLYKDKCKMEDILLEMDRILRPEGSVIIRDDVDMVVKIKKMAKGM  287

Query  416   RWDYKLMDHEDGPLVPEKILVAVKKYWT  333
             RW+ K +D+  G     K+L  VK+YW 
Sbjct  288   RWNSKFIDNVVGSSNSTKVLFVVKQYWV  315



>dbj|BAH20410.1| AT4G18030 [Arabidopsis thaliana]
Length=420

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 215/276 (78%), Gaps = 9/276 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
             GIA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP
Sbjct  135   GIAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVDTCKRKDTDDVWYKEIETCVTP  191

Query  956   SPKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
              PK + +E       KKFPERL A+PP I+ GL++GV  E+Y +D   WKK V+ YKRIN
Sbjct  192   FPKVSNEEEVAGGKLKKFPERLFAVPPSISKGLINGVDEESYQEDINLWKKRVTGYKRIN  251

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             ++I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDW
Sbjct  252   RLIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDW  310

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CEGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+
Sbjct  311   CEGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRK  370

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             I+ GMRWD KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  371   IVDGMRWDTKLMDHEDGPLVPEKILVATKQYWVAGD  406



>ref|XP_008659999.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Zea mays]
Length=611

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW +R++  SC   Q       C      DVWYKKM+VC+TP 
Sbjct  334   FAQLLCWKKVSEKDGIAIWTKRLNDKSCSMKQDNPNGGKCDLTSDSDVWYKKMEVCMTPL  393

Query  953   PKAN-IDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N +DE      + FP+RL A+PPRI +G V G S E+Y +DN  W+KHV AYK+IN 
Sbjct  394   PEVNSVDEVAGGQLEPFPKRLYAVPPRITDGSVPGFSVESYEEDNNLWRKHVKAYKKINN  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNIMDMNAGLGSFAAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIH+N +FSLY++KC FEDILLEMDRILRPEGA++ RD+VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                MRW  +L DHE GP VPEKIL AVK+YWT   T+S
Sbjct  574   ANAMRWKTRLADHEGGPHVPEKILFAVKQYWTAEKTSS  611



>ref|XP_008356626.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=611

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/282 (64%), Positives = 223/282 (79%), Gaps = 7/282 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +AKLL WEKK EKGEIAIW+ ++     R  Q   +   C+S + DDVWY+KM++C+TP 
Sbjct  332   VAKLLNWEKKHEKGEIAIWR-KLTTSEYRRDQD-PQPNXCESNNADDVWYQKMELCVTPY  389

Query  953   PK---ANIDES--FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+   AN D    +  FPERL A+P RI++  V  VSAE + +DNK WKKHV+AYKR NK
Sbjct  390   PETSDANEDAGGPWIPFPERLNALPFRISSDSVPDVSAETFQEDNKAWKKHVNAYKRTNK  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DT RYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGV +ERG+IGIYHDWC
Sbjct  450   LMDTXRYRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVXFERGLIGIYHDWC  509

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             E FSTYPRTYDLIHANGVFSLY+DKC+ EDILLEMDRILRPEGAV+FRD +D L+KV ++
Sbjct  510   EAFSTYPRTYDLIHANGVFSLYRDKCNAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKL  569

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
             + GMRW+ K++DHEDGPLVPEK+L AVK+YW   +  ST+++
Sbjct  570   VRGMRWNTKMVDHEDGPLVPEKVLFAVKRYWVAGEDKSTTSE  611



>ref|XP_004986789.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=606

 Score =   376 bits (965),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/271 (64%), Positives = 215/271 (79%), Gaps = 4/271 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IAK+LCW+K  EK +IAIWQ++++  SC      + +  C+  D DDVWYKKM+ CITP 
Sbjct  335   IAKMLCWDKIHEKEDIAIWQKKVNSHSCHQMSGHA-SNMCKVQDADDVWYKKMESCITPP  393

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
              +A      KKFPERL+AIPPRI  G   GV+ E Y +D+K W+KHV+ YKR+NK+I + 
Sbjct  394   REA---AQLKKFPERLSAIPPRILEGHAPGVTEEGYEEDSKLWRKHVNTYKRVNKLIGSL  450

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA L SP+ WVMNVVPTI++++TLG+IYERG+IGIYHDWCE FST
Sbjct  451   RYRNIMDMNAGLGSFAAALDSPRSWVMNVVPTISERNTLGIIYERGLIGIYHDWCEAFST  510

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIH  G+FSLY++KCD EDILLEMDRILRPEGAV+ RD VD L KVR  +GGMR
Sbjct  511   YPRTYDLIHGYGIFSLYQNKCDVEDILLEMDRILRPEGAVILRDSVDVLNKVRSTVGGMR  570

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDT  321
             W  KL+DHEDGP VPEKIL++VK+YW+ +++
Sbjct  571   WKSKLLDHEDGPHVPEKILISVKEYWSSHES  601



>gb|ACA66248.1| putative methyltransferase [Nicotiana benthamiana]
Length=617

 Score =   376 bits (965),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 222/280 (79%), Gaps = 9/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCWEKK EKG++AIW+++++  SC  S++KS    CQ+ D D+VWYKKMD CITP 
Sbjct  338   FAELLCWEKKYEKGDVAIWRKKINGKSC--SRRKS-TKICQTKDTDNVWYKKMDACITPY  394

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P     +       KKFP RL A+PPR+AN +V GV+ E+Y +DNK WKKHV++YKRI  
Sbjct  395   PDVQSSDVVAGGELKKFPARLFAVPPRVANEMVPGVTIESYQEDNKLWKKHVASYKRIVS  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RY NIMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWC
Sbjct  455   LLGTTRYHNIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I
Sbjct  514   EGFSTYPRTYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               G+RW+ KL+DHEDGPLVPEKI +AVK+Y    D +  +
Sbjct  574   AAGLRWETKLVDHEDGPLVPEKIFIAVKQYHVEGDDDQNT  613



>gb|ACB54686.1| methyltransferase [Nicotiana benthamiana]
Length=617

 Score =   375 bits (964),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/280 (64%), Positives = 222/280 (79%), Gaps = 9/280 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCWEKK EKG++AIW+++++  SC  S++KS    CQ+ D D+VWYKKMD CITP 
Sbjct  338   FAELLCWEKKYEKGDVAIWRKKINGKSC--SRRKS-TKICQTKDTDNVWYKKMDACITPY  394

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P     +       KKFP RL A+PPR+AN +V GV+ E+Y +DNK WKKHV++YKRI  
Sbjct  395   PDVQSSDVVAGGELKKFPARLFAVPPRVANEMVPGVTIESYQEDNKLWKKHVASYKRIVS  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++ T RY NIMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+YERG+IGIYHDWC
Sbjct  455   LLGTTRYHNIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I
Sbjct  514   EGFSTYPRTYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
               G+RW+ KL+DHEDGPLVPEKI +AVK+Y    D +  +
Sbjct  574   AAGLRWETKLVDHEDGPLVPEKIFIAVKQYHVEGDDDQNT  613



>ref|XP_006414159.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
 gb|ESQ55612.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
Length=623

 Score =   375 bits (963),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 182/282 (65%), Positives = 219/282 (78%), Gaps = 10/282 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+M+ C+TP 
Sbjct  338   IAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVNTCKRKDTDDVWYKEMETCVTPF  394

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL A+PP ++ GL++GV AE Y +D K WKK V+AYKRIN+
Sbjct  395   PKVSSEEEVAGGKLKKFPERLFAVPPSVSKGLINGVDAETYQEDVKLWKKRVNAYKRINR  454

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI  K+TL V+YERG+IGIYHDWC
Sbjct  455   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTIT-KNTLSVVYERGLIGIYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I
Sbjct  514   EGFSTYPRTYDFIHASGVFSLYQHSCKIEDILLETDRILRPEGIVIFRDEVDVLNDVRKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTL-NDTNSTSA  306
               GMRWD KLMDHEDGPLVPEKILVAVK+YW    D NS S+
Sbjct  574   ADGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGGDGNSPSS  615



>emb|CDY70748.1| BnaCnng69650D, partial [Brassica napus]
Length=430

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 209/275 (76%), Gaps = 9/275 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+ AI++++++  SC    + +    C+  D DDVWYK+++ C+TP 
Sbjct  145   IAESLCWEKKYEKGDTAIFRKKINDRSC---DRSTPVNTCKRKDSDDVWYKEIETCVTPF  201

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL A+PP ++ GLVSGV AE Y +D K WKK V  YKRIN 
Sbjct  202   PKVSNEEEVAGGKLKKFPERLFALPPSVSKGLVSGVDAETYQEDVKLWKKRVGRYKRINS  261

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPTI  K TL V+YERG+IGIYHDWC
Sbjct  262   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIT-KKTLSVVYERGLIGIYHDWC  320

