BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5278

Length=845
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97777.1|  unnamed protein product                                354   2e-113   Coffea canephora [robusta coffee]
ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    354   3e-113   Nicotiana sylvestris
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    354   3e-113   Nicotiana tomentosiformis
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    352   2e-112   Sesamum indicum [beniseed]
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    348   6e-111   Nicotiana tomentosiformis
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    342   1e-108   Nicotiana sylvestris
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    342   1e-108   Nicotiana sylvestris
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    341   2e-108   
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                331   2e-104   Erythranthe guttata [common monkey flower]
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                331   2e-104   Erythranthe guttata [common monkey flower]
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    327   8e-103   Solanum tuberosum [potatoes]
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    326   9e-103   Sesamum indicum [beniseed]
gb|EPS61932.1|  ovule receptor-like kinase 28                           325   3e-102   Genlisea aurea
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    325   5e-102   
gb|ABO31100.1|  ovule receptor-like kinase 28                           324   1e-101   Solanum chacoense
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    323   1e-101   Nicotiana sylvestris
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    323   1e-101   Nicotiana sylvestris
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    319   8e-100   Vitis vinifera
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    319   9e-100   Nicotiana tomentosiformis
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    318   2e-99    Solanum lycopersicum
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    317   4e-99    Solanum tuberosum [potatoes]
emb|CBI35784.3|  unnamed protein product                                316   1e-98    Vitis vinifera
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    315   2e-98    Solanum lycopersicum
ref|XP_012068778.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    302   3e-93    Jatropha curcas
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    302   4e-93    Nelumbo nucifera [Indian lotus]
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         300   2e-92    Jatropha curcas
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    292   1e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    290   1e-88    Populus euphratica
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    288   6e-88    Tarenaya hassleriana [spider flower]
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    288   1e-87    Malus domestica [apple tree]
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    288   1e-87    Eucalyptus grandis [rose gum]
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    286   3e-87    Populus euphratica
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    285   3e-87    
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    286   4e-87    
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             286   6e-87    Eutrema salsugineum [saltwater cress]
gb|AAG51973.1|AC024260_11  leucine-rich repeat transmembrane prot...    280   7e-87    Arabidopsis thaliana [mouse-ear cress]
emb|CDY36601.1|  BnaC06g06540D                                          285   7e-87    Brassica napus [oilseed rape]
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    285   2e-86    
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    284   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    284   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   3e-86    Populus euphratica
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    284   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   4e-86    
emb|CDY24077.1|  BnaA06g00750D                                          283   5e-86    Brassica napus [oilseed rape]
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   5e-86    Cucumis melo [Oriental melon]
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    283   5e-86    
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    283   5e-86    Brassica rapa
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    282   1e-85    Glycine soja [wild soybean]
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    282   1e-85    
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    282   2e-85    Glycine max [soybeans]
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    282   2e-85    Fragaria vesca subsp. vesca
ref|XP_002513297.1|  strubbelig receptor, putative                      281   2e-85    
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    281   3e-85    Brassica rapa
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     281   3e-85    Eucalyptus grandis [rose gum]
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    281   3e-85    Arabis alpina [alpine rockcress]
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  280   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    280   5e-85    
ref|XP_010655240.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   6e-85    
ref|XP_011659817.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    280   6e-85    Cucumis sativus [cucumbers]
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       280   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          280   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    280   7e-85    Cucumis sativus [cucumbers]
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  280   9e-85    Arabidopsis thaliana [mouse-ear cress]
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         279   1e-84    Jatropha curcas
ref|XP_012087291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    279   1e-84    
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    279   2e-84    Isatis tinctoria [woad]
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             279   2e-84    Capsella rubella
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             279   2e-84    
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   2e-84    Phoenix dactylifera
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   2e-84    Vitis vinifera
emb|CBI18374.3|  unnamed protein product                                278   3e-84    Vitis vinifera
emb|CDY02495.1|  BnaA08g01020D                                          278   4e-84    
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    279   5e-84    
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    277   9e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          276   2e-83    Sorghum bicolor [broomcorn]
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             276   2e-83    Citrus clementina [clementine]
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             276   3e-83    Capsella rubella
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               275   6e-83    Morus notabilis
ref|XP_010489831.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    266   6e-83    Camelina sativa [gold-of-pleasure]
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    275   7e-83    Arabis alpina [alpine rockcress]
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          275   7e-83    Sorghum bicolor [broomcorn]
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 274   1e-82    Medicago truncatula
emb|CDY25686.1|  BnaC03g69890D                                          274   2e-82    Brassica napus [oilseed rape]
emb|CDX97567.1|  BnaA05g25120D                                          273   3e-82    
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    273   3e-82    
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             272   6e-82    
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    272   1e-81    Setaria italica
ref|NP_001049184.1|  Os03g0183800                                       272   1e-81    
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    271   1e-81    Glycine soja [wild soybean]
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    271   1e-81    Citrus sinensis [apfelsine]
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    271   2e-81    
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    271   2e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    271   2e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    271   2e-81    Brassica rapa
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    271   3e-81    
ref|XP_008668240.1|  PREDICTED: uncharacterized protein LOC100381...    269   3e-81    
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                270   5e-81    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    270   5e-81    Populus euphratica
ref|XP_008668239.1|  PREDICTED: uncharacterized protein LOC100381...    269   6e-81    Zea mays [maize]
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  269   7e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    269   8e-81    
gb|KJB57112.1|  hypothetical protein B456_009G148500                    269   1e-80    Gossypium raimondii
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    269   1e-80    Zea mays [maize]
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    269   2e-80    Gossypium arboreum [tree cotton]
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    268   3e-80    Cicer arietinum [garbanzo]
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    268   4e-80    
ref|XP_007139054.1|  hypothetical protein PHAVU_009G260900g             264   4e-80    Phaseolus vulgaris [French bean]
gb|KDO67050.1|  hypothetical protein CISIN_1g040888mg                   262   4e-80    Citrus sinensis [apfelsine]
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    267   5e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011659592.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   6e-80    Cucumis sativus [cucumbers]
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    266   8e-80    
gb|KJB67061.1|  hypothetical protein B456_010G172500                    265   8e-80    Gossypium raimondii
gb|KJB67062.1|  hypothetical protein B456_010G172500                    265   8e-80    Gossypium raimondii
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             266   2e-79    
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 267   2e-79    
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    266   2e-79    Prunus mume [ume]
ref|XP_011659594.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    266   2e-79    Cucumis sativus [cucumbers]
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    265   2e-79    
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    265   3e-79    
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   3e-79    Cucumis melo [Oriental melon]
gb|KHG25534.1|  protein strubbelig-receptor family 6                    265   3e-79    Gossypium arboreum [tree cotton]
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      265   4e-79    
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    265   4e-79    Zea mays [maize]
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    265   5e-79    Sesamum indicum [beniseed]
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   6e-79    Tarenaya hassleriana [spider flower]
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             265   7e-79    Phaseolus vulgaris [French bean]
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      263   8e-79    Zea mays [maize]
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    263   8e-79    Populus euphratica
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             263   1e-78    Phaseolus vulgaris [French bean]
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               263   1e-78    
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    263   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX98445.1|  BnaC05g39300D                                          263   2e-78    
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       263   2e-78    Cucumis sativus [cucumbers]
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             263   2e-78    Eutrema salsugineum [saltwater cress]
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             263   2e-78    
gb|EEC85048.1|  hypothetical protein OsI_32379                          262   3e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    262   4e-78    Citrus sinensis [apfelsine]
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    262   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   6e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   8e-78    Elaeis guineensis
gb|EEE70214.1|  hypothetical protein OsJ_30326                          260   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             261   1e-77    Eutrema salsugineum [saltwater cress]
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    261   1e-77    Setaria italica
ref|NP_001063921.1|  Os09g0559900                                       260   1e-77    
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    260   2e-77    Brassica rapa
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    259   2e-77    Medicago truncatula
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   4e-77    Elaeis guineensis
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    258   5e-77    Cucumis sativus [cucumbers]
ref|XP_007023606.1|  Strubbelig-receptor family 5 isoform 2             261   5e-77    
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   6e-77    Tarenaya hassleriana [spider flower]
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   6e-77    
ref|NP_001064502.1|  Os10g0389800                                       259   7e-77    
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             262   7e-77    
tpg|DAA46921.1|  TPA: putative STRUBBELIG family receptor protein...    249   7e-77    
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   7e-77    Cicer arietinum [garbanzo]
emb|CDY39110.1|  BnaA01g29460D                                          259   8e-77    Brassica napus [oilseed rape]
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   1e-76    Glycine max [soybeans]
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   1e-76    Brachypodium distachyon [annual false brome]
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   2e-76    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    257   2e-76    Gossypium arboreum [tree cotton]
gb|KEH24658.1|  strubbelig-receptor family protein                      256   6e-76    Medicago truncatula
ref|XP_007024796.1|  Strubbelig-receptor family 6                       256   6e-76    
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          256   9e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    256   1e-75    Setaria italica
gb|EPS68087.1|  hypothetical protein M569_06686                         253   2e-75    Genlisea aurea
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    255   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             255   3e-75    
ref|NP_001060286.1|  Os07g0618400                                       255   3e-75    
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          254   3e-75    Sorghum bicolor [broomcorn]
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    254   3e-75    Arabis alpina [alpine rockcress]
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   4e-75    Brachypodium distachyon [annual false brome]
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   4e-75    
gb|EEC82450.1|  hypothetical protein OsI_26884                          254   5e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   8e-75    Nelumbo nucifera [Indian lotus]
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    253   8e-75    
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             253   1e-74    Prunus persica
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    252   1e-74    
tpg|DAA46922.1|  TPA: putative STRUBBELIG family receptor protein...    251   1e-74    
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        253   2e-74    Glycine soja [wild soybean]
emb|CDX88495.1|  BnaC06g39390D                                          252   2e-74    
emb|CDY33226.1|  BnaC01g36990D                                          252   2e-74    Brassica napus [oilseed rape]
emb|CDX87418.1|  BnaA07g34550D                                          252   2e-74    
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    252   2e-74    Brassica rapa
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    252   2e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    252   3e-74    Cicer arietinum [garbanzo]
gb|KHG18134.1|  protein strubbelig-receptor family 6                    252   3e-74    Gossypium arboreum [tree cotton]
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    252   4e-74    Nelumbo nucifera [Indian lotus]
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     251   4e-74    Zea mays [maize]
gb|KJB70030.1|  hypothetical protein B456_011G054100                    251   6e-74    Gossypium raimondii
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    251   7e-74    Prunus mume [ume]
ref|XP_006836581.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    251   8e-74    Amborella trichopoda
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    251   9e-74    
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    250   2e-73    
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    250   2e-73    Phoenix dactylifera
ref|XP_002889223.1|  ATP binding protein                                249   3e-73    
ref|XP_010429764.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    248   3e-73    
gb|KJB56462.1|  hypothetical protein B456_009G120500                    249   3e-73    Gossypium raimondii
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     248   4e-73    Eucalyptus grandis [rose gum]
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    249   4e-73    Fragaria vesca subsp. vesca
ref|XP_006850999.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    248   6e-73    
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    248   7e-73    Eucalyptus grandis [rose gum]
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    248   8e-73    Eucalyptus grandis [rose gum]
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    247   1e-72    Pyrus x bretschneideri [bai li]
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                248   1e-72    Erythranthe guttata [common monkey flower]
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             246   2e-72    Capsella rubella
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   3e-72    Pyrus x bretschneideri [bai li]
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    246   3e-72    
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   3e-72    
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    246   4e-72    Camelina sativa [gold-of-pleasure]
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   4e-72    Nicotiana sylvestris
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   5e-72    
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   7e-72    Elaeis guineensis
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    245   1e-71    Zea mays [maize]
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             244   2e-71    Phaseolus vulgaris [French bean]
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    245   2e-71    Setaria italica
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               244   2e-71    
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    244   3e-71    Elaeis guineensis
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             243   4e-71    
gb|KJB69229.1|  hypothetical protein B456_011G011800                    239   5e-71    Gossypium raimondii
gb|KDO78353.1|  hypothetical protein CISIN_1g005001mg                   237   5e-71    Citrus sinensis [apfelsine]
dbj|BAG99361.1|  unnamed protein product                                242   1e-70    Oryza sativa Japonica Group [Japonica rice]
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    242   3e-70    Oryza sativa Japonica Group [Japonica rice]
gb|EAY90345.1|  hypothetical protein OsI_11922                          242   3e-70    Oryza sativa Indica Group [Indian rice]
gb|AAC27896.1|  leucine-rich repeat transmembrane protein kinase 3      232   3e-70    Zea mays [maize]
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    239   3e-70    Triticum urartu
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   6e-70    
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    240   6e-70    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB69230.1|  hypothetical protein B456_011G011800                    239   7e-70    Gossypium raimondii
gb|KDO78351.1|  hypothetical protein CISIN_1g005001mg                   237   8e-70    Citrus sinensis [apfelsine]
emb|CDO97730.1|  unnamed protein product                                241   8e-70    Coffea canephora [robusta coffee]
gb|EEC81030.1|  hypothetical protein OsI_23812                          240   1e-69    Oryza sativa Indica Group [Indian rice]
gb|KDO78348.1|  hypothetical protein CISIN_1g005001mg                   238   1e-69    Citrus sinensis [apfelsine]
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          241   1e-69    Oryza sativa Japonica Group [Japonica rice]
gb|KDO78349.1|  hypothetical protein CISIN_1g005001mg                   238   1e-69    Citrus sinensis [apfelsine]
gb|KJB69228.1|  hypothetical protein B456_011G011800                    239   2e-69    Gossypium raimondii
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    238   2e-69    Glycine soja [wild soybean]
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   3e-69    Zea mays [maize]
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      238   3e-69    Zea mays [maize]
ref|XP_006845116.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    239   3e-69    Amborella trichopoda
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    239   3e-69    Vitis vinifera
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   3e-69    Zea mays [maize]
ref|XP_008649051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   4e-69    Zea mays [maize]
ref|XP_008649052.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   4e-69    Zea mays [maize]
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   4e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   6e-69    
ref|XP_009146553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    237   6e-69    Brassica rapa
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   9e-69    Citrus sinensis [apfelsine]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   237   1e-68    Citrus sinensis [apfelsine]
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   1e-68    Nicotiana sylvestris
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    236   2e-68    Zea mays [maize]
ref|XP_006449792.1|  hypothetical protein CICLE_v10014418mg             234   2e-68    
ref|XP_006407265.1|  hypothetical protein EUTSA_v10020193mg             236   2e-68    Eutrema salsugineum [saltwater cress]
gb|KHG11352.1|  protein strubbelig-receptor family 8                    236   2e-68    Gossypium arboreum [tree cotton]
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      235   3e-68    
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             235   3e-68    Capsella rubella
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   4e-68    Glycine max [soybeans]
ref|XP_009124710.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   4e-68    Brassica rapa
ref|NP_566444.4|  STRUBBELIG-receptor family 4                          235   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    236   5e-68    Oryza brachyantha
emb|CDY44024.1|  BnaA05g26190D                                          235   5e-68    Brassica napus [oilseed rape]
emb|CDY43376.1|  BnaA01g30070D                                          234   6e-68    Brassica napus [oilseed rape]
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   8e-68    Solanum lycopersicum
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    234   9e-68    Camelina sativa [gold-of-pleasure]
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   1e-67    Zea mays [maize]
ref|XP_010552382.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    233   1e-67    
emb|CDY23563.1|  BnaC05g40310D                                          234   1e-67    Brassica napus [oilseed rape]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   1e-67    Cucumis sativus [cucumbers]
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   1e-67    Solanum lycopersicum
dbj|BAK07184.1|  predicted protein                                      234   2e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             234   2e-67    Citrus clementina [clementine]
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   2e-67    Oryza brachyantha
gb|KFK38641.1|  hypothetical protein AALP_AA3G141300                    233   2e-67    Arabis alpina [alpine rockcress]
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   2e-67    Camelina sativa [gold-of-pleasure]
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    233   2e-67    Brachypodium distachyon [annual false brome]
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   2e-67    Cucumis melo [Oriental melon]
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   3e-67    Setaria italica
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   3e-67    Glycine max [soybeans]
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    233   4e-67    Fragaria vesca subsp. vesca
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   4e-67    
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   5e-67    
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   6e-67    
emb|CDP04441.1|  unnamed protein product                                233   6e-67    
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   7e-67    
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   2e-66    
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   2e-66    
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   2e-66    
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   2e-66    
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   2e-66    
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    230   4e-66    
dbj|BAK02781.1|  predicted protein                                      230   4e-66    
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    230   4e-66    
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    230   6e-66    
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      230   7e-66    
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      230   7e-66    
gb|EEC66871.1|  hypothetical protein OsI_33412                          229   8e-66    
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   1e-65    
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   1e-65    
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   2e-65    
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    228   3e-65    
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             227   4e-65    
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             226   7e-65    
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   9e-65    
dbj|BAK05038.1|  predicted protein                                      226   1e-64    
ref|XP_002869840.1|  kinase                                             226   1e-64    
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             226   1e-64    
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-64    
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   2e-64    
emb|CDX76385.1|  BnaA08g10150D                                          225   3e-64    
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             225   3e-64    
dbj|BAB01397.1|  protein kinase-like protein                            228   4e-64    
ref|XP_002882805.1|  predicted protein                                  228   4e-64    
emb|CDP11378.1|  unnamed protein product                                214   5e-64    
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    224   7e-64    
gb|AFW90526.1|  strubbelig-receptor family 6-like protein               223   9e-64    
gb|ACI49786.1|  At3g13065                                               223   9e-64    
gb|ERN11631.1|  hypothetical protein AMTR_s00022p00198910               223   1e-63    
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    227   1e-63    
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    222   1e-63    
ref|XP_012091293.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   2e-63    
gb|KJB67277.1|  hypothetical protein B456_010G183400                    220   2e-63    
gb|KJB67280.1|  hypothetical protein B456_010G183400                    220   3e-63    
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   4e-63    
emb|CDY27444.1|  BnaC03g64840D                                          222   4e-63    
gb|EPS69681.1|  hypothetical protein M569_05081                         221   7e-63    
gb|KJB67278.1|  hypothetical protein B456_010G183400                    221   8e-63    
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    221   8e-63    
gb|EMS56044.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    220   8e-63    
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    221   8e-63    
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    221   1e-62    
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    221   1e-62    
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             220   1e-62    
gb|KJB67276.1|  hypothetical protein B456_010G183400                    220   1e-62    
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  220   2e-62    
gb|KCW90298.1|  hypothetical protein EUGRSUZ_A02440                     220   2e-62    
ref|XP_010057986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    220   2e-62    
gb|EYU39916.1|  hypothetical protein MIMGU_mgv1a001954mg                220   3e-62    
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    219   3e-62    
emb|CDX79126.1|  BnaA01g11930D                                          219   4e-62    
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   8e-62    
emb|CDX82908.1|  BnaC01g13580D                                          218   8e-62    
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   9e-62    
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          218   1e-61    
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   1e-61    
ref|XP_006425179.1|  hypothetical protein CICLE_v10030356mg             216   1e-61    
ref|XP_006383865.1|  hypothetical protein POPTR_0004s00710g             213   2e-61    
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   3e-61    
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    217   3e-61    
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    216   5e-61    
ref|XP_012091295.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   5e-61    
ref|XP_011468063.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   6e-61    
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    216   6e-61    
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   7e-61    
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   1e-60    
emb|CAN80221.1|  hypothetical protein VITISV_027894                     214   1e-60    
ref|XP_012087800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    215   1e-60    
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             214   2e-60    
gb|EMT01284.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    214   2e-60    
emb|CDX98961.1|  BnaC09g48740D                                          214   2e-60    
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   3e-60    
ref|XP_009122296.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   3e-60    
emb|CDX70063.1|  BnaA10g24120D                                          214   4e-60    
ref|XP_002532341.1|  Receptor protein kinase CLAVATA1 precursor, ...    213   5e-60    
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   5e-60    
ref|XP_011075267.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    213   1e-59    
ref|XP_007204855.1|  hypothetical protein PRUPE_ppa026263mg             213   2e-59    
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    211   2e-59    
gb|KEH36931.1|  strubbelig-receptor family protein                      212   2e-59    
gb|KDO50163.1|  hypothetical protein CISIN_1g039558mg                   212   2e-59    
ref|XP_006492890.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    212   3e-59    
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    211   3e-59    
ref|XP_006399158.1|  hypothetical protein EUTSA_v10012782mg             211   5e-59    
gb|KFK25072.1|  hypothetical protein AALP_AA8G062600                    211   8e-59    
ref|XP_010534354.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   9e-59    
ref|XP_010534352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   1e-58    
emb|CDP20023.1|  unnamed protein product                                209   1e-58    
gb|EEE67594.1|  hypothetical protein OsJ_25142                          209   2e-58    
ref|XP_006429833.1|  hypothetical protein CICLE_v10013344mg             209   3e-58    
ref|XP_010672691.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    208   4e-58    
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   5e-58    
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   5e-58    
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   5e-58    
ref|XP_008241034.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    207   8e-58    
ref|XP_011004818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    207   1e-57    
ref|XP_009797583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   1e-57    
ref|XP_009612111.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    207   2e-57    
gb|EEC72655.1|  hypothetical protein OsI_06182                          206   2e-57    
ref|XP_012091294.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   4e-57    
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   4e-57    
ref|XP_002451714.1|  hypothetical protein SORBIDRAFT_04g006475          206   5e-57    
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    204   1e-56    
ref|XP_009370199.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   2e-56    
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              203   2e-56    
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   5e-56    
ref|XP_010557935.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   6e-56    
ref|XP_002316560.2|  hypothetical protein POPTR_0011s01540g             199   7e-56    
ref|XP_010456423.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    200   7e-56    
ref|XP_008465038.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   8e-56    
ref|XP_011652104.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    202   9e-56    
ref|XP_011468043.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   1e-55    
ref|XP_008443075.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    202   1e-55    
ref|XP_010236315.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   1e-55    
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   2e-55    
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    200   3e-55    
ref|XP_007028952.1|  STRUBBELIG-receptor family 2, putative             201   4e-55    
ref|NP_196300.1|  STRUBBELIG-receptor family 2                          200   4e-55    
ref|XP_010423292.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   4e-55    
ref|XP_010491264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   6e-55    
ref|XP_006287140.1|  hypothetical protein CARUB_v10000312mg             199   7e-55    
ref|XP_010257427.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   7e-55    
ref|XP_008392158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    199   7e-55    
ref|XP_010257424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   8e-55    
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             199   9e-55    
gb|EEE66066.1|  hypothetical protein OsJ_22073                          199   9e-55    
ref|XP_010423291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   1e-54    
ref|XP_002308374.2|  leucine-rich repeat transmembrane protein ki...    198   1e-54    
ref|XP_002871232.1|  hypothetical protein ARALYDRAFT_908613             199   2e-54    
ref|NP_001046150.1|  Os02g0190500                                       198   2e-54    
gb|KGN59317.1|  hypothetical protein Csa_3G809930                       198   2e-54    
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   3e-54    
gb|ERN12580.1|  hypothetical protein AMTR_s00025p00216900               196   5e-54    
ref|XP_009376134.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   5e-54    
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   1e-53    
gb|EPS64024.1|  hypothetical protein M569_10757                         196   1e-53    
gb|KHN07244.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                    195   3e-53    
ref|XP_006589916.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   3e-53    
gb|KHN28754.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                    194   6e-53    
emb|CBI30038.3|  unnamed protein product                                193   1e-52    
ref|XP_010914020.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    192   4e-52    
ref|XP_008679889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    191   5e-52    
gb|AFW66206.1|  putative STRUBBELIG family receptor protein kinase      188   6e-52    
ref|XP_010654321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    191   7e-52    
ref|XP_006648415.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    189   3e-51    
ref|XP_002460659.1|  hypothetical protein SORBIDRAFT_02g032710          188   4e-51    
ref|XP_010533880.1|  PREDICTED: protein STRUBBELIG                      189   4e-51    
ref|XP_004507203.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   5e-50    
gb|KEH41669.1|  strubbelig-receptor family 2 protein                    186   5e-50    
ref|XP_012088339.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   1e-49    
ref|XP_008439889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   2e-49    
ref|XP_006582789.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   3e-49    
gb|KHN41147.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    184   3e-49    
gb|KHN22911.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    184   3e-49    
ref|XP_009797595.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    183   4e-49    
ref|XP_011468044.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   5e-49    
gb|KHG18089.1|  Protein STRUBBELIG -like protein                        183   6e-49    
ref|XP_010317941.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    183   6e-49    
ref|XP_011468064.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   2e-48    
ref|XP_008679890.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   2e-48    
ref|XP_008679888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   3e-48    
ref|XP_010526524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   7e-48    
ref|NP_001046179.2|  Os02g0194600                                       180   8e-48    
ref|XP_007132645.1|  hypothetical protein PHAVU_011G112700g             180   9e-48    
ref|XP_010905455.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   1e-47    
ref|XP_010905439.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   1e-47    
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   1e-47    
gb|KJB69458.1|  hypothetical protein B456_011G024500                    178   1e-47    
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    178   2e-47    
gb|KJB69459.1|  hypothetical protein B456_011G024500                    178   2e-47    
ref|XP_010655241.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-47    
ref|XP_008371312.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    177   4e-47    
gb|KEH29625.1|  strubbelig receptor family protein                      178   6e-47    
gb|AFW66318.1|  putative STRUBBELIG family receptor protein kinase      176   8e-47    
gb|KEH29624.1|  strubbelig receptor family protein                      177   8e-47    
gb|KHN04276.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    176   1e-46    
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          176   1e-46    
ref|XP_003539524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   1e-46    
emb|CAC09572.1|  thymidine kinase (LTK)                                 165   1e-46    
ref|XP_002453383.1|  hypothetical protein SORBIDRAFT_04g005115          176   2e-46    
ref|NP_001169655.1|  uncharacterized LOC100383536 precursor             176   2e-46    
ref|XP_011659595.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   2e-46    
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   3e-46    
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   3e-46    
ref|XP_011659593.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    165   3e-46    
ref|XP_007135872.1|  hypothetical protein PHAVU_010G165200g             174   4e-46    
ref|XP_008680888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   4e-46    
ref|XP_010458496.1|  PREDICTED: protein STRUBBELIG                      174   5e-46    
ref|XP_003541551.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   6e-46    
gb|KEH39082.1|  strubbelig receptor family protein                      174   6e-46    
ref|XP_006467860.1|  PREDICTED: protein STRUBBELIG-like                 174   7e-46    
gb|KEH39081.1|  strubbelig receptor family protein                      174   7e-46    
ref|XP_006594332.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   7e-46    
ref|XP_008462233.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   8e-46    
ref|XP_010492393.1|  PREDICTED: protein STRUBBELIG-like                 174   8e-46    
ref|XP_010476014.1|  PREDICTED: protein STRUBBELIG-like                 174   1e-45    
ref|XP_006594861.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   1e-45    
ref|XP_009124712.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   1e-45    
ref|XP_010905434.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-45    
ref|XP_010905426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-45    
ref|XP_010905417.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-45    
ref|XP_003560082.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    173   2e-45    
ref|XP_010905405.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-45    
ref|XP_010905397.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-45    
ref|XP_010102562.1|  hypothetical protein L484_018034                   167   2e-45    
ref|XP_010905390.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   2e-45    
ref|XP_010905411.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   2e-45    
ref|XP_007159275.1|  hypothetical protein PHAVU_002G224200g             172   4e-45    
ref|XP_006449268.1|  hypothetical protein CICLE_v10014419mg             172   4e-45    
gb|ERN06789.1|  hypothetical protein AMTR_s00005p00184180               162   4e-45    
ref|XP_010476010.1|  PREDICTED: protein STRUBBELIG-like                 163   5e-45    
ref|NP_172580.2|  receptor-like kinase STRUBBELIG                       172   5e-45    
ref|XP_010556827.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    172   6e-45    



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 206/246 (84%), Gaps = 2/246 (1%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            MRE+  L  AVALL   LL  P    ADTDP DA+VL  L+ SLNSP QLTKW  NGGDP
Sbjct  1    MREV-ELAAAVALLGCILLLGPSFTNADTDPNDAAVLFDLYKSLNSPSQLTKWNPNGGDP  59

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            C E+WKG++CSG+RVTEI++SGL LTGSMGF+LD+LKSVT FDIS NNLGN LP+QLP N
Sbjct  60   CNENWKGITCSGSRVTEIKLSGLGLTGSMGFELDKLKSVTNFDISNNNLGNQLPFQLPQN  119

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            VQ+LNLAGNGF GGLPYS+SQM  L+YLNVSHNQ QG+++ MF SLT+LSTLDFSFN ++
Sbjct  120  VQQLNLAGNGFNGGLPYSVSQMTSLKYLNVSHNQFQGQLSDMFASLTSLSTLDFSFNVMS  179

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ  819
            G++P++FSS T+M +M LQNN FTGTIDVLANLPLDNLNVENNHF+GWIP QL+ IN LQ
Sbjct  180  GDLPKSFSSCTSMTDMNLQNNQFTGTIDVLANLPLDNLNVENNHFSGWIPDQLKDIN-LQ  238

Query  820  TGGNSW  837
            TGGNSW
Sbjct  239  TGGNSW  244



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   354 bits (909),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 199/235 (85%), Gaps = 3/235 (1%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-  318
            IG L   P  A+ADTDP DAS LR ++ +LNSP QLTKWTANGGDPCGESWKG++CSGN 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++SGLQL+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLAGNGF G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
            GLPYSISQM  L YLNVSHNQ+QG+VTV F SL++L+TLDFSFN++  N+PQ+F +LT+M
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTDNLPQSFKALTSM  194

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
              MYLQNN FTGTIDVLANLPLD+LNVENN FTGW+P QL+G   +++ GNSWNS
Sbjct  195  NKMYLQNNQFTGTIDVLANLPLDDLNVENNRFTGWVPDQLKGF--VKSNGNSWNS  247



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   354 bits (908),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 199/235 (85%), Gaps = 3/235 (1%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-  318
            IG L   P  A+ADTDP DAS LR ++ +LNSP QLTKWTANGGDPCGESWKG++CSGN 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++SGLQL+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLAGNGF G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
            GLPYSISQM  L YLNVSHNQ+QG+VTV F SL++L+TLDFSFN++  N+PQ+F +LT+M
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTDNLPQSFKALTSM  194

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
              MYLQNN FTGTIDVLANLPLD+LNVENN FTGW+P QL+G   +++ GNSWNS
Sbjct  195  NKMYLQNNQFTGTIDVLANLPLDDLNVENNRFTGWVPDQLKGF--VKSNGNSWNS  247



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/237 (74%), Positives = 200/237 (84%), Gaps = 5/237 (2%)
 Frame = +1

Query  133  ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            ALLIG     P S  ADTDPTDAS L  +++SLNSPP LT W  NGGDPCGESWKGVSCS
Sbjct  18   ALLIGI----PSSTNADTDPTDASTLNIMYTSLNSPPLLTNWKPNGGDPCGESWKGVSCS  73

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  492
            G++VTEI+I GL LTG+MG+QLD+L SVTTFDIS NNLGN +P+QLPPNVQ+LNLAGNGF
Sbjct  74   GSKVTEIKIPGLGLTGNMGYQLDRLTSVTTFDISNNNLGNQIPFQLPPNVQRLNLAGNGF  133

Query  493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT  672
             GGLPYSIS M  L YLNVSHNQ+QG+V V F SLT+LSTLDFSFNSL  N+PQ+F SLT
Sbjct  134  NGGLPYSISLMTSLRYLNVSHNQIQGQVNVQFNSLTSLSTLDFSFNSLTDNLPQSFQSLT  193

Query  673  NMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            N+ +MYLQNN FTG++DVLANLPL NLNVENNHFTGWIP QL+GIN L+T GNS+NS
Sbjct  194  NINDMYLQNNQFTGSLDVLANLPLQNLNVENNHFTGWIPEQLKGIN-LKTSGNSFNS  249



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   348 bits (893),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 194/221 (88%), Gaps = 2/221 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP+DASVLR L++SLNSP QLTKW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  25   DTDPSDASVLRVLYTSLNSPAQLTKWSANGGDPCGESWTGITCSGNRVTEIKISGLGLSG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF GGLPYSISQM  L+Y
Sbjct  85   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFNGGLPYSISQMTSLQY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG VTV F SL+ L+TLDFSFNS+ GN+PQ+F SLT+M  MYLQNN FTGTI
Sbjct  145  LNVSHNQIQGSVTVAFDSLSALNTLDFSFNSMTGNLPQSFQSLTSMNKMYLQNNQFTGTI  204

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLANLPL +LNVENN FTGWIP QL+GI  +Q+ GNSW+S
Sbjct  205  DVLANLPLGDLNVENNQFTGWIPNQLKGI--VQSNGNSWSS  243



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 200/243 (82%), Gaps = 11/243 (5%)
 Frame = +1

Query  142  IGFLLNAPPSAVA---------DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESW  294
            + FLL     AVA         +TDP+DASVLR L++SLNSP QL KW+ANGGDPCGESW
Sbjct  1    MRFLLQVMVVAVALFFSSANGTETDPSDASVLRVLYTSLNSPAQLKKWSANGGDPCGESW  60

Query  295  KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN  474
             G++CSGNRVTEI+ISGL L+GSMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LN
Sbjct  61   TGITCSGNRVTEIKISGLALSGSMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLN  120

Query  475  LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ  654
            LA +GF+GGLPYSISQM  L+YLNVSHNQ+QG VTV F SL+ L+TLDFSFNS+ GN+PQ
Sbjct  121  LAASGFSGGLPYSISQMTSLQYLNVSHNQIQGSVTVAFDSLSALNTLDFSFNSMTGNLPQ  180

Query  655  TFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS  834
            +F  LT++  MYLQNN FTGTIDVLANLPL +LNVENN FTGWIP QL+GI  +Q+ GNS
Sbjct  181  SFQLLTSVNKMYLQNNQFTGTIDVLANLPLGDLNVENNQFTGWIPNQLKGI--VQSNGNS  238

Query  835  WNS  843
            W+S
Sbjct  239  WSS  241



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 193/221 (87%), Gaps = 2/221 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP+DASVLR L++SLNSP QL KW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  16   ETDPSDASVLRVLYTSLNSPAQLKKWSANGGDPCGESWTGITCSGNRVTEIKISGLALSG  75

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  76   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFSGGLPYSISQMTSLQY  135

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG VTV F SL+ L+TLDFSFNS+ GN+PQ+F  LT++  MYLQNN FTGTI
Sbjct  136  LNVSHNQIQGSVTVAFDSLSALNTLDFSFNSMTGNLPQSFQLLTSVNKMYLQNNQFTGTI  195

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLANLPL +LNVENN FTGWIP QL+GI  +Q+ GNSW+S
Sbjct  196  DVLANLPLGDLNVENNQFTGWIPNQLKGI--VQSNGNSWSS  234



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/237 (73%), Positives = 199/237 (84%), Gaps = 2/237 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            ++LLIG LL     A+ADTDP DAS LR L+SSLNSP QLTKW ANGGDPCGESW G++C
Sbjct  6    LSLLIGILLYCAYCAIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SGNRVTEI+ISGL L+GS+G+QL  L SVT FDIS NNLGN LP+QLPPNVQ+LNLA NG
Sbjct  66   SGNRVTEIKISGLGLSGSLGYQLTSLTSVTNFDISNNNLGNQLPFQLPPNVQRLNLAANG  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            F GGLPYSISQM  L YLNVSHNQ+QG+VTVMF SL++L TLDFSFNS+ G++PQ+F +L
Sbjct  126  FNGGLPYSISQMTSLRYLNVSHNQIQGQVTVMFDSLSSLDTLDFSFNSMTGDLPQSFKAL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            T+M  MYLQNN FTGTIDVLANLPLD+LNVE NHFTGW+P  L+GI   ++ GNSWN
Sbjct  186  TSMNKMYLQNNQFTGTIDVLANLPLDDLNVEKNHFTGWVPDHLKGIT--KSNGNSWN  240



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 195/244 (80%), Gaps = 5/244 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            M +  AVALLIG L        ADTDPTDAS L  L++SLNSP QLT W  +GGDPC ES
Sbjct  1    MAVVAAVALLIGIL----SFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAES  56

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++CSG++VTEI I GL L G+MGFQLD+L SVTTFDIS NNLGN +PYQLPPNV++L
Sbjct  57   WKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERL  116