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFS+Y+  C  EDILLEMDRILRPEG V+ RDEVD L  VR+I
Sbjct  321   EGFSTYPRTYDFIHANGVFSMYQHSCKIEDILLEMDRILRPEGIVIIRDEVDVLNDVRKI  380

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
               GMRWD KLMDHEDGPLVPEKIL AVK+YW   D
Sbjct  381   ANGMRWDTKLMDHEDGPLVPEKILYAVKQYWVAGD  415



>ref|XP_004984213.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=611

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/278 (63%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW++R++  SC   Q   K   C+  + +DVWYKKM+VCITP 
Sbjct  334   FAELLCWKKISEKDGIAIWRKRLNDKSCSMKQDNPKIGKCELVNDNDVWYKKMEVCITPL  393

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N          + FP+RL A+PPRI  G + G S ++Y +DNK W+KHV AYK+ N 
Sbjct  394   PEVNSASEVAGGQLEPFPKRLNAVPPRITLGSMPGFSVQSYEEDNKLWQKHVKAYKKTNN  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRN+MDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNLMDMNAGLGSFAAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIH+N +FSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHSNAIFSLYQNKCKFEDILLEMDRILRPEGAVIVRDKVDALVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                MRW  +L DHEDGP VPEKIL AVK+YW     +S
Sbjct  574   ANAMRWKTRLADHEDGPHVPEKILFAVKQYWATTSKSS  611



>ref|XP_004984212.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
Length=619

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/278 (63%), Positives = 212/278 (76%), Gaps = 5/278 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW++R++  SC   Q   K   C+  + +DVWYKKM+VCITP 
Sbjct  342   FAELLCWKKISEKDGIAIWRKRLNDKSCSMKQDNPKIGKCELVNDNDVWYKKMEVCITPL  401

Query  953   PKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N          + FP+RL A+PPRI  G + G S ++Y +DNK W+KHV AYK+ N 
Sbjct  402   PEVNSASEVAGGQLEPFPKRLNAVPPRITLGSMPGFSVQSYEEDNKLWQKHVKAYKKTNN  461

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRN+MDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIYERG+IG+YHDWC
Sbjct  462   LLDTGRYRNLMDMNAGLGSFAAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWC  521

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIH+N +FSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I
Sbjct  522   EGFSTYPRTYDLIHSNAIFSLYQNKCKFEDILLEMDRILRPEGAVIVRDKVDALVKVEKI  581

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                MRW  +L DHEDGP VPEKIL AVK+YW     +S
Sbjct  582   ANAMRWKTRLADHEDGPHVPEKILFAVKQYWATTSKSS  619



>ref|XP_010439911.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   372 bits (956),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 178/279 (64%), Positives = 217/279 (78%), Gaps = 9/279 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP 
Sbjct  337   IAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVNTCKRKDTDDVWYKEIETCVTPF  393

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E        KFPERL A+PP I+ GL++GV AE+Y +D   WKK V+AYKRIN+
Sbjct  394   PKVSSEEEVAGGELMKFPERLFAVPPSISKGLINGVDAESYQEDINLWKKRVTAYKRINR  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDWC
Sbjct  454   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I
Sbjct  513   EGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
               GMRWD KLMDHEDGPLVPEKILVAVK+YW   D  +T
Sbjct  573   ADGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGDDGNT  611



>ref|XP_006662085.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=605

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 213/275 (77%), Gaps = 4/275 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW+K  EKG+  IW+++ D + C     +++   C+  D DDVWYKKM+ C+TP 
Sbjct  335   IAEMLCWDKIHEKGDTVIWRKKADSNGCPKKDNRARK-MCKIQDADDVWYKKMEGCLTPF  393

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+   +   +KFPERL A PPRI  G   GV+ E Y +DNK WKK++S YKRINK+I + 
Sbjct  394   PE---EAQLQKFPERLFATPPRILQGRTPGVTEEIYEEDNKLWKKYISTYKRINKLIGSS  450

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA L SP  WVMNVVP I++K+TLG++YERG+IGIYHDWCE FST
Sbjct  451   RYRNIMDMNAGLGSFAAVLESPISWVMNVVPAISEKNTLGIVYERGLIGIYHDWCEAFST  510

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMR
Sbjct  511   YPRTYDLIHANGLFSLYQNKCNIEDILLEMDRILRPEGAVIMRDNVEVLNKVRRTVMGMR  570

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             W  KL+DHEDGP +PEKILV+VKKYW  N+  S S
Sbjct  571   WKSKLLDHEDGPHIPEKILVSVKKYWVGNEEESGS  605



>ref|XP_010449513.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 216/275 (79%), Gaps = 9/275 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP 
Sbjct  337   IAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVNTCKRKDTDDVWYKEIETCVTPF  393

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + ++       KKFPERL A+PP I+ GL++GV AE+Y +D   WKK V+AYKRIN+
Sbjct  394   PKVSSEKEVAGGELKKFPERLFAVPPSISKGLINGVDAESYQEDINLWKKRVTAYKRINR  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDWC
Sbjct  454   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I
Sbjct  513   EGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
               GMRWD KLMDHEDGPLVPEKILVAVK+YW   D
Sbjct  573   ADGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGD  607



>gb|EAZ17038.1| hypothetical protein OsJ_32528 [Oryza sativa Japonica Group]
Length=589

 Score =   370 bits (949),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW K  EKG+  IW+++ D + C  ++    +  C+  D DDVWYKKM+ CITP 
Sbjct  319   IAEMLCWGKIHEKGDTVIWRKKADSNECH-NKDDHPSKMCKIQDADDVWYKKMEGCITPF  377

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+   +   +KFPERL A PPRI  G   GV+ E + +DNK WKK+VS YKRINK+I + 
Sbjct  378   PE---EAQLRKFPERLFAAPPRILQGRTPGVTEEIFEEDNKLWKKYVSTYKRINKLIGSL  434

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IYERG+IGIYHDWCE FST
Sbjct  435   RYRNIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFST  494

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMR
Sbjct  495   YPRTYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMR  554

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             W  KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  555   WKSKLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  589



>ref|XP_010434585.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   371 bits (952),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 215/275 (78%), Gaps = 9/275 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP 
Sbjct  337   IAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVNTCKRKDTDDVWYKEIETCVTPF  393

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E        KFPERL A+PP I+ GL++GV AE+Y +D   WKK V+AYKRIN+
Sbjct  394   PKVSSEEEVAGGKLMKFPERLFAVPPSISKGLINGVDAESYQEDINLWKKRVTAYKRINR  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDWC
Sbjct  454   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I
Sbjct  513   EGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
               GMRWD KLMDHEDGPLVPEKILVAVK+YW   D
Sbjct  573   ADGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGD  607



>ref|NP_193537.2| putative methyltransferase PMT14 [Arabidopsis thaliana]
 sp|Q94EJ6.1|PMTE_ARATH RecName: Full=Probable methyltransferase PMT14 [Arabidopsis thaliana]
 gb|AAK95250.1|AF410264_1 AT4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AAN64540.1| At4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AEE83986.1| putative methyltransferase PMT14 [Arabidopsis thaliana]
Length=621

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 215/276 (78%), Gaps = 9/276 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
             GIA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP
Sbjct  336   GIAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVDTCKRKDTDDVWYKEIETCVTP  392

Query  956   SPKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
              PK + +E       KKFPERL A+PP I+ GL++GV  E+Y +D   WKK V+ YKRIN
Sbjct  393   FPKVSNEEEVAGGKLKKFPERLFAVPPSISKGLINGVDEESYQEDINLWKKRVTGYKRIN  452

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             ++I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDW
Sbjct  453   RLIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDW  511

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CEGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+
Sbjct  512   CEGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRK  571

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             I+ GMRWD KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  572   IVDGMRWDTKLMDHEDGPLVPEKILVATKQYWVAGD  607



>ref|NP_001065447.2| Os10g0569300 [Oryza sativa Japonica Group]
 gb|ABB48009.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF27284.2| Os10g0569300 [Oryza sativa Japonica Group]
Length=605

 Score =   370 bits (949),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW K  EKG+  IW+++ D + C  ++    +  C+  D DDVWYKKM+ CITP 
Sbjct  335   IAEMLCWGKIHEKGDTVIWRKKADSNECH-NKDDHPSKMCKIQDADDVWYKKMEGCITPF  393

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+   +   +KFPERL A PPRI  G   GV+ E + +DNK WKK+VS YKRINK+I + 
Sbjct  394   PE---EAQLRKFPERLFAAPPRILQGRTPGVTEEIFEEDNKLWKKYVSTYKRINKLIGSL  450

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IYERG+IGIYHDWCE FST
Sbjct  451   RYRNIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFST  510

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMR
Sbjct  511   YPRTYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMR  570

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             W  KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  571   WKSKLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  605