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGNGF  GLPYSIS M  L+YLN+SHNQ+QG+VTV F SLT L+TLDFSFNS   N+P
Sbjct  117  NLAGNGFNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLTTLDFSFNSFTDNLP  176

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            Q+F SLT++ +MYLQNN FTGT+DVLA LPL NLNVENN FTGWIP QL+GIN +Q+ GN
Sbjct  177  QSFQSLTSINDMYLQNNQFTGTLDVLALLPLQNLNVENNRFTGWIPSQLKGIN-VQSNGN  235

Query  832  SWNS  843
              NS
Sbjct  236  LLNS  239



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 195/244 (80%), Gaps = 5/244 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            M +  AVALLIG L        ADTDPTDAS L  L++SLNSP QLT W  +GGDPC ES
Sbjct  1    MAVVAAVALLIGIL----SFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAES  56

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++CSG++VTEI I GL L G+MGFQLD+L SVTTFDIS NNLGN +PYQLPPNV++L
Sbjct  57   WKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERL  116

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGNGF  GLPYSIS M  L+YLN+SHNQ+QG+VTV F SLT L+TLDFSFNS   N+P
Sbjct  117  NLAGNGFNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLTTLDFSFNSFTDNLP  176

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            Q+F SLT++ +MYLQNN FTGT+DVLA LPL NLNVENN FTGWIP QL+GIN +Q+ GN
Sbjct  177  QSFQSLTSINDMYLQNNQFTGTLDVLALLPLQNLNVENNRFTGWIPSQLKGIN-VQSNGN  235

Query  832  SWNS  843
              NS
Sbjct  236  LLNS  239



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   327 bits (838),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A+ADTDP DAS LR L+SSLNSP QLTKW ANGGDPCGESW G++CSGNRVTEI+ISGL 
Sbjct  21   AIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITCSGNRVTEIKISGLG  80

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  
Sbjct  81   LSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTS  140

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L YLNVSHNQ+QG+VTV F SL++L+TLDFSFN++ G++PQ+F +LT+M  MYLQNN FT
Sbjct  141  LRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQFT  200

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            GTID+LANLPLD+LNVENN FTGW+P  L+GI   ++ GNSWN
Sbjct  201  GTIDILANLPLDDLNVENNRFTGWVPDHLKGIT--KSNGNSWN  241



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   326 bits (836),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTDP DAS L  L++SLNSP QLT W A+GGDPCGESWKG++CSG RVTEI ISGL L+
Sbjct  22   ADTDPADASALNILYTSLNSPQQLTNWKASGGDPCGESWKGITCSGTRVTEINISGLGLS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G+MG+QLD+L SVTTFDIS NNLGN +PYQLPPNVQ+LNLAGNGFT GLPYSIS M  L+
Sbjct  82   GNMGYQLDKLTSVTTFDISNNNLGNQIPYQLPPNVQRLNLAGNGFTAGLPYSISLMTSLK  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLNVSHNQ+QG V + F SLT LSTLDFSFNS+ G++PQ+  SLT MKNMYLQNN FTG 
Sbjct  142  YLNVSHNQIQGPVAISFGSLTALSTLDFSFNSMTGDLPQSLQSLTGMKNMYLQNNKFTGN  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            IDVL NLPL+NLN+ENN F+G IP QL+ I+ LQ  GN
Sbjct  202  IDVLGNLPLENLNIENNQFSGRIPEQLKSIH-LQLSGN  238



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 188/235 (80%), Gaps = 4/235 (2%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            LLIG       +A A TDPTDAS L  L++SLNSP QLT W + GGDPCGESW+GV+CSG
Sbjct  8    LLIGVF----SAAGATTDPTDASTLNALYASLNSPQQLTNWKSTGGDPCGESWRGVTCSG  63

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVT+I ISGL LTG+MG+QL  L +VTTFDIS NNLGN +PYQLPPNVQ LNLAG  F 
Sbjct  64   SRVTQIVISGLGLTGNMGYQLLSLTAVTTFDISNNNLGNQIPYQLPPNVQTLNLAGCNFN  123

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
             GLPYSIS M  L YLNVSHNQLQG+V V F SLT LSTLD SFN+L+  +PQ+F+SLT+
Sbjct  124  NGLPYSISYMNSLGYLNVSHNQLQGQVNVQFGSLTALSTLDLSFNALSDGLPQSFASLTS  183

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            MKNMYLQNN FTGTIDVL+NLPL NLNVENN FTGWIP QL  INSLQT GN +N
Sbjct  184  MKNMYLQNNQFTGTIDVLSNLPLVNLNVENNRFTGWIPNQLTNINSLQTSGNQFN  238



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   325 bits (833),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 192/233 (82%), Gaps = 2/233 (1%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA-NGGDPCGE  288
            M L   VALL  F+L+      ADTDP+D S LR ++SSLNSP QLTKW++ +GGDPCGE
Sbjct  26   MSLVVKVALLF-FILHGCSFINADTDPSDGSALRVMYSSLNSPGQLTKWSSSDGGDPCGE  84

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            SWKG++CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNV++
Sbjct  85   SWKGITCSGNRVTEIQISGLGLSGSMGYQLMSLTSVTNFDISNNNLGNQIPYQLPPNVKR  144

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLAGNGFTG LPYS+SQ+  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +
Sbjct  145  LNLAGNGFTGVLPYSVSQITSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKL  204

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGI  807
            PQ+F SLT+MK +YLQNN FTG IDVLANLPLD+LN+ENN FTG IP + +GI
Sbjct  205  PQSFKSLTSMKKIYLQNNQFTGNIDVLANLPLDDLNIENNQFTGGIPEKFKGI  257



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   324 bits (830),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 189/223 (85%), Gaps = 2/223 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A+ADTDP DAS LR L+SSLNSP QLTKW ANGG+PCGESW G++CSGNRVTEI+ISGL 
Sbjct  21   AIADTDPNDASALRVLYSSLNSPGQLTKWNANGGNPCGESWTGITCSGNRVTEIKISGLG  80

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  
Sbjct  81   LSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTS  140

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L YLNVSHNQ+QG+VTV F SL++L TLDFSFN++ G++PQ+F +LT+M  MYLQNN FT
Sbjct  141  LRYLNVSHNQIQGQVTVAFDSLSSLDTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQFT  200

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            GTID+LANLPLD+LNVENN FTGW+P  L+GI   ++ GNSWN
Sbjct  201  GTIDILANLPLDDLNVENNRFTGWVPNHLKGIT--KSNGNSWN  241



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 189/228 (83%), Gaps = 4/228 (2%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGV  303
             VALL    +N+   A ADTDP+DAS LR ++SSLNSP QLT W +++G DPCGE WKG+
Sbjct  10   VVALL---FVNSHSFANADTDPSDASALRVMYSSLNSPAQLTNWNSSDGSDPCGEFWKGI  66

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA 
Sbjct  67   TCSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAA  126

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGFTGGLPYSISQM  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +PQ+F 
Sbjct  127  NGFTGGLPYSISQMTSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKLPQSFQ  186

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGI  807
            SLT+MK +YLQNN FTG IDVLANLPLDNL++ENN FTG IP +L+GI
Sbjct  187  SLTSMKKIYLQNNQFTGNIDVLANLPLDNLSLENNQFTGAIPEKLKGI  234



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 189/228 (83%), Gaps = 4/228 (2%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGV  303
             VALL    +N+   A ADTDP+DAS LR ++SSLNSP QLT W +++G DPCGE WKG+
Sbjct  10   VVALL---FVNSHSFANADTDPSDASALRVMYSSLNSPAQLTNWNSSDGSDPCGEFWKGI  66

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA 
Sbjct  67   TCSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAA  126

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGFTGGLPYSISQM  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +PQ+F 
Sbjct  127  NGFTGGLPYSISQMTSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKLPQSFQ  186

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGI  807
            SLT+MK +YLQNN FTG IDVLANLPLDNL++ENN FTG IP +L+GI
Sbjct  187  SLTSMKKIYLQNNQFTGNIDVLANLPLDNLSLENNQFTGAIPEKLKGI  234



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   319 bits (818),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 192/240 (80%), Gaps = 1/240 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W + +LI  L   P      TDP DAS LR +FSSLNSP QL KW++NGGDPCGESW+G+
Sbjct  5    WRMLVLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGI  64

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C G+RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLAG
Sbjct  65   TCKGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAG  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF GG+PYSIS M  L+YLN+SHNQLQG++  MF  L++L+TLDFS NSL G++P++FS
Sbjct  125  NGFNGGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFS  184

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            SL+++  M+LQNN FTG+I+VLA+LPL+ LNV NNHFTGWIP  L+ IN LQ  GNSW+S
Sbjct  185  SLSSITTMFLQNNQFTGSINVLASLPLETLNVANNHFTGWIPESLKNIN-LQKDGNSWSS  243



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   319 bits (817),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 181/213 (85%), Gaps = 1/213 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVSCSGNRVTEIQISGL  348
            A A TDP+DAS LR ++SSLNSP QLTKW +++G DPCGESWKG++C GNRV EI +SGL
Sbjct  22   ANAGTDPSDASALRVMYSSLNSPAQLTKWNSSDGSDPCGESWKGITCYGNRVNEIHLSGL  81

Query  349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  528
             L+GSMG+QL  L SV  FDIS NNLGN +PYQLPPNVQKLNLAGNGFTGGLPYSISQMA
Sbjct  82   GLSGSMGYQLTSLTSVINFDISNNNLGNQIPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  141

Query  529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF  708
             L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +PQ+F SLT+MK +YLQNN +
Sbjct  142  SLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKLPQSFQSLTSMKKIYLQNNQY  201

Query  709  TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGI  807
            TG IDVLANLPLDNLN+ENN FTG IP +L+GI
Sbjct  202  TGNIDVLANLPLDNLNLENNQFTGAIPEKLRGI  234



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 190/219 (87%), Gaps = 2/219 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP+DASVLR L+++LNSP QLTKW+ANGGDPCGESW G++CSGN VTEI++SGL L+G
Sbjct  26   DTDPSDASVLRVLYTTLNSPGQLTKWSANGGDPCGESWTGITCSGNNVTEIKLSGLGLSG  85

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G QLD LKSVT FDIS NN+G+ +PYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  86   SLGSQLDSLKSVTNFDISNNNMGSQIPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG V V F  L+ L+TLDFSFNS+AGN+PQ+F SLT+M  MYLQNN F+GTI
Sbjct  146  LNVSHNQIQGSVIVSFDLLSALNTLDFSFNSMAGNLPQSFRSLTSMNKMYLQNNQFSGTI  205

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            DVLANLPL NLNVENN FTGWIP QL+GI  +Q+ GNSW
Sbjct  206  DVLANLPLGNLNVENNQFTGWIPDQLKGI--VQSNGNSW  242



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 190/219 (87%), Gaps = 2/219 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP+DASVLR L+++LNSP QLTKW ANGGDPCGESW G++CSGN+VTEI++SGL L+G
Sbjct  26   DTDPSDASVLRVLYTTLNSPGQLTKWNANGGDPCGESWTGITCSGNKVTEIKMSGLGLSG  85

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G QLD LKSVT FDIS NN+G+ LPYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  86   SLGSQLDSLKSVTNFDISNNNMGSQLPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG V V F SL+ L+TLDFSFNS+ GN+PQ+F SLT+M  MYLQNN F+GTI
Sbjct  146  LNVSHNQIQGSVVVSFDSLSALNTLDFSFNSMTGNLPQSFQSLTSMNKMYLQNNQFSGTI  205

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            DVLANLPL NLNVENN FTGWIP QL+GI  +Q+ GNSW
Sbjct  206  DVLANLPLGNLNVENNQFTGWIPDQLKGI--VQSNGNSW  242



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +LI  L   P      TDP DAS LR +FSSLNSP QL KW++NGGDPCGESW+G++C G
Sbjct  3    VLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITCKG  62

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLAGNGF 
Sbjct  63   SRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAGNGFN  122

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            GG+PYSIS M  L+YLN+SHNQLQG++  MF  L++L+TLDFS NSL G++P++FSSL++
Sbjct  123  GGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSLSS  182

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +  M+LQNN FTG+I+VLA+LPL+ LNV NNHFTGWIP  L+ IN LQ  GNSW+S
Sbjct  183  ITTMFLQNNQFTGSINVLASLPLETLNVANNHFTGWIPESLKNIN-LQKDGNSWSS  237



>ref|XP_004241858.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
lycopersicum]
Length=692

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 188/233 (81%), Gaps = 2/233 (1%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGE  288
            M L   VALL  F+ N      ADTDP+D S LR ++SSLNSP QLTKW+++ GGDPCGE
Sbjct  1    MSLVVKVALLF-FIFNGCSFINADTDPSDGSALRVMYSSLNSPGQLTKWSSSEGGDPCGE  59

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            SWKG++CSGNRVTEIQISGL L+GSMG+QL  L SVT FD+S NNLGN +PYQLPP V++
Sbjct  60   SWKGITCSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDLSNNNLGNQIPYQLPPYVKR  119

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLAGNGFTG LPYS+SQ+  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +
Sbjct  120  LNLAGNGFTGVLPYSVSQITSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKL  179

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGI  807
            PQ+F SLT+MK +YLQNN FTG IDVLANLPL +LN+ENN FTG IP + + I
Sbjct  180  PQSFKSLTSMKKIYLQNNQFTGNIDVLANLPLGDLNIENNQFTGGIPEKFKKI  232



>ref|XP_012068778.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Jatropha curcas]
Length=714

 Score =   302 bits (773),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP DAS LRG+F+SL SP QLT+W ANGGDPC ESWKGV+CSG RVTEI++SGL L+G
Sbjct  25   NTDPNDASALRGMFTSLGSPGQLTQWKANGGDPCEESWKGVTCSGPRVTEIKLSGLALSG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
             MG+QL  L ++T  D+S NN+G  +PY LPPN+ +LNLA N FTG +PYSIS M  L Y
Sbjct  85   QMGYQLASLTALTNLDMSNNNIGGGIPYGLPPNLTQLNLASNQFTGDIPYSISMMTKLTY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN++HNQLQ ++  MF  L++LSTLD SFN L+GN+P++FS+L++M +MYLQNN FTGTI
Sbjct  145  LNIAHNQLQNQLNDMFGKLSSLSTLDISFNQLSGNLPESFSNLSSMTSMYLQNNQFTGTI  204

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLA+LPL NL + NNHFTGWIP QL+GIN LQT GN+WNS
Sbjct  205  DVLADLPLKNLYIGNNHFTGWIPEQLKGIN-LQTDGNNWNS  244



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 180/220 (82%), Gaps = 0/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            T+ TDAS LR ++SSLNS  QLT W++ GGDPCG SWKG++CSG  VTEI++SGL LTGS
Sbjct  35   TNETDASALRIMYSSLNSAAQLTGWSSAGGDPCGNSWKGITCSGQAVTEIKLSGLGLTGS  94

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L S+TT DIS N LGN +PYQLPPNVQ+LNLAGN F GG+PYSISQM  L+YL
Sbjct  95   MGYQLSSLTSLTTLDISNNFLGNQIPYQLPPNVQQLNLAGNSFNGGIPYSISQMTSLKYL  154

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQG++  MF  L+ L+TLD SFNS  GN+P++FSSL+++  MYL+NN FTG ID
Sbjct  155  NISHNQLQGQLNDMFGQLSALTTLDLSFNSFTGNLPESFSSLSSLNTMYLENNQFTGPID  214

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLANLPLDNLNV NNHF GWIP QL+ I +LQT GNSWNS
Sbjct  215  VLANLPLDNLNVANNHFNGWIPEQLKNIKNLQTQGNSWNS  254



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 179/221 (81%), Gaps = 1/221 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP DAS LRG+F+SL SP QLT+W ANGGDPC ESWKGV+CSG RVTEI++SGL L+G
Sbjct  25   NTDPNDASALRGMFTSLGSPGQLTQWKANGGDPCEESWKGVTCSGPRVTEIKLSGLALSG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
             MG+QL  L ++T  D+S NN+G  +PY LPPN+ +LNLA N FTG +PYSIS M  L Y
Sbjct  85   QMGYQLASLTALTNLDMSNNNIGGGIPYGLPPNLTQLNLASNQFTGDIPYSISMMTKLTY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN++HNQLQ ++  MF  L++LSTLD SFN L+GN+P++FS+L++M + YLQNN FTGTI
Sbjct  145  LNIAHNQLQNQLNDMFGKLSSLSTLDISFNQLSGNLPESFSNLSSMTSRYLQNNQFTGTI  204

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLA+LPL NL + NNHFTGWIP QL+GIN LQT GN+WNS
Sbjct  205  DVLADLPLKNLYIGNNHFTGWIPEQLKGIN-LQTDGNNWNS  244



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 180/235 (77%), Gaps = 1/235 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L+I  L+ +P S   DTD  DAS L G+F+S+N+P QLT WTA+GGDPCG+SWKGV+CSG
Sbjct  8    LIISILVLSPSSINGDTDQADASALNGMFTSMNNPAQLTGWTASGGDPCGQSWKGVTCSG  67

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVT+I++  L LTGS+G+QL  L S+T FD+S NN G SL Y LPPN+Q+LNLA   F 
Sbjct  68   SRVTQIKLPNLGLTGSLGYQLQSLTSLTDFDLSHNNFGGSLTYNLPPNLQRLNLANCSFN  127

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +PYSIS M PLE+L++SHNQ  G++TV +  L +LST+D S N+L G +PQT SSLT+
Sbjct  128  GQIPYSISLMKPLEHLDLSHNQFNGQLTVDYSQLPSLSTMDLSSNALTGELPQTMSSLTS  187

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +  +YLQNN FTGTIDVL  LPL NLNV NN F+GWIP QLQ IN LQ GGNSWN
Sbjct  188  LNTLYLQNNQFTGTIDVLGTLPLQNLNVANNQFSGWIPKQLQNIN-LQKGGNSWN  241



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   290 bits (742),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 182/220 (83%), Gaps = 1/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP DAS LR +FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS
Sbjct  26   TDPNDASALRVMFSSMNSPAQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLGLSGS  85

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QLD LK+VT  D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSISQM  L YL
Sbjct  86   LGYQLDSLKAVTNLDLSNNNLAGALPYQLPPNLQRLNLANNRLSGGIPYSISQMPSLTYL  145

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQ ++  MF  LT+LSTLD SFN L G++P++FSSL+++K+MYLQ+N FTG ID
Sbjct  146  NLGHNQLQNQLGDMFGQLTSLSTLDVSFNLLTGDLPESFSSLSSVKSMYLQSNQFTGAID  205

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLANLPL+NLNV NN FTGWIP QL  IN LQ  GN+WNS
Sbjct  206  VLANLPLENLNVANNRFTGWIPSQLNSIN-LQKDGNNWNS  244



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   288 bits (737),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 184/239 (77%), Gaps = 2/239 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            VALL   ++   P  +   TD +D S L  ++SS+NSP QL++W  +GGDPCGE WKGV+
Sbjct  9    VALLTLCIVGLEPRFINGATDSSDTSALNTMYSSMNSPSQLSEWKPSGGDPCGEHWKGVT  68

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVTE+++  L L+GS+G+ LD+L +VT FD+S NNLG  LPYQLPP VQ+LNLA N
Sbjct  69   CSGSRVTEVKLPNLGLSGSLGYMLDKLSAVTEFDLSNNNLGGDLPYQLPPAVQRLNLANN  128

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MA L+YLN++HNQ +G++ V F  LT+L+ LD S NS +G++P +F+S
Sbjct  129  QFTGSAQYSISLMASLKYLNLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSGSLPSSFTS  188

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LT++K+MYLQNN FTGTIDVLA+LPL+NLN+ NN FTGWIP  L+GIN LQ  GNS+NS
Sbjct  189  LTSIKSMYLQNNQFTGTIDVLASLPLENLNIANNQFTGWIPDSLKGIN-LQKDGNSFNS  246



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 181/228 (79%), Gaps = 1/228 (0%)
 Frame = +1

Query  160  APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI  339
            +P S  A TDPTD S L+ L+SSLNSP QLT+W  NG DPCG+SWKGV CSG+RVTEI +
Sbjct  20   SPSSINAATDPTDVSALKVLYSSLNSPSQLTQWIQNGDDPCGQSWKGVKCSGSRVTEIDL  79

Query  340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  519
            SGLQL+G++G+QL  L ++T  D+S NNL  ++PYQLPPN+ +LNL GN F   +PYSIS
Sbjct  80   SGLQLSGTLGYQLQTLTALTNLDMSNNNLAGTIPYQLPPNMTRLNLGGNNFNQDIPYSIS  139

Query  520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN  699
            Q+  L YLN+SHNQ+Q ++  MF  L++LS LD SFNSL+GN+P++FSSL++M  M+LQN
Sbjct  140  QITSLTYLNISHNQIQNQLGDMFGKLSSLSVLDLSFNSLSGNLPESFSSLSSMTTMFLQN  199

Query  700  NVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            N  TGTIDVLANLPLDNLN+ENNHFTGWIP QL+ IN L+  GN WNS
Sbjct  200  NQLTGTIDVLANLPLDNLNIENNHFTGWIPEQLKNIN-LEKDGNMWNS  246



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   288 bits (736),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 194/255 (76%), Gaps = 3/255 (1%)
 Frame = +1

Query  82   ERASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            E    + +++M + + + L I  L +   S  ADTDP+DA+ L+ ++S LN P QLT+W+
Sbjct  2    ESVRRRKKKMMSV-FLIMLEICILGSTFTSINADTDPSDAAALQDMYSFLNQPSQLTQWS  60

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS-MGFQLDQLKSVTTFDISTNNLGNSL  438
            ++GGDPCG+SWKG++CSG+RVTEI++ GL L+GS +G++L  L SVT  D+S NNLG  L
Sbjct  61   SSGGDPCGQSWKGITCSGSRVTEIKLPGLGLSGSSIGYKLQSLTSVTNLDLSNNNLGGQL  120

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PY +PPNVQ+LNLA N FTG +P+SI+Q++ L+YLN+ HNQLQG +  MF  L++L TLD
Sbjct  121  PYGVPPNVQRLNLANNQFTGQIPWSIAQLSSLKYLNLGHNQLQGALNDMFGQLSSLDTLD  180

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL  798
             S N L+GN+PQT SSL+++  MYLQNN FTG I+VLANLPL+NLNV NN FTGW+P QL
Sbjct  181  LSSNQLSGNLPQTISSLSSITTMYLQNNQFTGDINVLANLPLENLNVANNQFTGWVPAQL  240

Query  799  QGINSLQTGGNSWNS  843
            + IN LQ  GNSW+S
Sbjct  241  KNIN-LQKDGNSWSS  254



>ref|XP_011011656.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=700

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 178/222 (80%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  28   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  87

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  88   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  147

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HN++ G+++ MF  LT L T+D S NS++GN+PQ+FS+L ++  ++LQ+N FTGT
Sbjct  148  YLNLNHNKINGQLSDMFQKLTKLKTMDLSHNSISGNLPQSFSALKSLSTLHLQDNKFTGT  207

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +DVLA LPL +LNVE+N FTGW+P  L+GI++L+TGGNSW+S
Sbjct  208  LDVLAALPLKDLNVEDNEFTGWVPDSLEGIDNLETGGNSWSS  249



>ref|XP_002320001.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=681

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 177/222 (80%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  22   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HN++ G+++ MF  LT L T+D S NS++GN+PQ+FS+L ++   +LQ+N FTGT
Sbjct  142  YLNLNHNKINGQLSDMFQKLTKLKTMDLSHNSISGNLPQSFSALKSLSTFHLQDNKFTGT  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +DVLA LPL +LNVE+N FTGW+P  L+GI++L+TGGNSW+S
Sbjct  202  LDVLAALPLKDLNVEDNEFTGWVPDSLEGIDNLETGGNSWSS  243



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 187/244 (77%), Gaps = 9/244 (4%)
 Frame = +1

Query  136  LLIGFLLN--------APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            L +GFLL         +P S  A TDPTD S L+ L+ SLNSPPQLT+W+ NG DPCG+S
Sbjct  30   LEVGFLLVFCICILGWSPSSINAATDPTDVSALKVLYGSLNSPPQLTQWSQNGDDPCGQS  89

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKGV CSG+RVTEI +SGLQL+G++G+QL  L ++T  D+S NNL   +PY LPPN+ +L
Sbjct  90   WKGVKCSGSRVTEIDLSGLQLSGTLGYQLQSLTALTNLDVSNNNLAGGIPYSLPPNMTRL  149

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NL  N F   +PYSIS +  L+YLN+SHNQLQ +++ +F  L++LS LD SFNSL+GN+P
Sbjct  150  NLGHNNFNQDIPYSISMITTLKYLNISHNQLQNQLSDIFGKLSSLSVLDLSFNSLSGNLP  209

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            ++FSSL++MK M+LQNN  TGTIDVLANLPLDNLN+ENN FTGWIP QL+ IN L+  GN
Sbjct  210  ESFSSLSSMKTMFLQNNQLTGTIDVLANLPLDNLNIENNRFTGWIPEQLKNIN-LEKDGN  268

Query  832  SWNS  843
            +WNS
Sbjct  269  TWNS  272



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   286 bits (731),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 190/253 (75%), Gaps = 14/253 (6%)
 Frame = +1

Query  100  MRELMGLPWAVAL------LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            MRE     W V +      ++GF L     A   TD +D S L  LFSS++SP QLT+WT
Sbjct  1    MRE----NWVVVVALFSVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWT  53

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP  441
            A+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T  D+S+NNLG  LP
Sbjct  54   ASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQLPPN+Q+LNLA N FTG   YSISQM+ L+YLN+ HNQ +G+V V F  L +L+TLDF
Sbjct  114  YQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKYLNLGHNQFKGQVAVDFTKLNSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ  801
            SFNS    +P TF+SLT++K++YLQNN F+GTIDVLA LPL+ LN+ NN FTGWIP  L+
Sbjct  174  SFNSFTMPLPGTFTSLTSLKSLYLQNNQFSGTIDVLAGLPLETLNIANNDFTGWIPSSLK  233

Query  802  GINSLQTGGNSWN  840
            GIN L+  GNS+N
Sbjct  234  GINLLK-DGNSFN  245



>gb|AAG51973.1|AC024260_11 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-7611 [Arabidopsis thaliana]
Length=516

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 187/253 (74%), Gaps = 14/253 (6%)
 Frame = +1

Query  100  MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  441
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDF
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ  801
            SFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+
Sbjct  174  SFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLK  233

Query  802  GINSLQTGGNSWN  840
            GI +L   GNS+N
Sbjct  234  GI-TLIKDGNSFN  245



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   285 bits (729),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 181/229 (79%), Gaps = 3/229 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGT  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++TLDFSFNS   ++P TF+SLT++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTESLPGTFTSLTSL  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG  825
            K++YLQNN F+GT+DVLA LPLD LN+ NN FTGWIP  L+GI+ ++ G
Sbjct  193  KSLYLQNNQFSGTVDVLAGLPLDTLNIANNDFTGWIPSSLKGIDLIKDG  241



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 194/255 (76%), Gaps = 5/255 (2%)
 Frame = +1

Query  85   RASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            R  ++ + ++G+ WAV   I ++ N P  A   TD  D S L  L+ SL SP QLT W +
Sbjct  3    REGVREKRMVGI-WAVLACI-WVWN-PSVANGATDSADVSALNVLYRSLQSPGQLTGWNS  59

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSL  438
            +GGDPC +SW GV+CSG+ VT I++SGL+L+GS+G+Q+  + S+T  D+S NNLG    +
Sbjct  60   SGGDPCEQSWLGVTCSGSAVTAIKLSGLELSGSLGYQMSSMTSLTELDMSNNNLGGGQQI  119

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PY LPPN+++LNLAGN F G +PYSIS++ PL+YLN+ HNQLQG ++ MF  LTNL+T+D
Sbjct  120  PYNLPPNLERLNLAGNQFAGNVPYSISRIVPLKYLNLGHNQLQGNLSDMFGQLTNLTTVD  179

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL  798
             SFNSL G++P++F+SL+++  +YLQNN  TG+I+VLANLPLD+LNV NN FTGWIP +L
Sbjct  180  LSFNSLTGDLPESFNSLSSLTTLYLQNNQLTGSINVLANLPLDDLNVANNRFTGWIPDKL  239

Query  799  QGINSLQTGGNSWNS  843
            + IN+LQTGGNSW+S
Sbjct  240  KAINNLQTGGNSWSS  254



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 184/244 (75%), Gaps = 9/244 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+GI +L   G
Sbjct  183  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGI-TLIKDG  241

Query  829  NSWN  840
            NS+N
Sbjct  242  NSFN  245



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 184/244 (75%), Gaps = 9/244 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+GI +L   G
Sbjct  183  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGI-TLIKDG  241

Query  829  NSWN  840
            NS+N
Sbjct  242  NSFN  245



>ref|XP_011012291.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=694

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 176/222 (79%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++ GL LT
Sbjct  22   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIHCSGSSVTQIKLPGLGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HN++ G+++ MF  LT L T+D S NS++GN+PQ+FS+L ++  ++LQ+N FTGT
Sbjct  142  YLNLNHNKINGQLSDMFQKLTKLKTMDLSHNSISGNLPQSFSALKSLSTLHLQDNKFTGT  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +DVLA LPL  LNVE+N FTGW+P  L+GI++L+TGGNSW+S
Sbjct  202  LDVLAALPLKELNVEDNEFTGWVPDSLEGIDNLETGGNSWSS  243



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 184/244 (75%), Gaps = 9/244 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  7    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  63

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  64   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  123

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  124  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSL  183

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+GI +L   G
Sbjct  184  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGI-TLIKDG  242

Query  829  NSWN  840
            NS+N
Sbjct  243  NSFN  246



>ref|XP_010928729.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Elaeis 
guineensis]
Length=684

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 182/242 (75%), Gaps = 4/242 (2%)
 Frame = +1

Query  118  LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK  297
            LP  +A+ +G +     SA+A+TD  D S L  LF SLNSPPQLT W+++GGDPCGE WK
Sbjct  5    LPVLLAVALGLVF----SALAETDQDDVSALNVLFLSLNSPPQLTGWSSSGGDPCGEDWK  60

Query  298  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL  477
            GV CS   VTEI ++ L LTGS+G+QL  L S+T FD+S NNL  ++PYQLPP V+ LNL
Sbjct  61   GVKCSDLSVTEISLADLGLTGSLGYQLSSLTSITYFDMSKNNLRGNIPYQLPPKVEHLNL  120

Query  478  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT  657
            A N FTGG+PYSISQM  L+YLN+  NQL G++  +F  LT LS +  SFN L+GN+P +
Sbjct  121  AENAFTGGIPYSISQMTDLKYLNLGKNQLNGQLNDIFGKLTRLSEMYLSFNQLSGNLPHS  180

Query  658  FSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
              SL ++K ++LQNN F+G+I+VLANLPL++LNVENN F+GWIP +L+ I++LQ GGNSW
Sbjct  181  SQSLKSLKVLHLQNNQFSGSINVLANLPLEDLNVENNQFSGWIPKKLKNIDTLQIGGNSW  240

Query  838  NS  843
            +S
Sbjct  241  SS  242



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   283 bits (725),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 181/229 (79%), Gaps = 3/229 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGT  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++TLDFSFNS   ++P TF+SLT++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTDSLPGTFTSLTSL  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG  825
            K++YLQNN F+GT+DVLA LPLD LN+ NN FTGWIP  L+GI+ ++ G
Sbjct  193  KSLYLQNNQFSGTVDVLAGLPLDILNIANNDFTGWIPSSLKGIDLIKDG  241



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   283 bits (725),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VLANLPL NLNVENNHFTGW+P +L+ IN +Q GGNSW+
Sbjct  210  VLANLPLQNLNVENNHFTGWVPERLKNIN-IQEGGNSWS  247



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   283 bits (725),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VLANLPL NLNVENNHFTGW+P +L+ IN +Q GGNSW+
Sbjct  210  VLANLPLQNLNVENNHFTGWVPERLKNIN-IQEGGNSWS  247



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   283 bits (724),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 181/229 (79%), Gaps = 3/229 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIYGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGT  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++TLDFSFNS   ++P TF+SLT++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTDSLPGTFTSLTSL  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG  825
            K++YLQNN F+GT+DVLA LPLD LN+ NN FTGWIP  L+GI+ ++ G
Sbjct  193  KSLYLQNNQFSGTVDVLAGLPLDILNIANNDFTGWIPSSLKGIDLIKDG  241



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 176/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P SA A TDP DA+ +R LF ++NSPPQL  W  NG DPCG+SWKG++CSGNRVTEI++S
Sbjct  22   PNSATAATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLS  80

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTGS+ + L  L S+   D+S+N LG S+PYQLPP +Q+LNLA N  TG +PYSIS 
Sbjct  81   NLGLTGSVPYGLQVLTSLNDLDMSSNRLGGSIPYQLPPYLQRLNLAYNNITGTVPYSISN  140

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN+ HNQLQ  + V F +L+ LSTLD SFNSL G++PQT SSL+ +  MYLQNN
Sbjct  141  LTALTDLNLGHNQLQQGLGVDFHNLSTLSTLDLSFNSLTGDLPQTMSSLSRITTMYLQNN  200

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTGTIDVLANLPLDNLNVENN+FTGWIP QL+ IN LQTGGN+W+S
Sbjct  201  QFTGTIDVLANLPLDNLNVENNNFTGWIPEQLKNIN-LQTGGNAWSS  246



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 178/220 (81%), Gaps = 1/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP DAS LR +FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS
Sbjct  26   TDPNDASALRVMFSSMNSPGQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLALSGS  85

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QLD L +    D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSIS M  L YL
Sbjct  86   LGYQLDSLTAAMNLDLSNNNLAGALPYQLPPNLQRLNLANNKLSGGIPYSISLMRSLTYL  145

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQ ++  MF  LT+LSTLD SFN L G++P++FSSL++MK+MYLQ+N FTG ID
Sbjct  146  NLGHNQLQSQLGDMFGQLTSLSTLDVSFNLLTGDLPESFSSLSSMKSMYLQSNQFTGAID  205

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLANLPL+NLNV NN FTGWIP QL  +N LQ  GN+WNS
Sbjct  206  VLANLPLENLNVANNRFTGWIPSQLNSVN-LQKDGNNWNS  244



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 179/238 (75%), Gaps = 2/238 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V +    L   P  A A TDP DA+ +R LF ++NSPPQL  W  NG DPCG+SWKG++C
Sbjct  9    VCITTCILCWMPNGATAATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITC  67

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SGNRVTEI++S L LTGS+ + L  L S+T  D+S+N+LG S+PYQLPP +Q LNLA N 
Sbjct  68   SGNRVTEIKLSNLGLTGSLPYGLQVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNN  127

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             TG +PYSIS +  L  LN SHNQLQ  + V F++L+ LSTLD SFN L G++PQT SSL
Sbjct  128  ITGTVPYSISNLTALTDLNFSHNQLQQGLGVDFLNLSTLSTLDLSFNFLTGDLPQTMSSL  187

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            + +  MYLQNN FTGTIDVLANLPLDNLNVENN+FTGWIP QL+ IN LQTGGN+W+S
Sbjct  188  SRITTMYLQNNQFTGTIDVLANLPLDNLNVENNNFTGWIPEQLKNIN-LQTGGNAWSS  244



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 178/228 (78%), Gaps = 1/228 (0%)
 Frame = +1

Query  160  APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI  339
            +P S  ADTDP+D S L  ++SSLNSP QLT+W+A+ GDPCG+SWKGV C+ +RVTEI +
Sbjct  20   SPISINADTDPSDVSALTVMYSSLNSPSQLTQWSASSGDPCGQSWKGVKCTRSRVTEIDL  79

Query  340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  519
            SGL L+GS G+ L  L ++T  D+S NNL   +PY LPPN+ +LNL GN FT G+PYS+S
Sbjct  80   SGLGLSGSFGYNLQSLTALTNLDMSNNNLAGGIPYNLPPNLTRLNLGGNQFTQGIPYSVS  139

Query  520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN  699
             M  L+YLN+SHNQLQ  +  +F  L++L+TLD SFN++ G++P++FSSL+++K + LQN
Sbjct  140  MMTSLKYLNISHNQLQNTLDDVFGKLSSLTTLDLSFNTMPGSLPESFSSLSSLKTLDLQN  199