>emb|CAA17146.1| putative protein [Arabidopsis thaliana]
 emb|CAB78805.1| putative protein [Arabidopsis thaliana]
Length=629

 Score =   370 bits (950),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 215/276 (78%), Gaps = 9/276 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
             GIA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP
Sbjct  344   GIAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVDTCKRKDTDDVWYKEIETCVTP  400

Query  956   SPKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
              PK + +E       KKFPERL A+PP I+ GL++GV  E+Y +D   WKK V+ YKRIN
Sbjct  401   FPKVSNEEEVAGGKLKKFPERLFAVPPSISKGLINGVDEESYQEDINLWKKRVTGYKRIN  460

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             ++I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDW
Sbjct  461   RLIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDW  519

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CEGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+
Sbjct  520   CEGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRK  579

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             I+ GMRWD KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  580   IVDGMRWDTKLMDHEDGPLVPEKILVATKQYWVAGD  615



>gb|AAL86466.1|AC077693_5 hypothetical protein [Oryza sativa Japonica Group]
Length=686

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/275 (63%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW K  EKG+  IW+++ D + C  ++    +  C+  D DDVWYKKM+ CITP 
Sbjct  416   IAEMLCWGKIHEKGDTVIWRKKADSNECH-NKDDHPSKMCKIQDADDVWYKKMEGCITPF  474

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+   +   +KFPERL A PPRI  G   GV+ E + +DNK WKK+VS YKRINK+I + 
Sbjct  475   PE---EAQLRKFPERLFAAPPRILQGRTPGVTEEIFEEDNKLWKKYVSTYKRINKLIGSL  531

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IYERG+IGIYHDWCE FST
Sbjct  532   RYRNIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFST  591

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMR
Sbjct  592   YPRTYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMR  651

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             W  KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  652   WKSKLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  686



>ref|XP_002868016.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44275.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   369 bits (948),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 213/272 (78%), Gaps = 9/272 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
             GIA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DD+WYK+++ C+TP
Sbjct  336   GIAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVNTCKRKDTDDIWYKEIETCVTP  392

Query  956   SPKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
              PK + +E       KKFPERL A+PP I+ GL++GV  E+Y +D   WKK V+AYKRIN
Sbjct  393   FPKVSSEEEVAGGKLKKFPERLFAVPPSISKGLINGVDEESYQEDINLWKKRVTAYKRIN  452

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             ++I + RYRN+MDMNAGLGGFAA L SPK WVMNV PTI +K+TL V+YERG+IGIYHDW
Sbjct  453   RLIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVNPTI-NKNTLSVVYERGLIGIYHDW  511

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CEGFSTYPRTYD IHANGVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+
Sbjct  512   CEGFSTYPRTYDFIHANGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRK  571

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYW  336
             I  GMRWD KLMDHEDGPLVPEKILVA K+YW
Sbjct  572   IADGMRWDTKLMDHEDGPLVPEKILVATKQYW  603



>gb|EAY79581.1| hypothetical protein OsI_34717 [Oryza sativa Indica Group]
Length=589

 Score =   368 bits (945),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/275 (63%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW K  EKG+  IW+++ D + C  ++    +  C+  D DDVWYKKM+ CITP 
Sbjct  319   IAEMLCWGKIHEKGDTVIWRKKADSNECH-NKDDHPSKMCKIQDADDVWYKKMEGCITPF  377

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+   +   +KFPERL A PPRI  G   GV+ E + +DNK WKK+V+ YKRINK+I + 
Sbjct  378   PE---EAQLRKFPERLFAAPPRILQGRTPGVTEEIFEEDNKLWKKYVNTYKRINKLIGSL  434

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IYERG+IGIYHDWCE FST
Sbjct  435   RYRNIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFST  494

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMR
Sbjct  495   YPRTYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMR  554

Query  413   WDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             W  KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  555   WKSKLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  589



>ref|XP_003557818.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=611

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/272 (65%), Positives = 210/272 (77%), Gaps = 5/272 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW+K SEK  IAIW++R++  SC   Q  SK   C+    +DVWYKKM+VCITP 
Sbjct  334   FAELLCWKKISEKDGIAIWRKRLNDKSCPRKQDNSKVGKCELTSDNDVWYKKMEVCITPL  393

Query  953   PKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+  ++ E      + FP+RL A+PPRIA G V G S ++Y +DNK W+KHV+ YK+ N 
Sbjct  394   PEVKSVSEVAGGQLQPFPQRLNAVPPRIALGSVPGFSVQSYQEDNKLWQKHVNGYKKTND  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L S K WVMNVVPTIAD STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNIMDMNAGLGSFAAVLESTKLWVMNVVPTIADASTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHAN VFSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHANDVFSLYQNKCKFEDILLEMDRILRPEGAVIIRDKVDALVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWT  333
                MRW  +L +HE GP V EKIL AVK+YW 
Sbjct  574   ANAMRWKTRLANHESGPHVSEKILFAVKQYWA  605



>gb|EEC68449.1| hypothetical protein OsI_36659 [Oryza sativa Indica Group]
Length=596

 Score =   367 bits (943),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMD--VDSC-RASQKKSKATFCQSGDPDDVWYKKMDVCIT  960
             A +LCWEK +E GE A+W++R D  V SC  A+    +     +  PDDVWYKKM+ CIT
Sbjct  283   AAMLCWEKLAEMGEAAVWRKRPDAAVVSCPTATPAPPRTCDAAAASPDDVWYKKMEPCIT  342

Query  959   PSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
             P P+A  +   + FPERLTA+PPR+A G V G++ E+Y ++N +W++HV+AY+++N  +D
Sbjct  343   P-PQAAGEVMLRPFPERLTAVPPRVAAGEVPGLTGESYAEENARWERHVAAYRKVNYRLD  401

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
              GRYRNIMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGV+YERG+IGI+HDWCE F
Sbjct  402   AGRYRNIMDMNAGVGGFAAAVFSPKSWVMNVVPTAAELSTLGVVYERGLIGIFHDWCEAF  461

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYDLIH NGVF+LYKDKC  EDILLEMDRILRPEG V+ RD+++ L+KV+RI  G
Sbjct  462   STYPRTYDLIHGNGVFTLYKDKCKMEDILLEMDRILRPEGTVILRDDIEVLLKVQRIASG  521

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             MRW   + +HED P +PEK+L AVK+YWT +D +S
Sbjct  522   MRWKMIMANHEDSPHIPEKVLYAVKRYWTADDKSS  556



>gb|EPS60507.1| hypothetical protein M569_14296, partial [Genlisea aurea]
Length=589

 Score =   367 bits (942),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 221/254 (87%), Gaps = 1/254 (0%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCW+K SE  E+AIWQ+  DVDSCRASQ+KS A FC SGD +DVWYK+M  C++ +
Sbjct  337   IAELLCWKKISENAEMAIWQKSSDVDSCRASQEKSGAEFCSSGDANDVWYKEMAPCVSAA  396

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
              +A+  E  K FP+RL A+PPRI++G VSGVS E YL+DNK+W+KHV++YK+INK+I T 
Sbjct  397   NEASSQE-LKPFPDRLFAVPPRISSGSVSGVSVEDYLEDNKQWRKHVNSYKKINKLIGTR  455

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRN MDMNAGLGGFAA L SP+ WVMNVVPT+A+K+TLGVIYERG+IGIYHDWCE FST
Sbjct  456   RYRNFMDMNAGLGGFAAALQSPELWVMNVVPTVAEKNTLGVIYERGLIGIYHDWCEAFST  515

Query  593   YPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMR  414
             YPRTYDLIHA+GVFSLYKDKC FE+ILLEMDRILRPEGA +FRDEVD L+KV++++GGMR
Sbjct  516   YPRTYDLIHASGVFSLYKDKCGFEEILLEMDRILRPEGAAIFRDEVDVLVKVKKVMGGMR  575

Query  413   WDYKLMDHEDGPLV  372
             WD K++DHE+GPLV
Sbjct  576   WDSKMVDHENGPLV  589



>ref|XP_002467784.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
 gb|EER94782.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
Length=610

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 209/277 (75%), Gaps = 5/277 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
              A+LLCW K SEK  IAIW++R++  SC   Q   K   C      DVWYKKM+VCITP 
Sbjct  334   FAQLLCWNKISEKDGIAIWRKRLNDKSCSMKQDNPKGGKCDLTSDSDVWYKKMEVCITPL  393

Query  953   PKAN-IDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+ N + E      + FP+RL A+PPRI  G V G S ++Y +DN  W+KHV AYK+ N 
Sbjct  394   PEVNSVSEVAGGQLEPFPKRLYAVPPRITLGSVPGFSVQSYEEDNNLWQKHVKAYKKTNN  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             ++DTGRYRNIMDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIYERG+IG+YHDWC
Sbjct  454   LLDTGRYRNIMDMNAGLGSFAAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWC  513