Query  700  NVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            N  TGTIDVLANLPL+NLN+ENNHFTGW+P  L+ IN L+  GN+WNS
Sbjct  200  NQLTGTIDVLANLPLENLNIENNHFTGWVPEPLKNIN-LKKDGNTWNS  246



>ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis]
 gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis]
Length=694

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 183/237 (77%), Gaps = 4/237 (2%)
 Frame = +1

Query  139  LIGFLLNA----PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            L+GFL+ +       A + T+  D S L  +F+ LNSP QL+ W ++GGDPC +SW+G++
Sbjct  5    LVGFLIVSLGFLSTLAHSKTNSQDVSALNVMFTGLNSPSQLSGWKSSGGDPCDDSWEGIT  64

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+ VT+I++SGL L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ N
Sbjct  65   CSGSSVTQIKLSGLGLSGSMGYQLSNLKSVTYFDMSKNNLDNDIPYQLPPNTAHLDLSNN  124

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
            GF+G +PYSISQM  LEYLN+ HNQL G+++ MF  L  L +LD S+NSL+GN+PQ+F+S
Sbjct  125  GFSGNVPYSISQMTDLEYLNLGHNQLNGQLSDMFQKLPKLKSLDLSYNSLSGNLPQSFAS  184

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            L+++  + LQ+N FTG+I+VLA LPLD L+VE+N F+GW+P +L+GI +++TGGNSW
Sbjct  185  LSSLNTLRLQDNKFTGSINVLAGLPLDTLDVEDNEFSGWVPDELEGIENIETGGNSW  241



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 184/234 (79%), Gaps = 4/234 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L     A   TD +D S L  LFSS++SP QLT+WTA+GGDPCG++W+GV+CSG+
Sbjct  17   IVGFELRLIHGA---TDASDTSALNMLFSSMHSPGQLTQWTASGGDPCGQNWRGVTCSGS  73

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT++++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG
Sbjct  74   RVTQLKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTG  133

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSIS MA L+YLN+ HNQ +G+V V F  LT+L+TLDFSFNS   ++P TF+SLT++
Sbjct  134  AAQYSISNMASLKYLNLGHNQFKGQVAVDFSKLTSLTTLDFSFNSFTLSLPGTFTSLTSL  193

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            K++YLQNN F+GT++VLA LPL+ LN+ NN FTGWIP  L+GIN L   GNS+N
Sbjct  194  KSLYLQNNQFSGTLNVLAGLPLETLNIANNDFTGWIPSTLKGIN-LIKDGNSFN  246



>gb|KCW53999.1| hypothetical protein EUGRSUZ_J03194, partial [Eucalyptus grandis]
Length=708

 Score =   281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 180/238 (76%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            +ALL+  +    PS  + TD  D S L  ++SSLNSP  LT W + GGDPCGESWKG+ C
Sbjct  13   LALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESWKGIKC  72

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI++S L LTGS+G+QL  LKSVT FD+S NNL   +PYQLPPN   ++L+ N 
Sbjct  73   SGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHIDLSSNA  132

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTG +PYSISQM  L+YLN+ HNQ++G+++ MF  L  L+TLD S+NSL+GN+PQ+F SL
Sbjct  133  FTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLATLDLSYNSLSGNLPQSFGSL  192

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  ++LQNN FTG I+VL +LPL++LNV NN FTGW+P  L+ I++++T GNSW+S
Sbjct  193  SSLTKLHLQNNQFTGPINVLTDLPLNDLNVANNQFTGWVPNALKDIDNIETEGNSWSS  250



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/238 (57%), Positives = 187/238 (79%), Gaps = 3/238 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
             +AL +  ++   P+ +  DTD +D S L  +F+S+NSP QL++WTA+GGDPCG++WKG+
Sbjct  7    VLALFLLCIVGFEPTFINGDTDSSDTSALNTMFTSMNSPGQLSQWTASGGDPCGQNWKGI  66

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  +PYQLPPN+++LNLA 
Sbjct  67   TCSGSRVTQIKLSGLGLSGSIGFMLDKLTSVTEFDLSNNNLGGDIPYQLPPNLERLNLAN  126

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG   YSIS M P++Y+N++HNQL+ ++ + F  LT+LS LD S N++ G++P T S
Sbjct  127  NQFTGSAQYSISMMTPIKYINLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNTIS  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            SLT++K++YLQNN FTGTID+LA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN +
Sbjct  186  SLTSVKSIYLQNNQFTGTIDILATLPLENLNIANNRFTGWIPDTLKGIN-LQKDGNQF  242



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P T SS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFIGSLPNTCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LT+ K++YLQNN F+GTID+LA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN  NS
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENLNIANNRFTGWIPDSLKGIN-LQKDGNLLNS  244



>ref|XP_010034888.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Eucalyptus 
grandis]
Length=716

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 180/238 (76%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            +ALL+  +    PS  + TD  D S L  ++SSLNSP  LT W + GGDPCGESWKG+ C
Sbjct  26   LALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESWKGIKC  85

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI++S L LTGS+G+QL  LKSVT FD+S NNL   +PYQLPPN   ++L+ N 
Sbjct  86   SGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHIDLSSNA  145

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTG +PYSISQM  L+YLN+ HNQ++G+++ MF  L  L+TLD S+NSL+GN+PQ+F SL
Sbjct  146  FTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLATLDLSYNSLSGNLPQSFGSL  205

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  ++LQNN FTG I+VL +LPL++LNV NN FTGW+P  L+ I++++T GNSW+S
Sbjct  206  SSLTKLHLQNNQFTGPINVLTDLPLNDLNVANNQFTGWVPNALKDIDNIETEGNSWSS  263



>ref|XP_010655240.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X2 [Vitis 
vinifera]
Length=611

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 180/238 (76%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V + + F     P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ C
Sbjct  7    VLMGVAFFGILTPIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKC  66

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ +TEI++SGL LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NG
Sbjct  67   SGSSITEIKLSGLGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNG  126

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTGG+PYSISQM  L+YLN+ HN+L G+++ MF  L  L+ +D SFN+L+ N+PQ+F SL
Sbjct  127  FTGGVPYSISQMTDLKYLNLGHNKLNGQLSDMFGQLPKLTLMDLSFNTLSDNLPQSFGSL  186

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  + LQNN FTG+I+VLA+LPL++LN+ENN FTGWIP  L  I++++ GGNSW+S
Sbjct  187  SSLTTLRLQNNQFTGSINVLADLPLNDLNIENNQFTGWIPNALNNIDNIEAGGNSWSS  244



>ref|XP_011659817.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Cucumis sativus]
Length=722

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  +++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   LGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDVSFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VLANLPL NLNVENNHFTGW+P +L+ IN +Q GGNSW+
Sbjct  210  VLANLPLQNLNVENNHFTGWVPERLKNIN-IQEGGNSWS  247



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 187/253 (74%), Gaps = 14/253 (6%)
 Frame = +1

Query  100  MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  441
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDF
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ  801
            SFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+
Sbjct  174  SFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLK  233

Query  802  GINSLQTGGNSWN  840
            GI +L   GNS+N
Sbjct  234  GI-TLIKDGNSFN  245



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 187/253 (74%), Gaps = 14/253 (6%)
 Frame = +1

Query  100  MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  441
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDF
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ  801
            SFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+
Sbjct  174  SFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLK  233

Query  802  GINSLQTGGNSWN  840
            GI +L   GNS+N
Sbjct  234  GI-TLIKDGNSFN  245



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis sativus]
 ref|XP_011659816.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis sativus]
Length=726

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  +++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   LGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDVSFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VLANLPL NLNVENNHFTGW+P +L+ IN +Q GGNSW+
Sbjct  210  VLANLPLQNLNVENNHFTGWVPERLKNIN-IQEGGNSWS  247



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   280 bits (716),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 185/239 (77%), Gaps = 3/239 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P T SS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFIGSLPNTCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LT+ K++YLQNN F+GTID+LA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN  NS
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENLNIANNRFTGWIPDSLKGIN-LQKDGNLLNS  244



>gb|KDP25030.1| hypothetical protein JCGZ_22565 [Jatropha curcas]
Length=705

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 178/224 (79%), Gaps = 0/224 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A + T+  D S L  +F+SLNSP QL+ W ++GGDPCG+SW+G++CSG+ VT I++SGL 
Sbjct  26   AHSKTNSQDVSALNVMFTSLNSPSQLSNWKSSGGDPCGDSWEGITCSGSSVTTIRLSGLG  85

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN+  L+L+ N F+G +PYSISQM  
Sbjct  86   LSGSMGYQLSNLKSVTYFDMSKNNLKNDIPYQLPPNMAHLDLSNNDFSGSVPYSISQMND  145

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            LEYLN+ HN+L G+ + MF  L  L TLD S+NSL+GN+PQ+F+SL+ +  ++LQNN F+
Sbjct  146  LEYLNLGHNKLNGQASDMFQKLKKLKTLDLSYNSLSGNLPQSFASLSRLSTLHLQNNRFS  205

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            G+I+VLA LPLD+LNVENN FTGW+P QL+GI SL TGGNSW+S
Sbjct  206  GSINVLAGLPLDDLNVENNKFTGWVPEQLKGIRSLHTGGNSWSS  249



>ref|XP_012087291.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Jatropha curcas]
Length=697

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 178/224 (79%), Gaps = 0/224 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A + T+  D S L  +F+SLNSP QL+ W ++GGDPCG+SW+G++CSG+ VT I++SGL 
Sbjct  26   AHSKTNSQDVSALNVMFTSLNSPSQLSNWKSSGGDPCGDSWEGITCSGSSVTTIRLSGLG  85

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN+  L+L+ N F+G +PYSISQM  
Sbjct  86   LSGSMGYQLSNLKSVTYFDMSKNNLKNDIPYQLPPNMAHLDLSNNDFSGSVPYSISQMND  145

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            LEYLN+ HN+L G+ + MF  L  L TLD S+NSL+GN+PQ+F+SL+ +  ++LQNN F+
Sbjct  146  LEYLNLGHNKLNGQASDMFQKLKKLKTLDLSYNSLSGNLPQSFASLSRLSTLHLQNNRFS  205

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            G+I+VLA LPLD+LNVENN FTGW+P QL+GI SL TGGNSW+S
Sbjct  206  GSINVLAGLPLDDLNVENNKFTGWVPEQLKGIRSLHTGGNSWSS  249



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 180/239 (75%), Gaps = 8/239 (3%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            W V  L     +GF L     A   TD +D S L  LF+S++SP QLT+WTA+ GDPCG+
Sbjct  5    WVVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFTSMHSPAQLTQWTASAGDPCGQ  61

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG RVT+I+I  L+L+G++G+ LD+L ++T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  62   NWRGVTCSGTRVTQIKIPSLELSGTLGYMLDRLTNLTELDLSSNNLGGDLPYQLPPNLQR  121

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSISQMAPL+YLN+ HNQ +G++ V F  LT+L+  DFSFNS   ++
Sbjct  122  LNLAYNQFTGAAQYSISQMAPLKYLNLGHNQFKGQIAVDFSKLTSLTFADFSFNSFTNSL  181

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG  825
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+GI+ ++ G
Sbjct  182  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGIHLIKDG  240



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 181/244 (74%), Gaps = 9/244 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            W V  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WVVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIPIDFTKLNSLTTLDFSFNSFTNSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P TF+SL ++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP   +GI +L   G
Sbjct  183  PGTFTSLKSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSFKGI-TLIKDG  241

Query  829  NSWN  840
            NS+N
Sbjct  242  NSFN  245



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 189/253 (75%), Gaps = 16/253 (6%)
 Frame = +1

Query  100  MRELMGLPWAVAL------LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            MRE     W V +      ++GF L     A   TD +D   L  LFSS++SP QLT+WT
Sbjct  1    MRE----NWVVVVALFSVCIVGFELRFIHGA---TDASD--TLNTLFSSMHSPAQLTQWT  51

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP  441
            A+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T  D+S+NNLG  LP
Sbjct  52   ASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLTELDLSSNNLGGDLP  111

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQLPPN+Q+LNLA N FTG   YSISQM+ L+YLN+ HNQ +G+V V F  L +L+TLDF
Sbjct  112  YQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKYLNLGHNQFKGQVAVDFTKLNSLTTLDF  171

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ  801
            SFNS    +P TF+SLT++K++YLQNN F+GTIDVLA LPL+ LN+ NN FTGWIP  L+
Sbjct  172  SFNSFTMPLPGTFTSLTSLKSLYLQNNQFSGTIDVLAGLPLETLNIANNDFTGWIPSSLK  231

Query  802  GINSLQTGGNSWN  840
            GIN L+  GNS+N
Sbjct  232  GINLLK-DGNSFN  243



>ref|XP_008781708.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Phoenix 
dactylifera]
Length=686

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 169/224 (75%), Gaps = 0/224 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A+TD  D S +  LF SLN+PPQLT W++ GGDPCG+ WKGV CSG+ VTEI +SGL 
Sbjct  19   AFAETDQGDVSAVNVLFKSLNAPPQLTGWSSTGGDPCGDDWKGVKCSGSSVTEISLSGLG  78

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            LTGS+G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGSLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN+  NQL G++  +F  L  LS +  SFN L+GN+P +  SL ++K ++LQNN F+
Sbjct  139  LKYLNLHRNQLNGQLNDIFGKLDRLSEMYLSFNQLSGNLPPSLGSLKSLKTLHLQNNQFS  198

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            G+I  LANLPL++LNVENN F GWIP +L+ I++LQ GGNSW+S
Sbjct  199  GSIKGLANLPLEDLNVENNQFNGWIPNKLKNIDTLQIGGNSWSS  242



>ref|XP_010655239.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Vitis 
vinifera]
Length=687

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 180/238 (76%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V + + F     P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ C
Sbjct  7    VLMGVAFFGILTPIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKC  66

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ +TEI++SGL LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NG
Sbjct  67   SGSSITEIKLSGLGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNG  126

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTGG+PYSISQM  L+YLN+ HN+L G+++ MF  L  L+ +D SFN+L+ N+PQ+F SL
Sbjct  127  FTGGVPYSISQMTDLKYLNLGHNKLNGQLSDMFGQLPKLTLMDLSFNTLSDNLPQSFGSL  186

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  + LQNN FTG+I+VLA+LPL++LN+ENN FTGWIP  L  I++++ GGNSW+S
Sbjct  187  SSLTTLRLQNNQFTGSINVLADLPLNDLNIENNQFTGWIPNALNNIDNIEAGGNSWSS  244



>emb|CBI18374.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 180/238 (76%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V + + F     P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ C
Sbjct  7    VLMGVAFFGILTPIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKC  66

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ +TEI++SGL LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NG
Sbjct  67   SGSSITEIKLSGLGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNG  126

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTGG+PYSISQM  L+YLN+ HN+L G+++ MF  L  L+ +D SFN+L+ N+PQ+F SL
Sbjct  127  FTGGVPYSISQMTDLKYLNLGHNKLNGQLSDMFGQLPKLTLMDLSFNTLSDNLPQSFGSL  186

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  + LQNN FTG+I+VLA+LPL++LN+ENN FTGWIP  L  I++++ GGNSW+S
Sbjct  187  SSLTTLRLQNNQFTGSINVLADLPLNDLNIENNQFTGWIPNALNNIDNIEAGGNSWSS  244



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   278 bits (711),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  LFSS++SP QLT+WTA+GGDPCG++W+GV+CS +RVT++++SGL+L+G+
Sbjct  29   TDASDTSALNMLFSSMHSPGQLTQWTASGGDPCGQNWRGVTCSRSRVTQLKLSGLELSGT  88

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M  L+YL
Sbjct  89   LGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMVSLKYL  148

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQ +G+V V F  LT+L+TLDFSFNS   ++P TF+SLT++K++YLQNN F+GT++
Sbjct  149  NLGHNQFKGQVAVDFSKLTSLTTLDFSFNSFTLSLPGTFTSLTSLKSLYLQNNQFSGTLN  208

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VLA LPL+ LN+ NN FTGWIP  L+GIN L   GNS+N
Sbjct  209  VLAGLPLETLNIANNDFTGWIPSTLKGIN-LIKDGNSFN  246



>ref|XP_010245765.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Nelumbo 
nucifera]
Length=760

 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = +1

Query  199  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  378
             S L  +++SLNSP +LT W ++GGDPCG+SWKG+ CSG+ V EI++SGL LTGS+G++L
Sbjct  81   VSALHVMYTSLNSPSKLTNWKSSGGDPCGDSWKGIKCSGSHVKEIKLSGLGLTGSLGYKL  140

Query  379  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
              L S+T FD+S NNL +S+PYQLPPNV  +NLAGN FTG +PYSISQM  L+YLN+ HN
Sbjct  141  SSLTSLTYFDLSNNNLKDSIPYQLPPNVLHINLAGNSFTGTVPYSISQMLNLKYLNLGHN  200

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            QL G+++ MF  LT L  LD SFNSL+GN+PQ+F +L+++  +YLQNN FTG+I+VL +L
Sbjct  201  QLSGQLSDMFGHLTRLQFLDLSFNSLSGNLPQSFETLSSLSTLYLQNNKFTGSINVLTHL  260

Query  739  PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            P+D+LNV NN FTGWIP +L+ I++++TGGN W+S
Sbjct  261  PIDDLNVANNQFTGWIPSELKNIDNIKTGGNQWSS  295



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   277 bits (709),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 186/255 (73%), Gaps = 7/255 (3%)
 Frame = +1

Query  88   ASLKMRELMGLPWAVALLIGFLLNAPPSAVA-DTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            A  + RE +    A+ +L   +L   P  V   TD  D S L  LF+SLNSP QLT W A
Sbjct  2    AKARGRETL----AIGVLFACILVGNPGGVGGATDQNDVSTLNVLFTSLNSPSQLTGWIA  57

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN--SL  438
            NGGDPCG+SW GV+C+G+ +T I++SGL L+G++G+ L  + S+   D+S NN+G+   L
Sbjct  58   NGGDPCGQSWLGVTCTGSAITTIKLSGLGLSGTLGYNLQTMTSLAELDMSNNNIGSGGQL  117

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PY LPPN+Q LNL GN F+G +PYSIS M  L+YLN++HNQLQG +T MF  LTNL+T+D
Sbjct  118  PYNLPPNLQSLNLGGNQFSGNIPYSISLMVTLKYLNLAHNQLQGNLTEMFGGLTNLTTMD  177

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL  798
             SFN L G++PQ+FS+L+++  +YL+NN FTG ID+LANLPL +LNV NN FTGWIP QL
Sbjct  178  LSFNQLTGDLPQSFSNLSSLTTLYLENNQFTGHIDILANLPLQDLNVANNRFTGWIPDQL  237

Query  799  QGINSLQTGGNSWNS  843
            + IN+L+T GNSW+S
Sbjct  238  KKINNLRTDGNSWSS  252



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 180/239 (75%), Gaps = 2/239 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A+ ++  FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct  5    AIGVVALFLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT  64

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I +SG++L G++G+ ++QL ++   D S NNLG S +PY LPPN+Q LNL G
Sbjct  65   CSGSRVTAINLSGMRLNGTLGYNMNQLTALVQLDASNNNLGGSDIPYNLPPNLQSLNLEG  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L  LN+ HNQL   +  MF  LTNL+TLD S+N+ +GNIPQ+F+
Sbjct  125  NNFTGTVPYSISQMVALRNLNLGHNQL-SNINDMFSQLTNLTTLDLSYNTFSGNIPQSFN  183

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            SLT++K +YLQNN F+GTIDVL NLPL +LNVENN FTGW+P +L+GIN+LQT GNS+N
Sbjct  184  SLTSLKTLYLQNNKFSGTIDVLTNLPLTDLNVENNQFTGWVPDKLKGINNLQTSGNSFN  242



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 182/222 (82%), Gaps = 1/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TDP+DAS L+ ++SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+
Sbjct  30   AATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLS  89

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  L ++T  D+S NN G  +PY +PPN+++L+L  N FTG +PYSISQM  L+
Sbjct  90   GSVGYQLSSLTALTNLDLSNNNFGGDIPYNIPPNLERLDLENNKFTGNVPYSISQMKTLK  149

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            Y+N++HNQLQG++  MF  L +LSTLD SFN+L+GN+PQ+FSSL+++ ++YLQNN F+GT
Sbjct  150  YVNIAHNQLQGQLNDMFGQLPSLSTLDLSFNTLSGNLPQSFSSLSSLSSLYLQNNQFSGT  209

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            IDVLANLPLDNLN+ NN FTGW+P QL+ IN LQ  GNSW+S
Sbjct  210  IDVLANLPLDNLNIANNRFTGWVPEQLKNIN-LQKDGNSWSS  250



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 186/239 (78%), Gaps = 3/239 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL++  ++   PS +  DTD +D S L  LF+S+NSP QL++WTA+GGDPCG++W+GV+
Sbjct  8    LALVLLCIVGFEPSFIHGDTDASDTSALNSLFTSMNSPGQLSQWTASGGDPCGQNWRGVT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++  L L+GS+GF LD+L SVT  D+S NNLG  L YQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTELDLSNNNLGGDLSYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P + SS
Sbjct  128  QFTGSAQYSISLMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNSCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LT+ K++YLQNN F+GTID+LA LPL+NLN+ NN FTGW+P  L+GIN LQ  GN +NS
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENLNIANNRFTGWVPDSLKGIN-LQKDGNLFNS  244



>ref|XP_010087069.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
 gb|EXB26124.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
Length=697

 Score =   275 bits (702),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 176/238 (74%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            + L I F        ++ T+  D S L  +++SLNSP QL+ W ++GGDPCG+SW+G+ C
Sbjct  6    LGLWIVFFGVIATRVLSKTNAPDVSALNVMYTSLNSPSQLSGWQSSGGDPCGDSWEGIKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI +S L L+GSMG+QL  L SVT FD+S NN+   +PYQLPPN Q ++L+ NG
Sbjct  66   SGSSVTEINLSNLGLSGSMGYQLSSLTSVTYFDLSKNNIKGEIPYQLPPNAQYIDLSENG  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FT  +PYS SQM  LEYLN++HNQL G+++ MF  LT L  LD S NSL GN+PQ+F  L
Sbjct  126  FTNNVPYSFSQMTDLEYLNLAHNQLNGQLSDMFGKLTKLKELDLSSNSLTGNLPQSFGKL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  ++LQ+N FTG I+VLANLPLD+LNVE+N F+GWIP +L+GI  L+TGGNSW+S
Sbjct  186  SSLIKLHLQDNKFTGPINVLANLPLDDLNVEDNDFSGWIPEELKGIRKLKTGGNSWSS  243



>ref|XP_010489831.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=404

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 177/227 (78%), Gaps = 2/227 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P   +  TD +D S L  +F+S+NSP QL++WTA+GGDPCG++W+GV+CSG+RVT+I++ 
Sbjct  22   PSFILGATDASDTSALNIMFTSMNSPGQLSQWTASGGDPCGQNWRGVTCSGSRVTQIKLP  81

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L L+G++G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS 
Sbjct  82   SLGLSGTLGYTLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISL  141

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P + S LT+ K++YLQNN
Sbjct  142  MAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNSCSFLTSAKSIYLQNN  200

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             F+GTID+LA LPL+NLN+ NN FTGW+P  L+GIN LQ  GN + S
Sbjct  201  QFSGTIDILATLPLENLNIANNRFTGWVPDSLKGIN-LQKDGNLFTS  246



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 178/229 (78%), Gaps = 3/229 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L     A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG+
Sbjct  16   ILGFELRFIHGA---TDSSDTSALNMLFSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGS  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+I GL+L+G++GF LD+L S+T  D+S+NNLG  LPY LPPN+++LNLA N FTG
Sbjct  73   RVTQIKIPGLELSGTLGFMLDRLTSLTELDLSSNNLGGDLPYPLPPNLEQLNLANNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQMA L+YLN+ HNQ  G + V F  LT+L+TLDFSFNS  G++P +F+SLT++
Sbjct  133  TAQYSISQMASLKYLNLGHNQFTGNIGVDFTKLTSLTTLDFSFNSFTGSLPGSFTSLTSI  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG  825
            K++YLQNN F+GT++VLA LPL+ LN+ NN FTGWIP  L+GI  ++ G
Sbjct  193  KSLYLQNNQFSGTLNVLAGLPLETLNIANNDFTGWIPSSLKGIKLIKDG  241



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 178/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+I +  L 
Sbjct  39   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIILPNLS  98

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            LTG++ + ++ L S+   D+S NNLG+   +PY LP   ++KLNLAGN F G LPYSIS 
Sbjct  99   LTGTLAYNMNNLGSLVELDMSQNNLGSGAQIPYNLPNMKLEKLNLAGNQFGGNLPYSIST  158

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F SL +LS LD SFNSL+G++PQ+F+ L+++K +YLQNN
Sbjct  159  MPNLKYLNLNHNQLQGNISDVFSSLYSLSELDLSFNSLSGDLPQSFTGLSSLKKIYLQNN  218

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTG I+VLANLPL+ LNV NNHFTGWIP QL+ INSLQT GNSW++
Sbjct  219  QFTGYINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST  265



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 177/243 (73%), Gaps = 7/243 (3%)
 Frame = +1

Query  121  PWAVALLIGFLLNAPPSAV--ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESW  294
            PW + L++ F++++  + V   DTDP D S L  LF S+NSP QL  W  NG DPCG+SW
Sbjct  5    PW-LMLMLMFIISSSCTFVINGDTDPNDVSALMALFQSMNSPSQLN-W--NGNDPCGQSW  60

Query  295  KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN  474
             G++CSGNR+TEI++ G QLTG++GFQL  L SVT  D+S NNL  +LPYQ PPN+Q LN
Sbjct  61   TGITCSGNRITEIKLPGRQLTGTLGFQLQSLSSVTNLDLSNNNLAGTLPYQFPPNLQHLN  120

Query  475  LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ  654
            LA N F GG+PYS S    L  LN  HNQ Q  + + F  LT+L+T D SFNSL G++PQ
Sbjct  121  LANNNFNGGIPYSFSDTPSLISLNFGHNQFQQALNLNFQKLTSLTTFDVSFNSLTGDLPQ  180

Query  655  TFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS  834
            T +SL+++  M LQNN FTGTID+LA+LPLDNLN+ENNHFTGWIP QL+ IN LQ  GNS
Sbjct  181  TMNSLSSISTMNLQNNQFTGTIDILADLPLDNLNIENNHFTGWIPEQLKNIN-LQKNGNS  239

Query  835  WNS  843
            W+S
Sbjct  240  WSS  242



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  LF+S++SP QLT+WTA+GGDPC ++W+GV+CS +R+T++++SGL+L+G+
Sbjct  29   TDASDTSALNMLFTSMHSPGQLTQWTASGGDPCVQNWRGVTCSKSRITQLKLSGLELSGT  88

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS MA L+YL
Sbjct  89   LGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMASLKYL  148

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQ +G+V V F  LT+L+TLDFSFNS   ++P TF+SLT++K++YLQNN F+GT++
Sbjct  149  NLGHNQFKGQVAVDFSKLTSLTTLDFSFNSFTSSLPGTFTSLTSLKSLYLQNNQFSGTLN  208

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VLA LPL+ LN+ NN FTGWIP  L+G N L   GNS+N
Sbjct  209  VLAGLPLETLNIANNDFTGWIPSTLKGTN-LIKDGNSFN  246



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 188/238 (79%), Gaps = 3/238 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  14   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  73

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  74   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  133

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P T SS
Sbjct  134  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNTITGSLPNTMSS  192

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            LTN K++YLQNN FTGTIDVLA LPL+NLN+ NN FTGWIP  L+GIN LQ  GNS+N
Sbjct  193  LTNAKSIYLQNNQFTGTIDVLATLPLENLNIANNRFTGWIPDSLRGIN-LQKDGNSFN  249



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 169/208 (81%), Gaps = 1/208 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+MG+QL  L S+
Sbjct  1    MYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSL  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  LN+SHNQLQ +V
Sbjct  61   TNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISLNMSHNQLQNQV  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN  756
              MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTIDVLANLPL NLN
Sbjct  121  NDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTIDVLANLPLQNLN  180

Query  757  VENNHFTGWIPPQLQGINSLQTGGNSWN  840
            VENNHFTGW+P +L+ IN +Q GGNSW+
Sbjct  181  VENNHFTGWVPERLKNIN-IQEGGNSWS  207



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   272 bits (696),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 185/254 (73%), Gaps = 15/254 (6%)
 Frame = +1

Query  100  MRELMGLPWAV------ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            MRE     WAV       +++GF L     A   TD +D S L  LFS ++SP QLT+WT
Sbjct  1    MRE----NWAVVALFTLCIVVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWT  53

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSL  438
            A  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G + LD+L S+T  D+S+NNLG  L
Sbjct  54   AAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDL  113

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PYQ PPN+Q+L LA N FTG   YSISQ+  L+YLN+ HNQ +G++ + F  L +L+TLD
Sbjct  114  PYQFPPNLQRLYLANNQFTGAAAYSISQITTLKYLNLGHNQFKGQIAIDFTKLDSLTTLD  173

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL  798
            FSFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L
Sbjct  174  FSFNSFTNSLPGTFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSL  233

Query  799  QGINSLQTGGNSWN  840
            +GI +L   GNS+N
Sbjct  234  KGI-TLIKDGNSFN  246



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 183/239 (77%), Gaps = 2/239 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A+ +++ FL  AP  A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct  5    AIGVVVLFLAAAPFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT  64

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I++ G++L G++G+ ++Q+ ++   D+S NNLG S +PY LPPN++ LNLA 
Sbjct  65   CSGSRVTTIKLPGMRLNGTLGYNMNQMTALIQLDMSNNNLGGSDIPYNLPPNMEILNLAS  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L+ LN+ HNQL   +  MF  LTNL+ +D S+N+ +GNIPQ+F+
Sbjct  125  NNFTGTVPYSISQMVALKNLNLGHNQL-SNINDMFNQLTNLTAMDLSYNNFSGNIPQSFN  183

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            SL ++K +YLQNN F+GT+DVLA+LPL +LN+ENN FTGW+P +L+GIN+LQT GNS+N
Sbjct  184  SLKSLKALYLQNNKFSGTVDVLADLPLTDLNIENNQFTGWVPDKLKGINNLQTSGNSFN  242



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
              ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++  L 
Sbjct  30   VAADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLPSLG  89

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPN-VQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ + S+   D+S NNLG    + Y LP N +++LNLAGN FTG LPYSI  
Sbjct  90   LSGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTNKLERLNLAGNQFTGNLPYSIFS  149

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M+ L+YLN++HNQLQG +T +F SL +L+TLD SFNSLAG++PQ F+SL+++K +YLQNN
Sbjct  150  MSNLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLAGDLPQGFTSLSSLKKLYLQNN  209

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
             FTG I+VLANLPLD+LNV NNHFTGWIP QL+ IN+LQT GNSW+
Sbjct  210  QFTGYINVLANLPLDDLNVANNHFTGWIPSQLKKINNLQTDGNSWS  255



>gb|KHN38109.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Glycine soja]
Length=690

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 175/236 (74%), Gaps = 0/236 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L I  L  +       T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CSG
Sbjct  12   LWIALLAVSTTVVHCKTASQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSG  71

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +S L L+GSMG+QL  LKSVT FD+S NN    +PYQLPPN + ++L+ N FT
Sbjct  72   SSVTEINLSDLGLSGSMGYQLSSLKSVTDFDLSNNNFKGDIPYQLPPNARYIDLSKNDFT  131

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +PYS S+M  L YLN++HNQL+ ++  MF  L+ L  LD SFNSL+G++PQ+  SL +
Sbjct  132  GSIPYSFSEMDDLNYLNLAHNQLKNQLGDMFGKLSKLKQLDVSFNSLSGDLPQSLKSLKS  191

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            ++ ++LQNN FTG+++VLA+LPL++LNVENN FTGW+P +L+ IN+LQTGGNSW+S
Sbjct  192  LEKLHLQNNQFTGSVNVLASLPLEDLNVENNKFTGWVPEELKEINNLQTGGNSWSS  247



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TDP+DAS L+ ++SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+
Sbjct  30   AATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLS  89

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+QL  L ++T  D+S NN G  +PY +P N+++L+L  N FTG +PY  SQM  L+
Sbjct  90   GSMGYQLSSLTALTNLDLSNNNFGPDIPYNVPQNLERLDLGNNKFTGNVPYYFSQMKTLK  149

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HNQLQG++  MF  L +LSTLD SFN+L+GN+PQ+FSSL+++ ++YLQNN F+GT
Sbjct  150  YLNIAHNQLQGQLNDMFGQLPSLSTLDLSFNTLSGNLPQSFSSLSSLSSLYLQNNQFSGT  209

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            IDVLANLPLDNLN+ NN FTGW+P QL+ IN LQ  GNSW+S
Sbjct  210  IDVLANLPLDNLNIANNRFTGWVPEQLKNIN-LQKDGNSWSS  250



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 176/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L 
Sbjct  48   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLS  107

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            LTG++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS 
Sbjct  108  LTGNLAYNMNNLGSLVELDMSQNNLGGGGQIQYNLPNMKLEKLNLAGNQFGGNLPYSIST  167

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN
Sbjct  168  MPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNN  227

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTG I+VLANLPL+ LNV NNHFTGWIP QL+ INSLQT GNSW++
Sbjct  228  QFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST  274



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 181/235 (77%), Gaps = 5/235 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF    P   +  TD +D S L  +F S+NSP QL++WTA+GGDPCG++WKGV+CSG+
Sbjct  18   IVGF---EPSFILGATDASDTSALNIMFISMNSPGQLSQWTASGGDPCGQNWKGVTCSGS  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I++ GL L+G++G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG
Sbjct  75   RVTQIKLPGLGLSGTLGYTLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P + S LT+ 
Sbjct  135  SAQYSISLMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNSCSFLTSA  193

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            K++YLQNN F+GTID+LA LPL+NLN+ NN FTGW+P  L+GIN LQ  GN + S
Sbjct  194  KSIYLQNNQFSGTIDILATLPLENLNIANNRFTGWVPDSLKGIN-LQKDGNLFTS  247



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 175/220 (80%), Gaps = 2/220 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  +F+S+NSP QL++WTA+GGDPCG++WKGV+CSG R+T+I++ GL L+GS
Sbjct  30   TDASDTSALNTMFNSMNSPGQLSQWTASGGDPCGQNWKGVTCSGLRITQIKLPGLGLSGS  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+YL
Sbjct  90   LGYMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMAPLKYL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N++HNQL+ ++ + F  LT+LS LD S N++ G++P T S LT+ K++YLQNN F+GTID
Sbjct  150  NLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNTCSFLTSAKSIYLQNNQFSGTID  208

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +LA LPL+NLN+ NN FTGW+P  L+GIN LQ  GN + S
Sbjct  209  ILATLPLENLNIANNRFTGWVPDSLKGIN-LQKDGNLFTS  247



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 194/255 (76%), Gaps = 6/255 (2%)
 Frame = +1

Query  76   LSERASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTK  255
            + ++ S K R + GL   +  ++G     P   + DT+ +DA+ L  LFSSLNSP QL++
Sbjct  1    MKKKMSEKNRHV-GLALFILCIVGL---KPSFILGDTNASDAAALNNLFSSLNSPGQLSQ  56

Query  256  WTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS  435
            WTA+GGDPCG++WKG++CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  
Sbjct  57   WTASGGDPCGQNWKGITCSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGD  116

Query  436  LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL  615
            LPYQLPPN+++LNLA N FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS L
Sbjct  117  LPYQLPPNLERLNLANNQFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSIL  175

Query  616  DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQ  795
            D S N++ G++P T +SLT+ K++YLQNN FTGTIDVLA LPL+N+N+ NN FTGWIP  
Sbjct  176  DLSSNTITGSLPNTMTSLTSAKSIYLQNNQFTGTIDVLATLPLENMNIANNRFTGWIPDS  235

Query  796  LQGINSLQTGGNSWN  840
            L+GIN LQ  GNS+N
Sbjct  236  LRGIN-LQKDGNSFN  249



>ref|XP_006586431.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Glycine 
max]
Length=725

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 175/236 (74%), Gaps = 0/236 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L I  L  +       T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CSG
Sbjct  47   LWIALLAVSTTVVHCKTASQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSG  106