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIH+N +FSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I
Sbjct  514   EGFSTYPRTYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAVIIRDKVDVLVKVEKI  573

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
                MRW  +L DHE GP VPEKIL  VK+YW ++ ++
Sbjct  574   ANAMRWKTRLADHEGGPHVPEKILFVVKQYWDVSTSS  610



>ref|XP_003574364.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=604

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 205/265 (77%), Gaps = 5/265 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A++LCW+K  EKG+ AIWQ++ D + C     ++ +  C+    DD+WYKKM+ CITP P
Sbjct  336   AEMLCWDKIYEKGDTAIWQKKADSNGCHNKHGRT-SKMCKVQGADDIWYKKMEACITPLP  394

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
             +       KKFPERL A+PPRI  G  SGV+ E Y +D K WKKHV  YKR+NK+I T R
Sbjct  395   EGG---QLKKFPERLFAVPPRILEG-TSGVTEEVYEEDKKSWKKHVDTYKRMNKLIGTSR  450

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAGLG FAA L SP  WVMNVVPTI++++TLG+IYERG+IGIYHDWCE FSTY
Sbjct  451   YRNIMDMNAGLGSFAAVLDSPGSWVMNVVPTISERNTLGIIYERGLIGIYHDWCEAFSTY  510

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHA+GVF+LY++KCD EDILLEMDRILRPEG V+ RD V  L KVR  + GMRW
Sbjct  511   PRTYDLIHASGVFTLYENKCDLEDILLEMDRILRPEGTVILRDNVHVLNKVRSTVAGMRW  570

Query  410   DYKLMDHEDGPLVPEKILVAVKKYW  336
               KL+DHEDGP VPEKIL+AVK+YW
Sbjct  571   KTKLLDHEDGPYVPEKILIAVKEYW  595



>dbj|BAH19630.1| AT4G18030 [Arabidopsis thaliana]
Length=621

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/276 (63%), Positives = 214/276 (78%), Gaps = 9/276 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
             GIA+ LCWEKK EKG+IAI++++++  SC    + +    C+  D DDVWYK+++ C+TP
Sbjct  336   GIAESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVDTCKRKDTDDVWYKEIETCVTP  392

Query  956   SPKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRIN  792
              PK + +E       KKFPERL A+PP I+ GL++GV  E+Y +D   WKK V+ YKRIN
Sbjct  393   FPKVSNEEEVAGGKLKKFPERLFAVPPSISKGLINGVDEESYQEDINLWKKRVTGYKRIN  452

Query  791   KIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDW  612
             ++I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDW
Sbjct  453   RLIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDW  511

Query  611   CEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRR  432
             CEGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FR EVD L  VR+
Sbjct  512   CEGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRGEVDVLNDVRK  571

Query  431   IIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             I+ GMRWD KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  572   IVDGMRWDTKLMDHEDGPLVPEKILVATKQYWVAGD  607



>gb|EEE52366.1| hypothetical protein OsJ_34430 [Oryza sativa Japonica Group]
Length=624

 Score =   367 bits (943),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMD--VDSC-RASQKKSKATFCQSGDPDDVWYKKMDVCIT  960
             A +LCWEK +E GE A+W++R D  V SC  A+    +     +  PDDVWYKKM+ CIT
Sbjct  311   AAMLCWEKLAEMGEAAVWRKRPDAAVVSCPTATPAPPRTCDAAAASPDDVWYKKMEPCIT  370

Query  959   PSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
             P P+A  +   + FPERLTA+PPR+A G V G++ E+Y ++N +W++HV+AY+++N  +D
Sbjct  371   P-PQAAGEVMLRPFPERLTAVPPRVAAGEVPGLTGESYAEENARWERHVAAYRKVNYRLD  429

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
              GRYRNIMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGV+YERG+IGI+HDWCE F
Sbjct  430   AGRYRNIMDMNAGVGGFAAAVFSPKSWVMNVVPTAAELSTLGVVYERGLIGIFHDWCEAF  489

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYDLIH NGVF+LYKDKC  EDILLEMDRILRPEG V+ RD+++ L+KV+RI  G
Sbjct  490   STYPRTYDLIHGNGVFTLYKDKCKMEDILLEMDRILRPEGTVILRDDIEVLLKVQRIASG  549

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             MRW   + +HED P +PEK+L AVK+YWT +D +S
Sbjct  550   MRWKMIMANHEDSPHIPEKVLYAVKRYWTADDKSS  584



>ref|XP_008448741.1| PREDICTED: probable methyltransferase PMT14 [Cucumis melo]
Length=613

 Score =   367 bits (941),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/283 (62%), Positives = 220/283 (78%), Gaps = 12/283 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++ +  SC+   +K  A  C++ D +DVWY+KM+ C+TP 
Sbjct  334   LAEQLCWEKKYEKGDIAIWRKKENDKSCK---RKKAAKSCEASD-EDVWYQKMETCVTPF  389

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+   DE       KKFP RL A+PPRI++GL+  V+AE++ +DNK WKKHV+AYKRIN 
Sbjct  390   PEVTSDEEVAGGKLKKFPARLFAVPPRISSGLIPDVTAESFEEDNKIWKKHVAAYKRINN  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNA LGGFAA + S   WVMNVVPTI+ K+TLG IYERG++G+YHDWC
Sbjct  450   LIGSPRYRNVMDMNANLGGFAAAVHSKNSWVMNVVPTIS-KNTLGAIYERGLVGMYHDWC  508

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IH NGVF LY++ C+ EDILLEMDRILRPEG V+ RD VD + KV++I
Sbjct  509   EGFSTYPRTYDFIHGNGVFDLYENNCNLEDILLEMDRILRPEGIVILRDGVDVMNKVKKI  568

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDT--NSTSA  306
               GMRWD KLMDHEDGPLVPEKI+VAVK+YW  ++   N TS 
Sbjct  569   AAGMRWDVKLMDHEDGPLVPEKIMVAVKQYWVASNPPDNRTSG  611



>gb|KJB08229.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=655

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/309 (58%), Positives = 220/309 (71%), Gaps = 41/309 (13%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+LLCWEK  E G+IA+W++R + D CR  Q+ +K   C+   PDDVWYKKM+ C+TP 
Sbjct  336   IARLLCWEKLDELGDIAVWKKRTNYDLCR--QQDTKPNLCEPSYPDDVWYKKMEACVTPY  393

Query  953   PKANID-ESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDT  777
             PK+    E +K FP+RL AIPPRI++G V GVS + Y +D + W+KHV +YK IN +ID+
Sbjct  394   PKSTKSYEEWKPFPDRLNAIPPRISSGSVPGVSVDMYQEDIQIWEKHVKSYKSINNLIDS  453

Query  776   GRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFS  597
             GR+RNIMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI +RG+IGIYHDWCE FS
Sbjct  454   GRFRNIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVISDRGLIGIYHDWCEAFS  513

Query  596   TYPRTYDLIHANGVFSLYKD--------------------------------------KC  531
             TYPRTYDLIHANG+FSLYKD                                      +C
Sbjct  514   TYPRTYDLIHANGIFSLYKDNSVCPDFQLIEFIFAHTCTTCLVITRTVEAYMLVFYRCRC  573

Query  530   DFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVA  351
               EDILLEMDRILRPEG+V+ RD V+ L+KV++I+GGMRWD +++DHEDGPLV EK+L A
Sbjct  574   KAEDILLEMDRILRPEGSVIIRDNVNVLVKVKKIVGGMRWDARMVDHEDGPLVSEKVLFA  633

Query  350   VKKYWTLND  324
             VKKYW + D
Sbjct  634   VKKYWVVGD  642



>emb|CDX78823.1| BnaA01g08900D [Brassica napus]
Length=620

 Score =   366 bits (940),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 209/275 (76%), Gaps = 9/275 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+ AI++++++  SC    + +    C+  D DDVWYK+++ C+TP 
Sbjct  335   IAESLCWEKKYEKGDTAIFRKKINDRSC---DRSTPVNTCKRKDTDDVWYKEIETCVTPF  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL A+PP ++ GLVSGV AE Y +D K WKK V  Y+RIN 
Sbjct  392   PKVSNEEEVAGGKLKKFPERLFAVPPSVSKGLVSGVDAETYQEDVKLWKKRVGRYRRINS  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPTI  K TL V+YERG+IGIYHDWC
Sbjct  452   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIT-KKTLSVVYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFS+Y+  C  EDILLEMDRILRPEG V+ RDEVD L  VR+I
Sbjct  511   EGFSTYPRTYDFIHANGVFSMYQHSCKIEDILLEMDRILRPEGIVIIRDEVDVLNDVRKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
               GMRWD KLMDHEDGPLVPEKIL AVK+YW   D
Sbjct  571   ADGMRWDTKLMDHEDGPLVPEKILYAVKQYWVAGD  605