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +S L L+GSMG+QL  LKSVT FD+S NN    +PYQLPPN + ++L+ N FT
Sbjct  107  SSVTEINLSDLGLSGSMGYQLSSLKSVTDFDLSNNNFKGDIPYQLPPNARYIDLSKNDFT  166

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +PYS S+M  L YLN++HNQL+ ++  MF  L+ L  LD SFNSL+G++PQ+  SL +
Sbjct  167  GSIPYSFSEMDDLNYLNLAHNQLKNQLGDMFGKLSKLKQLDVSFNSLSGDLPQSLKSLKS  226

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            ++ ++LQNN FTG+++VLA+LPL++LNVENN FTGW+P +L+ IN+LQTGGNSW+S
Sbjct  227  LEKLHLQNNQFTGSVNVLASLPLEDLNVENNKFTGWVPEELKEINNLQTGGNSWSS  282



>ref|XP_008668240.1| PREDICTED: uncharacterized protein LOC100381414 isoform X2 [Zea 
mays]
Length=671

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 174/236 (74%), Gaps = 2/236 (1%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSG  315
            +  L +A   AVA TD +D + L  +F+S+N P QL+ W ++GGDPC +   WKG+ CSG
Sbjct  16   LAVLFSAVAPAVAKTDKSDVAALNVMFNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSG  75

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +SGL+L+GS+G+QL  LKSVT FD+S NNL   LPYQLPPNV +LNL GN  T
Sbjct  76   SSVTEINLSGLELSGSLGYQLSSLKSVTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLT  135

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            GG+PYSISQM  LE LN+  N L G++T MF  L  LSTLD SFN  +G++P++F  L +
Sbjct  136  GGVPYSISQMGDLETLNLGKNHLSGQLTDMFSELPKLSTLDLSFNRFSGSLPKSFQHLKD  195

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +K + +++N F+G IDVLA LPL++LN++NN FTGWIP +L+ I++LQ GGN W+S
Sbjct  196  LKTLNVESNQFSGHIDVLAKLPLEDLNLQNNKFTGWIPSKLKDISNLQIGGNQWSS  251



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   270 bits (690),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 188/238 (79%), Gaps = 3/238 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  10   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  69

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  70   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  129

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P T +S
Sbjct  130  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNTITGSLPNTMTS  188

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            LT+ K++YLQNN FTGTIDVLA LPL+N+N+ NN FTGWIP  L+GIN LQ  GNS+N
Sbjct  189  LTSAKSIYLQNNQFTGTIDVLATLPLENMNIANNRFTGWIPDSLRGIN-LQKDGNSFN  245



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   270 bits (690),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/248 (59%), Positives = 187/248 (75%), Gaps = 4/248 (2%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            M    G+   V+LLI  +      A   TDP DAS LR ++SSLNSP QLT+W+ NG DP
Sbjct  2    MENWRGVEVLVSLLIVCIFGCVNGA---TDPNDASALRIMYSSLNSPGQLTQWSPNGDDP  58

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            CG++WKG+ CSG RVTEI++  L L+GS+G+QL  L +VT  D+S NNL  ++P QLPPN
Sbjct  59   CGQNWKGIICSGLRVTEIKLPSLGLSGSLGYQLTSLTAVTNLDMSYNNLAGNIPDQLPPN  118

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            +Q+LNLA N F+GG+PYSISQ+  L+YLN+ HNQLQ ++  +F  L +LSTLD SFNSL 
Sbjct  119  LQQLNLANNQFSGGIPYSISQLPSLKYLNLGHNQLQNQLGDVFRQLPSLSTLDLSFNSLT  178

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ  819
            G++PQ+FSSL++M +MYLQNN FTG+I+VLA+LPL+NLNV NN FTGWIP QL  IN LQ
Sbjct  179  GDLPQSFSSLSSMTSMYLQNNQFTGSINVLASLPLENLNVGNNRFTGWIPSQLNSIN-LQ  237

Query  820  TGGNSWNS  843
              GN+WNS
Sbjct  238  KDGNNWNS  245



>ref|XP_008668239.1| PREDICTED: uncharacterized protein LOC100381414 isoform X1 [Zea 
mays]
Length=685

 Score =   269 bits (687),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 174/236 (74%), Gaps = 2/236 (1%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSG  315
            +  L +A   AVA TD +D + L  +F+S+N P QL+ W ++GGDPC +   WKG+ CSG
Sbjct  16   LAVLFSAVAPAVAKTDKSDVAALNVMFNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSG  75

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +SGL+L+GS+G+QL  LKSVT FD+S NNL   LPYQLPPNV +LNL GN  T
Sbjct  76   SSVTEINLSGLELSGSLGYQLSSLKSVTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLT  135

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            GG+PYSISQM  LE LN+  N L G++T MF  L  LSTLD SFN  +G++P++F  L +
Sbjct  136  GGVPYSISQMGDLETLNLGKNHLSGQLTDMFSELPKLSTLDLSFNRFSGSLPKSFQHLKD  195

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +K + +++N F+G IDVLA LPL++LN++NN FTGWIP +L+ I++LQ GGN W+S
Sbjct  196  LKTLNVESNQFSGHIDVLAKLPLEDLNLQNNKFTGWIPSKLKDISNLQIGGNQWSS  251



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   269 bits (687),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 169/209 (81%), Gaps = 2/209 (1%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +FSS+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++  L L+GS+GF LD+L SV
Sbjct  1    MFSSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLPSLGLSGSLGFMLDKLTSV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+YLN++HNQL+ ++
Sbjct  61   TEFDMSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLK-QL  119

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN  756
             + F  LT+LS LD S N+  G++P T SSLT+ K++YLQNN F+GTID+LA LPL+NLN
Sbjct  120  AIDFTKLTSLSILDLSSNAFIGSLPNTCSSLTSAKSIYLQNNQFSGTIDILATLPLENLN  179

Query  757  VENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            + NN FTGWIP  L+GIN LQ  GN  NS
Sbjct  180  IANNRFTGWIPDSLKGIN-LQKDGNLLNS  207



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   269 bits (688),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 169/215 (79%), Gaps = 2/215 (1%)
 Frame = +1

Query  199  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  378
            A+ +R LF ++NSPPQL  W  NG DPCG+SWKG++CSGNRVTEI++S L LTGS+ + L
Sbjct  19   AAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLSNLGLTGSLPYGL  77

Query  379  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
              L S+T  D+S+N+LG S+PYQLPP +Q LNLA N  TG +PYSIS +  L  LN SHN
Sbjct  78   QVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNNITGTVPYSISNLTALTDLNFSHN  137

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            QLQ  + V F++L+ LSTLD SFN L G++PQT SSL+ +  MYLQNN FTGTIDVLANL
Sbjct  138  QLQQGLGVDFLNLSTLSTLDLSFNFLTGDLPQTMSSLSRITTMYLQNNQFTGTIDVLANL  197

Query  739  PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            PLDNLNVENN+FTGWIP QL+ IN LQTGGN+W+S
Sbjct  198  PLDNLNVENNNFTGWIPEQLKNIN-LQTGGNAWSS  231



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 183/250 (73%), Gaps = 4/250 (2%)
 Frame = +1

Query  94   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  273
            +K R+ + L      ++GF    P  +   TD  DAS L  +FSSLNSP QLT WTAN G
Sbjct  2    MKWRKGLVLALFTVCILGF---KPRCSDGATDQGDASALGVMFSSLNSPQQLTGWTANNG  58

Query  274  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP  453
            DPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+   D+S NNL   +PY +P
Sbjct  59   DPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLKELDLSHNNLAGDIPYNIP  118

Query  454  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS  633
             N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++  MF  L++LSTLD SFNS
Sbjct  119  LNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQLNDMFGPLSSLSTLDLSFNS  178

Query  634  LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINS  813
            L   +PQ+F +LT++K+MYLQNN FTGTIDVLANLPLDNL V NNHFTGWIP QL+ I+ 
Sbjct  179  LTDALPQSFKNLTSLKSMYLQNNQFTGTIDVLANLPLDNLYVSNNHFTGWIPDQLKSID-  237

Query  814  LQTGGNSWNS  843
            LQ+ GNSW+S
Sbjct  238  LQSDGNSWSS  247



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 175/232 (75%), Gaps = 2/232 (1%)
 Frame = +1

Query  148  FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT  327
            FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT
Sbjct  13   FLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVT  72

Query  328  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGL  504
             I++SG++L G++G+ ++QL ++   D+S NNLG S +PY LPPN+Q LNLA N FTG +
Sbjct  73   AIKLSGMRLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTV  132

Query  505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN  684
            PYSISQM  L  LN+ HNQL   +  MF  LTNL+TLD S+N+ +G+IP +F+SLT++K 
Sbjct  133  PYSISQMVALRDLNLDHNQL-SNINDMFSQLTNLTTLDLSYNTFSGDIPHSFNSLTSLKT  191

Query  685  MYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +YLQNN F GTIDVL +LPL +LNVENN  TGWIP +L+GIN+LQT GNS+N
Sbjct  192  LYLQNNKFNGTIDVLTDLPLTDLNVENNQLTGWIPDKLKGINNLQTSGNSFN  243



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/250 (59%), Positives = 182/250 (73%), Gaps = 4/250 (2%)
 Frame = +1

Query  94   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  273
            +K R+ + L      ++GF    P  +   TD  DAS L  +FSSLNSP QLT WTAN G
Sbjct  2    MKWRKGLVLALFTVCILGF---KPRCSDGATDQGDASALGVMFSSLNSPQQLTGWTANNG  58

Query  274  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP  453
            DPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+   D+S NNL   +PY +P
Sbjct  59   DPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLKELDLSHNNLAGGIPYNIP  118

Query  454  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS  633
             N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++  MF  L++LSTLD SFNS
Sbjct  119  LNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQLNDMFGPLSSLSTLDLSFNS  178

Query  634  LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINS  813
            L   +PQ+F +LT+MK+MYLQNN FTGTIDVLANLPLDNL V NNHFTGWIP QL+ I+ 
Sbjct  179  LTDALPQSFKNLTSMKSMYLQNNQFTGTIDVLANLPLDNLYVSNNHFTGWIPDQLKSID-  237

Query  814  LQTGGNSWNS  843
            LQ  GNSW+S
Sbjct  238  LQLDGNSWSS  247



>ref|XP_004488910.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cicer arietinum]
Length=706

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            L I FL+    + V   T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CS
Sbjct  11   LWIAFLIAVSTTTVHCKTSSQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCS  70

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  492
             + VTEI++S L L+GS+G+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ N F
Sbjct  71   SSSVTEIKLSDLGLSGSVGYQLASLTSVTYFDLSNNNLKGDIPYQLPPNARDIDLSKNQF  130

Query  493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT  672
            +G +PYSISQM  L  LN++HNQL  ++  MF SLT L  LD SFNSL+GN+PQ+  SL 
Sbjct  131  SGSIPYSISQMKELNSLNLAHNQLNNQLGDMFGSLTKLKQLDVSFNSLSGNLPQSLKSLR  190

Query  673  NMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            N+K ++LQNN F+G+++VLANLPLD++NVENN  TGW+P +L+ I++L+TGGNSW++
Sbjct  191  NLKKIHLQNNQFSGSLNVLANLPLDDVNVENNKLTGWVPEELKDISNLKTGGNSWST  247



>ref|XP_006649512.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 175/226 (77%), Gaps = 3/226 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++S L L
Sbjct  28   AADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLSSLGL  87

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    + Y LP   +++LNLAGN FTG LPYSI  M
Sbjct  88   SGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTSKLERLNLAGNQFTGNLPYSIFSM  147

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F SL +L+TLD SFNSL G++PQ F+SL+++K +YLQNN 
Sbjct  148  NNLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLTGDLPQGFTSLSSLKKLYLQNNQ  207

Query  706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            FTG I+VLANLPLD+LNV NN FTGWIP QL+ INSLQT GNSW++
Sbjct  208  FTGYINVLANLPLDDLNVANNRFTGWIPSQLKKINSLQTDGNSWST  253



>ref|XP_007139054.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11048.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=575

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P      TDP DAS +R LF ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S
Sbjct  20   PNGDAVSTDPNDASAVRFLFQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLS  78

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTGS+ + L  L S+T+ D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS 
Sbjct  79   NLGLTGSLPYGLQVLTSLTSLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISN  138

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN+ HNQLQ  + V F++L+ LSTLD SFNSL G++PQT SSL+++  M LQNN
Sbjct  139  LTALTDLNLGHNQLQQGLAVNFLNLSTLSTLDLSFNSLTGDLPQTMSSLSHITTMNLQNN  198

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGIN  810
             FTG IDVLANLPLDNLNVENN+FTGWIP QL+ IN
Sbjct  199  QFTGPIDVLANLPLDNLNVENNNFTGWIPEQLKNIN  234



>gb|KDO67050.1| hypothetical protein CISIN_1g040888mg, partial [Citrus sinensis]
Length=495

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 172/234 (74%), Gaps = 2/234 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V   I +L +     ++ TD  DAS L  +++SL+SP QL+ W A GGDPCGE WKG++C
Sbjct  7    VGFFIFYLGSFSCHVLSKTDSQDASALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGITC  66

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI++SGL L G +G+QL  LKSV+  D+S NNL +S+PYQLPPN++ L+L+ N 
Sbjct  67   SGSSVTEIKLSGLGLNGQLGYQLTNLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSENQ  126

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            F+G +PYSISQM+ L+YLN+  NQL G+++ MF     L TLD S N L G +P++F+SL
Sbjct  127  FSGTVPYSISQMSELKYLNLGSNQLNGQLSDMFQKNEKLETLDLSKNQLTGELPRSFASL  186

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            +++K +YLQNN FTG+I+VL  LPLD LNVENN F+GW+P +L+ I   +TGGN
Sbjct  187  SSLKKLYLQNNQFTGSINVLGKLPLDELNVENNKFSGWVPEELKDI--AKTGGN  238



>ref|XP_009408730.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   267 bits (682),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 174/221 (79%), Gaps = 0/221 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TD  D S L  ++SSLNSPPQLT W+++GGDPCG +WKG+ CSG+ VT+I +SGLQLTG
Sbjct  24   NTDQADVSALNVMYSSLNSPPQLTGWSSSGGDPCGNNWKGIKCSGSSVTKITLSGLQLTG  83

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            +MG+QL  L SVT FD+S NNL   +PYQLPPN   LNLAGN  TGG+PYS+SQM  L+Y
Sbjct  84   TMGYQLSSLISVTYFDLSKNNLNGDIPYQLPPNTTHLNLAGNALTGGIPYSVSQMNHLKY  143

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN++ NQL G++T MF  L++LS LD SFN  +GN+P +F SL+++K + LQNN  +G++
Sbjct  144  LNLASNQLSGQLTDMFGELSSLSLLDLSFNRFSGNLPNSFGSLSSLKTLNLQNNQLSGSV  203

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLA L L+NLNV+NN FTGWIP +L+ IN+L+ GGNSW++
Sbjct  204  DVLATLSLENLNVQNNQFTGWIPNKLKSINNLKVGGNSWST  244



>ref|XP_011659592.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis sativus]
 gb|KGN45432.1| hypothetical protein Csa_7G447940 [Cucumis sativus]
Length=263

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 183/249 (73%), Gaps = 6/249 (2%)
 Frame = +1

Query  97   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            + REL+       +++  L + P      T+PTDAS LR L+ SL+SP +LT+W ANGGD
Sbjct  4    RWRELISF-----IILCILWSKPICIQGTTNPTDASALRVLYISLDSPSRLTQWNANGGD  58

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SWKG++CS +RVTEI +SGL L+GS+G+QL  + SVT  D+S NN G  + Y LPP
Sbjct  59   PCGQSWKGITCSDSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPP  118

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
            N+++LNL  N F   +PYSIS    L+YLN+SHNQLQ  +  ++  LT+LS LD SFN++
Sbjct  119  NLKRLNLGRNNFNKAIPYSISLTTSLQYLNISHNQLQDPLMDVYGQLTSLSILDLSFNAM  178

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL  816
            +GN+PQ+FSSL+ + +MYLQNN FTGTIDVLA LPLDNLNVENN FTGWIP  L+ IN L
Sbjct  179  SGNLPQSFSSLSGISSMYLQNNRFTGTIDVLATLPLDNLNVENNRFTGWIPEPLKNIN-L  237

Query  817  QTGGNSWNS  843
            Q  GNSWN+
Sbjct  238  QKNGNSWNT  246



>ref|XP_004959657.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Setaria 
italica]
Length=693

 Score =   266 bits (680),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 166/222 (75%), Gaps = 2/222 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCG--ESWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F+S+N P QL+ W ++GGDPCG  E WKG+ CSG+ VTEI +SGL L+
Sbjct  31   TDQPDVAALNVMFNSMNKPSQLSGWKSSGGDPCGGDEEWKGIECSGSSVTEINLSGLGLS  90

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD S NNL   +PYQLPPN+ +LNL GN FTGG+PYSISQM  LE
Sbjct  91   GTLGYQLSSLKSVTKFDASNNNLNGDIPYQLPPNMVQLNLYGNSFTGGVPYSISQMEDLE  150

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LNV  N L G++T MF  L  LSTLD SFN  +G++PQ+F  L N+K + +++N F+G 
Sbjct  151  TLNVGKNHLNGQLTDMFSQLPKLSTLDLSFNRFSGSLPQSFQHLRNLKTLNVESNQFSGH  210

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            IDVLA LPL++LN++NN FTGWIP +L+ IN+LQ GGN W+S
Sbjct  211  IDVLAKLPLEDLNLQNNKFTGWIPSKLKDINNLQIGGNQWSS  252



>gb|KJB67061.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=636

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A TD  DAS L  +FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLA  81

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSVGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN++HNQLQ +++ MF  L++LSTLD SFNSL G++P++F +LT+M +MYLQNN  T
Sbjct  142  LQYLNLAHNQLQNQLSDMFGPLSSLSTLDLSFNSLTGDLPESFKNLTSMNSMYLQNNQLT  201

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            GTIDVLANLPLD L V NNHFTGWIP QL+ IN LQ  GNSW
Sbjct  202  GTIDVLANLPLDTLYVSNNHFTGWIPDQLKSIN-LQKDGNSW  242



>gb|KJB67062.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=622

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A TD  DAS L  +FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLA  81