>ref|XP_009131372.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=620

 Score =   366 bits (940),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 209/275 (76%), Gaps = 9/275 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA+ LCWEKK EKG+ AI++++++  SC    + +    C+  D DDVWYK+++ C+TP 
Sbjct  335   IAESLCWEKKYEKGDTAIFRKKINDRSC---DRSTPVNTCKRKDTDDVWYKEIETCVTPF  391

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL A+PP ++ GLVSGV AE Y +D K WKK V  YKRIN 
Sbjct  392   PKVSNEEEVAGGKLKKFPERLFAVPPSVSKGLVSGVDAETYQEDVKLWKKRVGRYKRINS  451

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNVVPTI  K TL V+YERG+IGIYHDWC
Sbjct  452   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTIT-KKTLSVVYERGLIGIYHDWC  510

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHANGVFS+Y+  C  EDILLEMDRILRPEG ++ RDEVD L  VR+I
Sbjct  511   EGFSTYPRTYDFIHANGVFSMYQHSCKIEDILLEMDRILRPEGILIIRDEVDVLNDVRKI  570

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
               GMRWD KLMDHEDGPLVPEKIL AVK+YW   D
Sbjct  571   ADGMRWDTKLMDHEDGPLVPEKILYAVKQYWVAGD  605



>ref|NP_001068227.1| Os11g0601600 [Oryza sativa Japonica Group]
 gb|ABA94590.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28590.1| Os11g0601600 [Oryza sativa Japonica Group]
Length=652

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 214/275 (78%), Gaps = 4/275 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMD--VDSC-RASQKKSKATFCQSGDPDDVWYKKMDVCIT  960
             A +LCWEK +E GE A+W++R D  V SC  A+    +     +  PDDVWYKKM+ CIT
Sbjct  339   AAMLCWEKLAEMGEAAVWRKRPDAAVVSCPTATPAPPRTCDAAAASPDDVWYKKMEPCIT  398

Query  959   PSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIID  780
             P P+A  +   + FPERLTA+PPR+A G V G++ E+Y ++N +W++HV+AY+++N  +D
Sbjct  399   P-PQAAGEVMLRPFPERLTAVPPRVAAGEVPGLTGESYAEENARWERHVAAYRKVNYRLD  457

Query  779   TGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGF  600
              GRYRNIMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGV+YERG+IGI+HDWCE F
Sbjct  458   AGRYRNIMDMNAGVGGFAAAVFSPKSWVMNVVPTAAELSTLGVVYERGLIGIFHDWCEAF  517

Query  599   STYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGG  420
             STYPRTYDLIH NGVF+LYKDKC  EDILLEMDRILRPEG V+ RD+++ L+KV+RI  G
Sbjct  518   STYPRTYDLIHGNGVFTLYKDKCKMEDILLEMDRILRPEGTVILRDDIEVLLKVQRIASG  577

Query  419   MRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
             MRW   + +HED P +PEK+L AVK+YWT +D +S
Sbjct  578   MRWKMIMANHEDSPHIPEKVLYAVKRYWTADDKSS  612



>ref|XP_004150171.1| PREDICTED: probable methyltransferase PMT14 [Cucumis sativus]
 gb|KGN55796.1| hypothetical protein Csa_3G016410 [Cucumis sativus]
Length=614

 Score =   365 bits (936),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 171/283 (60%), Positives = 220/283 (78%), Gaps = 12/283 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++ +  SC+   +K  A  C++ D +DVWY+KM+ C+TP 
Sbjct  334   LAEQLCWEKKYEKGDIAIWKKKENDKSCK---RKKAANLCEAND-EDVWYQKMETCVTPF  389

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P    D+       KKFP RL A+PPRI++GL+  V+ E++ +DNK WKKHV+AY+RIN 
Sbjct  390   PDVTSDDEVAGGKLKKFPARLFAVPPRISSGLIPDVTVESFEEDNKIWKKHVTAYRRINN  449

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNA LGGFAA + S   WVMNVVPTI+ K+TLG IYERG++G+YHDWC
Sbjct  450   LIGSPRYRNVMDMNANLGGFAAAVHSKNSWVMNVVPTIS-KNTLGAIYERGLVGMYHDWC  508

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IH NGVF LY++ C+ EDILLEMDRILRPEG V+ RD VD + KV+++
Sbjct  509   EGFSTYPRTYDFIHGNGVFDLYENNCNLEDILLEMDRILRPEGIVILRDGVDVMNKVKKL  568

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDT--NSTSA  306
               GMRWD KLMDHEDGPLVPEKI+VAVK+YW +++   N TS+
Sbjct  569   AAGMRWDVKLMDHEDGPLVPEKIMVAVKQYWVVSNPPHNRTSS  611



>ref|XP_008658538.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
 ref|XP_008658539.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
Length=604

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 213/275 (77%), Gaps = 6/275 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKAT-FCQSGDPDDVWYKKMDVCITP  957
             IA++LCW+K  EK +IAIWQ++ +  SC   QK   A+  C+  D DDVWYKK++ CITP
Sbjct  335   IAEMLCWDKIFEKDDIAIWQKQGNSYSCH--QKDGHASKMCKVQDSDDVWYKKLESCITP  392

Query  956   SPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDT  777
               +A      KKFPERL+AIPPRI  G V  ++ E Y +DNK WKKHV+ YKR+NK+I +
Sbjct  393   PIEA---AQLKKFPERLSAIPPRILEGQVPDITEEVYEEDNKLWKKHVNTYKRVNKLIGS  449

Query  776   GRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFS  597
              RYRNIMDMNAGLG FAA L S   WVMNVVP+I++++TLG+IYERG+IGIYHDWCE FS
Sbjct  450   SRYRNIMDMNAGLGSFAATLHSSSSWVMNVVPSISERNTLGIIYERGLIGIYHDWCEAFS  509

Query  596   TYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGM  417
             TYPRTYDLIH N +FSLY++KCD EDILLEMDRILRPEGAV+ RD  D L KVR ++ GM
Sbjct  510   TYPRTYDLIHGNDIFSLYQNKCDAEDILLEMDRILRPEGAVILRDNADVLNKVRSMVAGM  569

Query  416   RWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
             RW  KL+DHEDGP VPEKIL++VK+YW  ++  ++
Sbjct  570   RWKSKLLDHEDGPHVPEKILISVKEYWVGSEEQNS  604



>ref|XP_006283339.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
 gb|EOA16237.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
Length=626

 Score =   362 bits (930),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/275 (63%), Positives = 212/275 (77%), Gaps = 9/275 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             I + LCWEKK EKG+IAI++++++  SC    + +    C+  D DD+WYK+++ C+TP 
Sbjct  337   ITESLCWEKKYEKGDIAIFRKKINDRSC---DRSTPVNTCKRKDTDDIWYKEIETCVTPF  393

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             PK + +E       KKFPERL A+PP I+ GL++GV   +Y +D   WKK + AYKRIN+
Sbjct  394   PKVSSEEEVAGGELKKFPERLFAVPPSISKGLINGVDENSYQEDIDLWKKRLIAYKRINR  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I + RYRN+MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+YERG+IGIYHDWC
Sbjct  454   LIGSTRYRNVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I
Sbjct  513   EGFSTYPRTYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
               GMRWD KL+DHEDGPLVPEKILVAVK+YW   D
Sbjct  573   ADGMRWDTKLLDHEDGPLVPEKILVAVKQYWVAGD  607



>tpg|DAA46388.1| TPA: hypothetical protein ZEAMMB73_857191 [Zea mays]
Length=613

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/278 (62%), Positives = 213/278 (77%), Gaps = 8/278 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKAT-FCQSGDPDDVW--YKKMDVC  966
              IA++LCW+K  EK +IAIWQ++ +  SC   QK   A+  C+  D DDVW  YKK++ C
Sbjct  341   NIAEMLCWDKIFEKDDIAIWQKQGNSYSCH--QKDGHASKMCKVQDSDDVWIGYKKLESC  398

Query  965   ITPSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             ITP  +A      KKFPERL+AIPPRI  G V  ++ E Y +DNK WKKHV+ YKR+NK+
Sbjct  399   ITPPIEA---AQLKKFPERLSAIPPRILEGQVPDITEEVYEEDNKLWKKHVNTYKRVNKL  455

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             I + RYRNIMDMNAGLG FAA L S   WVMNVVP+I++++TLG+IYERG+IGIYHDWCE
Sbjct  456   IGSSRYRNIMDMNAGLGSFAATLHSSSSWVMNVVPSISERNTLGIIYERGLIGIYHDWCE  515

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
              FSTYPRTYDLIH N +FSLY++KCD EDILLEMDRILRPEGAV+ RD  D L KVR ++
Sbjct  516   AFSTYPRTYDLIHGNDIFSLYQNKCDAEDILLEMDRILRPEGAVILRDNADVLNKVRSMV  575

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  312
              GMRW  KL+DHEDGP VPEKIL++VK+YW  ++  ++
Sbjct  576   AGMRWKSKLLDHEDGPHVPEKILISVKEYWVGSEEQNS  613



>tpg|DAA42264.1| TPA: methyltransferase isoform 1 [Zea mays]
 tpg|DAA42265.1| TPA: methyltransferase isoform 2 [Zea mays]
Length=628

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 210/276 (76%), Gaps = 3/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A +LCWEK +E  EIAIW++++D  +  A   +     C   + DDVWYK M+ CITP P
Sbjct  341   AAMLCWEKVTEIREIAIWRKQLDPSA--ACPDRPPVRTCDDANSDDVWYKNMETCITP-P  397

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              A +    + FP RLTA+PPRI+ G V G +AE+Y ++N++W++HV+AYK++N  +++ R
Sbjct  398   AAAVAGELQPFPARLTAVPPRISAGAVPGFTAESYEEENRRWERHVAAYKKVNYRLNSER  457

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG+GGFAA + SPK WVMNVVPT A+  TLGV+YERG+IGIYHDWCE FSTY
Sbjct  458   YRNIMDMNAGVGGFAAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTY  517

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW
Sbjct  518   PRTYDLIHANGIFTLYKDRCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRW  577

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
                L +HEDGP VPEK+L AVK+YWT     + + +
Sbjct  578   KTLLANHEDGPNVPEKVLFAVKRYWTAAGEGTAAEE  613



>ref|NP_001152056.1| methyltransferase [Zea mays]
 gb|ACG45571.1| methyltransferase [Zea mays]
Length=628

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 210/276 (76%), Gaps = 3/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A +LCWEK +E  EIAIW++++D  +  A   +     C   + DDVWYK M+ CITP P
Sbjct  341   AAMLCWEKVTEIREIAIWRKQLDPSA--ACPDRPPVRTCDDANSDDVWYKNMETCITP-P  397

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              A +    + FP RLTA+PPRI+ G V G +AE+Y ++N++W++HV+AYK++N  +++ R
Sbjct  398   AAAVAGELQPFPARLTAVPPRISAGAVPGFTAESYEEENRRWERHVAAYKKVNYRLNSER  457

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG+GGFAA + SPK WVMNVVPT A+  TLGV+YERG+IGIYHDWCE FSTY
Sbjct  458   YRNIMDMNAGVGGFAAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTY  517

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW
Sbjct  518   PRTYDLIHANGIFTLYKDRCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRW  577

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
                L +HEDGP VPEK+L AVK+YWT     + + +
Sbjct  578   KTLLANHEDGPNVPEKVLFAVKRYWTAAGEGTAAEE  613



>ref|XP_008668148.1| PREDICTED: methyltransferase isoform X1 [Zea mays]
Length=658

 Score =   358 bits (920),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 210/276 (76%), Gaps = 3/276 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A +LCWEK +E  EIAIW++++D  +  A   +     C   + DDVWYK M+ CITP P
Sbjct  371   AAMLCWEKVTEIREIAIWRKQLDPSA--ACPDRPPVRTCDDANSDDVWYKNMETCITP-P  427

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              A +    + FP RLTA+PPRI+ G V G +AE+Y ++N++W++HV+AYK++N  +++ R
Sbjct  428   AAAVAGELQPFPARLTAVPPRISAGAVPGFTAESYEEENRRWERHVAAYKKVNYRLNSER  487

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG+GGFAA + SPK WVMNVVPT A+  TLGV+YERG+IGIYHDWCE FSTY
Sbjct  488   YRNIMDMNAGVGGFAAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTY  547

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW
Sbjct  548   PRTYDLIHANGIFTLYKDRCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRW  607

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  303
                L +HEDGP VPEK+L AVK+YWT     + + +
Sbjct  608   KTLLANHEDGPNVPEKVLFAVKRYWTAAGEGTAAEE  643



>gb|AAD14491.1| Unknown protein [Arabidopsis thaliana]
Length=590

 Score =   356 bits (914),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/277 (61%), Positives = 208/277 (75%), Gaps = 31/277 (11%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             AKLLCWEKK E GEIAIWQ+R++ ++CR+ Q   +A FC++ D DDVWYKKM+ CITP P
Sbjct  339   AKLLCWEKKYEHGEIAIWQKRVNDEACRSRQDDPRANFCKTDDTDDVWYKKMEACITPYP  398

Query  950   KANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKI  786
             + +  +       + FP+RL A+PPRI++G +SGV+ +AY DDN++WKKHV AYKRIN +
Sbjct  399   ETSSSDEVAGGELQAFPDRLNAVPPRISSGSISGVTVDAYEDDNRQWKKHVKAYKRINSL  458

Query  785   IDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCE  606
             +DTGRYRNIMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+YERG+IGIYHDWC 
Sbjct  459   LDTGRYRNIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCN  518

Query  605   GFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRII  426
                                        +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII
Sbjct  519   A--------------------------DDILLEMDRILRPEGAVIIRDDVDTLIKVKRII  552

Query  425   GGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
              GMRWD KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  553   AGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVTNSTST  589



>gb|EMS59423.1| putative methyltransferase PMT2 [Triticum urartu]
Length=659

 Score =   358 bits (918),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 216/295 (73%), Gaps = 7/295 (2%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A++LCWEK +E  EI +W++R D  +C A     +A  C   +PDDVWYK M+ CITPS 
Sbjct  242   AQMLCWEKVTEMDEIGVWRKRTDTAACPAMPPAVRA--CDPANPDDVWYKNMETCITPST  299

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              A   E  + FPERL AIPPRI++G V G + E+Y ++N++W++HV AY+++N  +DT R
Sbjct  300   TAAGGE-LQSFPERLKAIPPRISSGAVQGFTMESYEEENRRWERHVKAYRKVNYKLDTKR  358

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG+GGFAA + SP  WVMNVVPT A+ STLGVIYERG+IGIYHDWCE FSTY
Sbjct  359   YRNIMDMNAGVGGFAAAIFSPMSWVMNVVPTAAELSTLGVIYERGLIGIYHDWCEAFSTY  418

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANGVF++Y+DKC  EDI+LEMDRILRPEG V+ RD++D L++V ++  GMRW
Sbjct  419   PRTYDLIHANGVFNIYRDKCKMEDIMLEMDRILRPEGTVILRDDIDVLLRVDKVATGMRW  478

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ*GVPEGEARNDRCDGVDYE  246
                + +HED P + EK+L A+K YWT +   S+  Q    E +A + +  G D E
Sbjct  479   KTMMANHEDSPHIREKVLYAIKPYWTADSDKSSQDQ----EKKATSSKGKGSDSE  529



>gb|KDO43766.1| hypothetical protein CISIN_1g026623mg [Citrus sinensis]
Length=235

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 190/231 (82%), Gaps = 6/231 (3%)
 Frame = -1

Query  986  YKKMDVCITPSPKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWK  822
            YK+M+ CITP P+ +  +       KKFP RL  +PPRIANG V GV+ ++Y +D+K WK
Sbjct  5    YKQMETCITPFPEVSSTKEVAGGELKKFPSRLFDVPPRIANGEVEGVTGKSYQEDSKLWK  64

Query  821  KHVSAYKRINKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYE  642
            KHV+AYK++N +I T RYRN+MDMNAGLGGFAA L SPK WVMNVVPT A K+TLGVIYE
Sbjct  65   KHVNAYKKMNSLIGTRRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTTA-KNTLGVIYE  123

Query  641  RGMIGIYHDWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRD  462
            RG+IGIYHDWCEGFSTYPRTYDLIHANGVFSLY++ C  EDILLEMDRILRPEGAV+FRD
Sbjct  124  RGLIGIYHDWCEGFSTYPRTYDLIHANGVFSLYENTCKPEDILLEMDRILRPEGAVIFRD  183

Query  461  EVDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
            EVD L KVR+   GMRWD K+MDHEDGPL+PEKIL+AVK+YW  +  NSTS
Sbjct  184  EVDALNKVRKFAEGMRWDTKMMDHEDGPLMPEKILIAVKQYWVGSAGNSTS  234



>dbj|BAJ85549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=670

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 203/266 (76%), Gaps = 5/266 (2%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW K  EK +  IWQ++ + + C     ++ +  C+  D DD+WYKKM+ CITP 
Sbjct  399   IAEMLCWNKIYEKEDTVIWQKKENSNPCHNKNSRT-SKMCKVQDGDDIWYKKMETCITPI  457

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+       +KFPERL  +PPRI +    GV+ E Y +D K WKKHV  YKRINK+I   
Sbjct  458   PEG--AHQLQKFPERLFVVPPRILDS-TQGVTEEVYEEDKKLWKKHVDTYKRINKLIGKS  514

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKS-TLGVIYERGMIGIYHDWCEGFS  597
             RYRNIMDMNAGLG FAA L SP  WVMNVVPTI++++ TLG+IYERG+IGIYHDWCE FS
Sbjct  515   RYRNIMDMNAGLGSFAAALNSPGSWVMNVVPTISERNNTLGIIYERGLIGIYHDWCEAFS  574

Query  596   TYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGM  417
             TYPRTYDLIHA+GVFSLY++KCD EDILLEMDRILRPEG V+ RD V+ L KVRR + GM
Sbjct  575   TYPRTYDLIHASGVFSLYENKCDLEDILLEMDRILRPEGTVILRDNVEVLNKVRRTVAGM  634

Query  416   RWDYKLMDHEDGPLVPEKILVAVKKY  339
             RW  KL+DHEDGPLVPEK+L+AVK+Y
Sbjct  635   RWKSKLLDHEDGPLVPEKLLIAVKEY  660



>gb|EMS46508.1| putative methyltransferase PMT2 [Triticum urartu]
Length=524

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 210/296 (71%), Gaps = 25/296 (8%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             IA++LCW K  EK +  IWQ+++++++C     ++ +  C   D DD+WYKKM+ CITP 
Sbjct  233   IAEMLCWNKIYEKEDTVIWQKKVNLNACHNKNGRT-SKMCNVQDADDIWYKKMEACITPI  291

Query  953   PKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTG  774
             P+    +  +KFP+RL A+PPRI  G   GV+ E Y +D K WKKHV  YKR+NK+I   
Sbjct  292   PEGA--QQLQKFPKRLFAVPPRILEG-TPGVTEEVYEEDKKLWKKHVDTYKRVNKLIGKS  348

Query  773   RYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFST  594
             RYRNIMDMNAGLG FAA L SP  WVMNVVPTI++++TLG+IYERG+IGIYHDWCE FST
Sbjct  349   RYRNIMDMNAGLGSFAAVLDSPGSWVMNVVPTISERNTLGIIYERGLIGIYHDWCEAFST  408

Query  593   YPRTYDLIHANGVFSLYKD---------------------KCDFEDILLEMDRILRPEGA  477
             YPRTYDLIHA+GVFSLY++                     +CD EDILLEMDRILRPEG 
Sbjct  409   YPRTYDLIHASGVFSLYQNNYMYTTWEIHDLFLYGLGALVRCDLEDILLEMDRILRPEGT  468

Query  476   VVFRDEVDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             V+ RD V+ L KVRR + GM+W  KL+DHEDGPLVPEK+L+ VK YW   +  S+S
Sbjct  469   VILRDNVEVLNKVRRTVTGMQWKSKLLDHEDGPLVPEKLLIGVKTYWVGREEGSSS  524



>gb|KEH31563.1| methyltransferase PMT14-like protein, putative [Medicago truncatula]
Length=1599

 Score =   368 bits (944),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 211/268 (79%), Gaps = 10/268 (4%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPS  954
             +A+ LCWEKK EKG+IAIW+++++  SC   Q+KS    C   + DDVWYKKM+VC TP 
Sbjct  338   LAESLCWEKKYEKGDIAIWRKKINAKSC---QRKS-LNLCDLDNADDVWYKKMEVCKTPI  393

Query  953   PKANIDES-----FKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINK  789
             P+            KKFP RL A+PPRIA   + GV+ E+Y +DNK WKK V+ YKRIN+
Sbjct  394   PEVTSQSEVAGGELKKFPARLFAVPPRIAKDAIPGVTVESYQEDNKLWKKRVNNYKRINR  453

Query  788   IIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWC  609
             +I T RYRNIMDMNAGLGGFAA L S K WVMN VPTIAD +TLGVIYERG+IGIYHDWC
Sbjct  454   LIGTTRYRNIMDMNAGLGGFAAALESQKSWVMNAVPTIAD-NTLGVIYERGLIGIYHDWC  512

Query  608   EGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRI  429
             EGFSTYPRTYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEG+V+ RDEVD + KV++I
Sbjct  513   EGFSTYPRTYDLIHANGLFSLYQDKCNLEDILLEMDRILRPEGSVIIRDEVDVINKVQKI  572

Query  428   IGGMRWDYKLMDHEDGPLVPEKILVAVK  345
             + GMRW+ K++DHEDGP  PEKILV VK
Sbjct  573   VRGMRWESKMVDHEDGPFAPEKILVIVK  600



>ref|XP_004979626.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=626

 Score =   348 bits (894),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/272 (59%), Positives = 202/272 (74%), Gaps = 3/272 (1%)
 Frame = -1

Query  1130  AKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITPSP  951
             A +LCWEK +E  EI IW++R D  +  A   +     C   +PDDVWYK M+ CITP  
Sbjct  341   AAMLCWEKVTEINEIGIWRKRPDPAA--ACPDRPPVRTCDEANPDDVWYKNMETCITPPA  398

Query  950   KANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRINKIIDTGR  771
              A   E  + FP RLTA+PPRI +G V G +AE+Y ++N +W++HV AYK++N  + T R
Sbjct  399   GAGAGE-LQPFPARLTAVPPRILSGAVPGFTAESYAEENWRWERHVEAYKKVNYKLSTER  457

Query  770   YRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHDWCEGFSTY  591
             YRNIMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGVIYERG+IG+YHDWCE FSTY
Sbjct  458   YRNIMDMNAGVGGFAAAIFSPKAWVMNVVPTAAELSTLGVIYERGLIGMYHDWCEAFSTY  517

Query  590   PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  411
             PRTYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW
Sbjct  518   PRTYDLIHANGIFTLYKDRCKMEDILLEMDRILRPEGTVILRDDVEILLKVQRTVKGMRW  577

Query  410   DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNS  315
                + +HED   + EK+L AVK+YWT +   S
Sbjct  578   KTLMANHEDSQNIREKVLFAVKRYWTADSDGS  609



>ref|XP_006663417.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=260

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 184/233 (79%), Gaps = 3/233 (1%)
 Frame = -1

Query  1007  GDPDDVWYKKMDVCITPSPKANIDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKK  828
             G    V YKKM+ C+TP P+   +   +KFPERL A PPRI  G   GV+ E Y +DNK 
Sbjct  31    GQGHRVMYKKMEGCLTPFPE---EAQLQKFPERLFATPPRILQGRTPGVTEEIYEEDNKL  87

Query  827   WKKHVSAYKRINKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVI  648
             WKK++S YKRINK+I + RYRNIMDMNAGLG FAA L SP  WVMNVVP I++K+TLG++
Sbjct  88    WKKYISTYKRINKLIGSSRYRNIMDMNAGLGSFAAVLESPISWVMNVVPAISEKNTLGIV  147

Query  647   YERGMIGIYHDWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVF  468
             YERG+IGIYHDWCE FSTYPRTYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ 
Sbjct  148   YERGLIGIYHDWCEAFSTYPRTYDLIHANGLFSLYQNKCNIEDILLEMDRILRPEGAVIM  207

Query  467   RDEVDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  309
             RD V+ L KVRR + GMRW  KL+DHEDGP +PEKILV+VKKYW  N+  S S
Sbjct  208   RDNVEVLNKVRRTVMGMRWKSKLLDHEDGPHIPEKILVSVKKYWVGNEEESGS  260



>ref|XP_003570093.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=639

 Score =   337 bits (865),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/281 (56%), Positives = 211/281 (75%), Gaps = 8/281 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKAT--FCQSGDPDDVWYKKMDVCI  963
              +A+ LCW+K  E G+IA+WQ+ M+  SC+ S++K+  +  FC + +PD  WY KM+ C+
Sbjct  358   AVARSLCWKKIKEAGDIAVWQKPMNHVSCKTSRRKTAKSPPFCSNKNPDAAWYDKMEACV  417

Query  962   TPSPK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR  798
             TP P+ +N DE    + KK+P+RLTA+PPRI+ G + GV+A+A+  D + WK+ V  YK 
Sbjct  418   TPLPEVSNADEVAGGAVKKWPQRLTAVPPRISRGSIKGVTAKAFQQDTELWKRRVRHYKA  477

Query  797   -INKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIY  621
              IN+    GRYRN++DMNAGLGGFAA L +   WVMN+VPT+ + STLGVIYERG+IG Y
Sbjct  478   VINQFEQKGRYRNVLDMNAGLGGFAAALANYPLWVMNMVPTVRNSSTLGVIYERGLIGSY  537

Query  620   HDWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIK  441
              DWCEG STYPRTYDL+HA+ VF+LYK +C+ + ILLEMDRILRPEG V+ RD+VD L+K
Sbjct  538   QDWCEGASTYPRTYDLVHADSVFTLYKSRCEMDSILLEMDRILRPEGTVIIRDDVDMLVK  597

Query  440   VRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
             V+ +  GMRWD +++DHEDGPLV EK+L+ VK YWT  D +
Sbjct  598   VKSVADGMRWDSQIVDHEDGPLVREKLLLVVKTYWTAPDQD  638



>ref|XP_009399379.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=644

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 205/278 (74%), Gaps = 7/278 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKA-TFCQSGDPDDVWYKKMDVCIT  960
              +A+ LCW K  EKG+IAIWQ+ ++  SC+A++K  ++  FCQS DPD  WY KM+ CI 
Sbjct  350   AVARSLCWNKLKEKGDIAIWQKPVNHISCKANRKIIRSPQFCQSQDPDSAWYTKMETCIV  409

Query  959   PSPKANIDE-----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR-  798
             P PK    E     + K++PERLTA+PPRIA+G V GV+AE +L D + WKK V  YK+ 
Sbjct  410   PLPKVASPEETAGGAPKRWPERLTAVPPRIASGSVVGVTAETFLQDTELWKKRVGYYKKV  469

Query  797   INKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYH  618
             I ++   GRYRN++DMNA  GGFAA L     WVMN+VPT +  +TLGVIYERG+IG Y 
Sbjct  470   IGQLGQAGRYRNLLDMNANFGGFAAALIDDPLWVMNIVPTTSQVNTLGVIYERGLIGTYQ  529

Query  617   DWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKV  438
             DWCE  STYPRTYDL+HA+ VF+LYKD+C+ EDILLEMDRILRPEG V+ RD+VD L+K+
Sbjct  530   DWCEAMSTYPRTYDLLHADSVFNLYKDRCEMEDILLEMDRILRPEGTVIIRDDVDILVKI  589

Query  437   RRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             + I  GMRW+ ++ DHEDGPL  EK+L+ VK YWT+ +
Sbjct  590   KSIADGMRWNSRIADHEDGPLQREKLLLVVKTYWTVGE  627



>ref|XP_003580353.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=643

 Score =   335 bits (860),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 206/278 (74%), Gaps = 7/278 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKAT-FCQSGDPDDVWYKKMDVCIT  960
              +AK LCW+K  E G+IAIWQ+  +   C+AS++ +K+  FC + +PD  WY KM+ CIT
Sbjct  362   AVAKSLCWKKIKEVGDIAIWQKPTNHIHCKASRRITKSPPFCSNKNPDAAWYDKMEACIT  421

Query  959   PSPKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR-  798
             P P+ +          KK+P+RLTA+PPRIA+G ++GV+ E +L+D K W+K V  YK  
Sbjct  422   PLPEVSDIKKVAGGELKKWPQRLTAVPPRIASGSIAGVTDEMFLEDTKLWRKRVGHYKSV  481

Query  797   INKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYH  618
             I++    GRYRN++DMNA  GGFAA L     WVMN+VPT+ + +TLGVIYERG+IG Y 
Sbjct  482   ISQFGQKGRYRNLLDMNAHFGGFAAALVGDPMWVMNMVPTVGNSTTLGVIYERGLIGNYQ  541

Query  617   DWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKV  438
             DWCEG STYPRTYDLIHA+ VFSLYKD+C+ + ILLEMDRILRPEG V+ RD+VD L+K+
Sbjct  542   DWCEGMSTYPRTYDLIHADSVFSLYKDRCEMDSILLEMDRILRPEGTVIIRDDVDILVKI  601

Query  437   RRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
             + I  GMRW+ +++DHEDGPLV EK+L+ VK YWTL D
Sbjct  602   KSITDGMRWNSQVVDHEDGPLVREKLLLVVKTYWTLGD  639



>gb|EEC73773.1| hypothetical protein OsI_08448 [Oryza sativa Indica Group]
Length=646

 Score =   335 bits (858),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/279 (56%), Positives = 206/279 (74%), Gaps = 8/279 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKATFCQSGDPDDVWYKKMDVCITP  957
              +A+ LCW+K  E G+IA+WQ+  +  SC+AS+K     FC   +PD  WY KM+VC+TP
Sbjct  369   AVARSLCWKKIKEAGDIAVWQKPANHASCKASRKSP--PFCSHKNPDAAWYDKMEVCVTP  426

Query  956   SPKAN-----IDESFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR-I  795
              P+ +        + KK+P+RLTA+PPRI+ G + GV+++A++ D + W+K V  YK  I
Sbjct  427   LPEVSDASKVAGGALKKWPQRLTAVPPRISRGSIKGVTSKAFVQDTELWRKRVQHYKGVI  486

Query  794   NKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHD  615
             N+    GRYRN++DMNAGLGGFAA L S   WVMN+VPT+ + STLGV+YERG+IG Y D
Sbjct  487   NQFEQKGRYRNVLDMNAGLGGFAAALASDPLWVMNMVPTVGNSSTLGVVYERGLIGSYQD  546

Query  614   WCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVR  435
             WCEG STYPRTYDLIHA+ VF+LYK++C+ + ILLEMDRILRPEG V+ RD+VD L+KV+
Sbjct  547   WCEGMSTYPRTYDLIHADSVFTLYKNRCEMDIILLEMDRILRPEGTVIIRDDVDMLVKVK  606

Query  434   RIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
                 GMRWD +++DHEDGPLV EKIL+ VK YWT  + +
Sbjct  607   SAADGMRWDSQIVDHEDGPLVREKILLVVKTYWTAKEQD  645



>ref|XP_009400717.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=631

 Score =   333 bits (855),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/280 (56%), Positives = 202/280 (72%), Gaps = 7/280 (3%)
 Frame = -1

Query  1136  GIAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKA-TFCQSGDPDDVWYKKMDVCIT  960
              +A+ LCW K  EKG+IAIWQ+ ++   C+A++K  ++  FCQS +PD  WY K + CIT
Sbjct  350   AVARSLCWNKLKEKGDIAIWQKPINHIGCKANRKTVRSPQFCQSQNPDTAWYTKTESCIT  409

Query  959   PSPKA-NIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKR-  798
             P P+   ++E      KK+PERLTA+PPRIA G + G + E +L D + WK  V  YK  
Sbjct  410   PLPEVVRVEEISGGELKKWPERLTAVPPRIARGSIDGATPEVFLQDTELWKNRVGYYKTV  469

Query  797   INKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYH  618
             IN++   GRYRN++DMNA  GGFAA L     WVMN+VPT AD +TLGVIYERG+IG Y 
Sbjct  470   INQLGQKGRYRNLLDMNAKFGGFAAALIDDPLWVMNIVPTAADVNTLGVIYERGLIGTYQ  529

Query  617   DWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKV  438
             DWCE  STYPRTYDL+HA+ VF+LYKD+C+ EDILLEMDRILRPEG V+ RD+VD L+K+
Sbjct  530   DWCEAMSTYPRTYDLLHADSVFTLYKDRCEMEDILLEMDRILRPEGTVIIRDDVDALVKI  589

Query  437   RRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTN  318
             + I  GMRW+ ++MDHEDGPL  EK+L+ VK YWT    N
Sbjct  590   KSIADGMRWNSRIMDHEDGPLQREKLLLVVKTYWTAPGPN  629



>dbj|BAJ87212.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/277 (57%), Positives = 207/277 (75%), Gaps = 7/277 (3%)
 Frame = -1

Query  1133  IAKLLCWEKKSEKGEIAIWQERMDVDSCRASQKKSKAT-FCQSGDPDDVWYKKMDVCITP  957
             +AK LCW+K  E G+IAIWQ+  +   C+A +K +K+  FC + +PD  WY+KM+ CITP
Sbjct  352   VAKSLCWKKIKEVGDIAIWQKPTNHIHCKALRKVAKSPPFCSNKNPDAAWYEKMEACITP  411

Query  956   SPK-ANIDE----SFKKFPERLTAIPPRIANGLVSGVSAEAYLDDNKKWKKHVSAYKRI-  795
              P+ ++I E      KK+P+RLTA+PPRIA+G   GV+AE + +D K WKK V  YK + 
Sbjct  412   LPEVSDIKEVAGGELKKWPQRLTAVPPRIASGSFEGVTAEMFNEDTKLWKKRVGHYKSVV  471

Query  794   NKIIDTGRYRNIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYERGMIGIYHD  615
             ++    GRYRN++DMNA  GGFAA L     WVMN+VPTI + +TLGVIYERG+IG Y D
Sbjct  472   SQFGQKGRYRNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNSTTLGVIYERGLIGNYQD  531

Query  614   WCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVR  435
             WCEG STYPRTYDLIHA+ VFSLYKD+C+ + ILLEMDRILRPEG V+ RD+VD L+K++
Sbjct  532   WCEGMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPEGTVIIRDDVDLLVKIK  591

Query  434   RIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLND  324
              +  GMRW+ +++DHEDGPLV EK+L+ VK YWTL D
Sbjct  592   SVADGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLGD  628



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3072589671640