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSVGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN++HNQLQ +++ MF  L++LSTLD SFNSL G++P++F +LT+M +MYLQNN  T
Sbjct  142  LQYLNLAHNQLQNQLSDMFGPLSSLSTLDLSFNSLTGDLPESFKNLTSMNSMYLQNNQLT  201

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            GTIDVLANLPLD L V NNHFTGWIP QL+ IN LQ  GNSW
Sbjct  202  GTIDVLANLPLDTLYVSNNHFTGWIPDQLKSIN-LQKDGNSW  242



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP DAS LR ++ SL SP QLT+W+ANG DPCG++WKG+ CSG+RVTEI++  L L GS
Sbjct  27   TDPNDASALRVMYISLQSPGQLTQWSANGDDPCGQNWKGIICSGSRVTEIKLPSLGLPGS  86

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L +VT  D+S NNL  ++P QLPPN+Q+LNLA N F+GG+PYSISQ+  L+YL
Sbjct  87   LGYQLTSLTAVTNLDMSYNNLAGNIPDQLPPNLQQLNLANNQFSGGIPYSISQLPSLKYL  146

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQ ++  +F  L +LSTLD SFNSL G++PQ+FSSL++M +MYLQNN FTG+I+
Sbjct  147  NLGHNQLQNQLGDVFGQLPSLSTLDLSFNSLTGDLPQSFSSLSSMTSMYLQNNQFTGSIN  206

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLA+LPL+NLNV NN FTGWIP QL  IN LQ  GN+WNS
Sbjct  207  VLASLPLENLNVGNNRFTGWIPSQLNSIN-LQKDGNNWNS  245



>ref|XP_003604115.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AES86312.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=790

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 176/247 (71%), Gaps = 0/247 (0%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            +R+ M +   ++ L   +L +  S    T   D S L  +++SLNSP QL+ W ++GGDP
Sbjct  87   LRKKMHINHNLSWLWIIVLISTASVQCKTSSQDVSALNVMYTSLNSPSQLSGWKSSGGDP  146

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            CGE+W+G+ CSG+ VTEI +S L L+GS+G+QL QL SVT FD+S NN    +PYQLPPN
Sbjct  147  CGENWEGIKCSGSSVTEINLSDLGLSGSLGYQLSQLTSVTDFDLSNNNFKGDIPYQLPPN  206

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
             + ++L+ N FTG +PYSI QM  L  LN++HN+L  ++  MF +LT L  LD SFNSL+
Sbjct  207  ARNVDLSKNAFTGNIPYSIGQMKELTSLNLAHNKLNNQLGDMFTTLTKLKQLDVSFNSLS  266

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ  819
            G +PQ+  S T++K +YLQNN  +G+I+VLA  PLD++NVENN FTGWIP +L+ INSLQ
Sbjct  267  GELPQSLKSATSLKKIYLQNNQLSGSINVLAYPPLDDVNVENNKFTGWIPEELKDINSLQ  326

Query  820  TGGNSWN  840
            TGGNSW 
Sbjct  327  TGGNSWK  333



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 183/241 (76%), Gaps = 2/241 (1%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            W + +    +L   PS++ A TDP D S L+ L+SSLNSP QLT+W+ANG DPCG+SWKG
Sbjct  7    WVLLVFSICILGWSPSSINAATDPADVSALKALYSSLNSPSQLTQWSANGDDPCGQSWKG  66

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V CSG+RVTEI +S LQL+GS+   L  L S+T  D+S NNL  S+PY LPPN+ +LNLA
Sbjct  67   VKCSGSRVTEIDVSNLQLSGSLWSSLQSLTSLTNLDMSHNNLAGSIPYSLPPNMTRLNLA  126

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N F  G+PYSISQ+  LEYLN+SHNQLQ +V  +F  L++LSTLD SFNSL+GN+P++ 
Sbjct  127  ANNFNQGIPYSISQITSLEYLNISHNQLQNQVDDIFGKLSSLSTLDLSFNSLSGNLPESL  186

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            SSL++M  M LQNN  TG I+VLANLPL+NLN++NN FTGWIP QL+ IN L+  GN+WN
Sbjct  187  SSLSSMTRMNLQNNQLTGNINVLANLPLENLNIQNNQFTGWIPEQLKNIN-LEKDGNTWN  245

Query  841  S  843
            S
Sbjct  246  S  246



>ref|XP_011659594.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
sativus]
 gb|KGN45433.1| hypothetical protein Csa_7G447950 [Cucumis sativus]
Length=715

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDPTDAS LR L++SLNSP QLT+W ANG DPCG+SWKG++CSG+RVTEI +SGL L+G
Sbjct  27   NTDPTDASALRVLYTSLNSPSQLTQWNANGDDPCGQSWKGITCSGSRVTEINLSGLGLSG  86

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL  + SVT  D+S NN G  + Y LPPN+++LNL  N F  G+PYSIS M  L+Y
Sbjct  87   SLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPPNLKRLNLGRNNFNKGIPYSISMMTSLQY  146

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHNQLQ  +  ++  LT+LS LD SFN+++GN+PQ+FSSL+ + +MYLQNN FTGTI
Sbjct  147  LNISHNQLQDPLMDVYGQLTSLSILDLSFNAMSGNLPQSFSSLSGISSMYLQNNRFTGTI  206

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            DVLA LPLDNLNVENN FTGWIP  L+ IN LQ  GNSWN
Sbjct  207  DVLATLPLDNLNVENNRFTGWIPEPLKNIN-LQKNGNSWN  245



>ref|XP_002310348.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE90798.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=672

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 177/222 (80%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  22   SKTDSEDVSALNVMFTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLKNDIPYQLPPNAATLDLSNNGFTGSVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN++ N+L G+++ MF  L+ L TLD S NS++GN+PQ+FS+L+++  ++LQ+N FTGT
Sbjct  142  NLNLNQNKLNGQLSDMFQKLSKLKTLDLSHNSISGNLPQSFSALSSLSTLHLQDNEFTGT  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            IDVLA LPL +LN+++N FTGW+P  L GI++L+TGGN+W+S
Sbjct  202  IDVLARLPLKDLNIKDNEFTGWVPDSLNGIDNLETGGNAWSS  243



>ref|XP_008445635.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Cucumis melo]
Length=706

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 167/222 (75%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + T   D S L  +FSSLNSP QLT W ++GGDPCG+SW+G+ CSG+ VTEI +S   L+
Sbjct  22   SKTKAPDVSALNVMFSSLNSPSQLTGWGSSGGDPCGDSWEGIKCSGSSVTEISLSDFGLS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+QL  L SVT FD+S N+L   +PYQLPPN   ++L+GN FTG +PYSISQM  LE
Sbjct  82   GSMGYQLSNLASVTYFDLSKNSLSGDIPYQLPPNAVHIDLSGNSFTGSVPYSISQMTELE  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            +LN+ HNQL  +++ MF  L  L  LD SFN ++GN+PQ+F  L+++  +++Q+N F+G+
Sbjct  142  FLNLGHNQLSNQLSDMFGKLAKLKRLDLSFNKISGNLPQSFKKLSSLTVLHIQDNKFSGS  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLA+LPLD+LNV NN FTGWIP  L+ I++L+T GNSW++
Sbjct  202  INVLADLPLDDLNVANNKFTGWIPESLEDIDNLETVGNSWST  243



>ref|XP_008462231.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis melo]
Length=716

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 187/248 (75%), Gaps = 6/248 (2%)
 Frame = +1

Query  97   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            + RE++ L     +++  L + P      TDPTDAS L+ L++SLNSP QLT+W ANG D
Sbjct  4    RWREVISL-----IILCILWSKPICIQGTTDPTDASALKVLYTSLNSPSQLTQWNANGDD  58

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SW+G++CSG+RVTEI +SGL L+GS+G+QL  + SVT  D+S NNLG  + Y LPP
Sbjct  59   PCGQSWRGITCSGSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNLGGEIGYNLPP  118

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
             +++LNL  N F  G+PYS+S M  L+YLN+SHNQLQ  +  ++  LT+LS LD SFNS+
Sbjct  119  KLKRLNLGRNNFNKGIPYSVSLMTSLQYLNISHNQLQDPLNDVYGQLTSLSILDLSFNSM  178

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL  816
            +GN+PQ+FSSL+ + +MYLQNN FTGTIDVLA+LPLDNLNVENN FTGWIP  L+ IN L
Sbjct  179  SGNLPQSFSSLSGISSMYLQNNQFTGTIDVLASLPLDNLNVENNRFTGWIPEPLKNIN-L  237

Query  817  QTGGNSWN  840
            Q  GNSWN
Sbjct  238  QKNGNSWN  245



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 172/223 (77%), Gaps = 1/223 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A TD  DAS L  +FSSLNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSSLNSPQQLTGWTANNGDPCGQSWKGVTCSDQRVTEIKLSNLA  81

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GSMG+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSMGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN++HNQLQ +++ MF  L++LSTLD SFNSL G++P++F +LT+M  MYLQNN FT
Sbjct  142  LQYLNLAHNQLQNQLSDMFGPLSSLSTLDLSFNSLTGDLPESFKNLTSMNTMYLQNNQFT  201

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            GTIDVLANLPLD L V +N FTGWIP QL+ IN LQ  GNSW+
Sbjct  202  GTIDVLANLPLDILYVSDNRFTGWIPDQLKSIN-LQKDGNSWS  243



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 173/226 (77%), Gaps = 3/226 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L L
Sbjct  36   AADTDPNDLNVLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNLSL  95

Query  355  TGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            TG++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M
Sbjct  96   TGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTM  155

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN 
Sbjct  156  PNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQ  215

Query  706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            FTG I+VLANLPL+ LNV NNHFTGWIP QL+ IN+LQT GNSW++
Sbjct  216  FTGYINVLANLPLETLNVGNNHFTGWIPSQLKKINNLQTDGNSWST  261



>ref|NP_001104882.1| leucine-rich repeat transmembrane protein kinase 2 precursor 
[Zea mays]
 gb|AAC27895.1| leucine-rich repeat transmembrane protein kinase 2 [Zea mays]
Length=725

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 173/226 (77%), Gaps = 3/226 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L L
Sbjct  36   AADTDPNDLNVLNTLFTSLNSPGQLRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSL  95

Query  355  TGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            TG++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M
Sbjct  96   TGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTM  155

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN 
Sbjct  156  PNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQ  215

Query  706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            FTG I+VLANLPL+ LNV NNHFTGWIP QL+ IN+LQT GNSW++
Sbjct  216  FTGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQTDGNSWST  261



>ref|XP_011072790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Sesamum indicum]
Length=717

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 174/222 (78%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
              TD +D S L  +++S+NSP  L  WT++GGDPCGESWKG+SCSG++VTEI +SGL LT
Sbjct  40   CKTDSSDVSGLNVMYTSMNSPSVLDGWTSSGGDPCGESWKGISCSGSKVTEINLSGLGLT  99

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS G++L  LKSVT FD+S N+   ++PYQLPPN+Q ++L+GN F G +PYSISQM  L+
Sbjct  100  GSFGYKLSDLKSVTRFDLSKNSFKGNIPYQLPPNLQLIDLSGNEFDGNVPYSISQMTDLK  159

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +++++N+L G+++ MF  L+ L+ +D S NSL+G +PQ+F +L+++  + LQ+N FTG+
Sbjct  160  EMDLNNNKLNGQLSDMFGKLSKLTKMDLSSNSLSGELPQSFKNLSSLTTLRLQDNKFTGS  219

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLANLP+D LNVENN FTGWIP +L+ I  ++TGGNSW+S
Sbjct  220  INVLANLPVDELNVENNKFTGWIPNELKDIKKIKTGGNSWSS  261



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 180/239 (75%), Gaps = 2/239 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
             VALLI  ++   P  +   TD +D S L  + SS+NSP QL++W   GGDPCGE+W+G+
Sbjct  8    VVALLILCIVGLEPRFIHGATDSSDTSALNTMHSSMNSPSQLSQWKPWGGDPCGENWQGI  67

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C  +RVT++++  L L+GS+G+ LD+L +VT FD+S NNLG  LPY LPPNVQ+LNLA 
Sbjct  68   TCLDSRVTQVKLPNLGLSGSLGYMLDKLTAVTEFDLSNNNLGGDLPYNLPPNVQQLNLAN  127

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG   YSIS MA L+YL+++HNQ +G++ V F  LT+L+ LD S NS +G++P +F+
Sbjct  128  NQFTGNGQYSISLMASLKYLSLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSGSLPSSFT  187

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            SL+++K+MYLQNN FTGTID+LA LPL+NLN+ NN FTGWIP  L+GIN L+  GNS+N
Sbjct  188  SLSSIKSMYLQNNQFTGTIDLLAGLPLENLNIANNKFTGWIPDSLKGINLLK-DGNSFN  245



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   265 bits (676),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P      TDP DAS +R LF ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S
Sbjct  20   PNGDAVSTDPNDASAVRFLFQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLS  78

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTGS+ + L  L S+T+ D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS 
Sbjct  79   NLGLTGSLPYGLQVLTSLTSLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISN  138

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN+ HNQLQ  + V F++L+ LSTLD SFNSL G++PQT SSL+++  M LQNN
Sbjct  139  LTALTDLNLGHNQLQQGLAVNFLNLSTLSTLDLSFNSLTGDLPQTMSSLSHITTMNLQNN  198

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGIN  810
             FTG IDVLANLPLDNLNVENN+FTGWIP QL+ IN
Sbjct  199  QFTGPIDVLANLPLDNLNVENNNFTGWIPEQLKNIN  234



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 172/222 (77%), Gaps = 3/222 (1%)
 Frame = +1

Query  187  DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM  366
            DP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L LTG++
Sbjct  1    DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNL  60

Query  367  GFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMAPLE  537
             + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M  L+
Sbjct  61   AYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLK  120

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN FTG 
Sbjct  121  YLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGN  180

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLANLPL+ LNV NNHFTGWIP QL+ INSLQT GNSW++
Sbjct  181  INVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST  222



>ref|XP_011031253.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Populus euphratica]
Length=672

 Score =   263 bits (672),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 176/222 (79%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SG  LT
Sbjct  22   SKTDSEDVSALNVMFTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGFGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLKNDMPYQLPPNAATLDLSNNGFTGSVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN++ N+L G+++ MF  L+ L TLD S NS++GN+PQ+FS+L+++  ++LQ+N FTGT
Sbjct  142  NLNLNQNKLNGQLSDMFQKLSKLKTLDLSHNSISGNLPQSFSALSSLSTLHLQDNEFTGT  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            IDVLA LPL +LN+++N FTGW+P  L GI++L+TGGN+W+S
Sbjct  202  IDVLARLPLKDLNIKDNEFTGWVPDSLNGIDNLETGGNAWSS  243



>ref|XP_007135873.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
 gb|ESW07867.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
Length=689

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 171/235 (73%), Gaps = 0/235 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L +  L  +  S    T   D + L  ++SSLNSP +L+ W ++GGDPCGESWKG+ CSG
Sbjct  10   LWLALLAVSTTSVHCKTSSEDVAALNVMYSSLNSPSKLSGWKSSGGDPCGESWKGIKCSG  69

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +S + L+GS G+QL  L SVT FD+S NNL   +PYQLPP  + ++L+ NGFT
Sbjct  70   SSVTEINLSDMGLSGSTGYQLSSLSSVTYFDLSNNNLKGDIPYQLPPKARHIDLSNNGFT  129

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +P+S+SQM  L  LN+ HNQLQ ++  MF  LT L  LD SFNSL+GN+PQ+  SL N
Sbjct  130  GSIPFSVSQMDELSQLNLGHNQLQNQLGDMFEKLTKLKLLDVSFNSLSGNLPQSLKSLKN  189

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +K ++LQNN FTG+I+VLANLPL+ L+VENN FTGW+P +L+ IN LQTGGNSW+
Sbjct  190  LKKLHLQNNQFTGSINVLANLPLEELHVENNKFTGWVPEELKSINDLQTGGNSWS  244



>ref|XP_010096526.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
 gb|EXB64646.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
Length=689

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 170/246 (69%), Gaps = 27/246 (11%)
 Frame = +1

Query  112  MGLPWAVALLIGF-LLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCG  285
            M   W + +     +L   PS + A TDP DA+ LR +++S+NSPPQLT W ANG DPCG
Sbjct  1    MSEIWRILVFFSVCILGFKPSFINAATDPQDAAALRNMYTSMNSPPQLTGWNANGDDPCG  60

Query  286  ESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ  465
            +SWKGV+CSG RVTEI++S L L+GS G+QL  L SVT  D+S NNLG  +PY +PPN+ 
Sbjct  61   QSWKGVTCSGQRVTEIKLSDLGLSGSFGYQLQSLTSVTILDLSNNNLGGGMPYGIPPNLT  120

Query  466  KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN  645
            +                        LN+SHNQLQ ++  MF  LT+LSTLD SFNS+ GN
Sbjct  121  R------------------------LNISHNQLQNQLDNMFDKLTSLSTLDLSFNSIQGN  156

Query  646  IPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG  825
            +PQ+FSSL++M  MYLQNN FTGTIDVLANLPLD LNVENN FTGW+P QL+GI+ L++ 
Sbjct  157  LPQSFSSLSSMNKMYLQNNQFTGTIDVLANLPLDVLNVENNRFTGWVPEQLKGID-LKSN  215

Query  826  GNSWNS  843
            GNSW S
Sbjct  216  GNSWRS  221



>ref|XP_009398614.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 175/220 (80%), Gaps = 0/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  ++SSL+SP +LT W++ GGDPCG  WKG+ CSG+ VTEI++SGL LTG+
Sbjct  26   TDSSDVSALNVMYSSLSSPSKLTGWSSGGGDPCGNDWKGIKCSGSSVTEIKLSGLGLTGT  85

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L SVT FD+S NNL   +PYQLPPNV  +NLAGNG TGG+PYSISQM+ L+YL
Sbjct  86   MGYQLASLTSVTYFDLSKNNLNGDIPYQLPPNVTHINLAGNGLTGGIPYSISQMSDLKYL  145

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+++NQL G++  MF  L +LS LD SFN  +G++PQ+F SLT++K + L+NN F+G++D
Sbjct  146  NLANNQLSGQLIDMFGKLPSLSLLDLSFNRFSGSLPQSFGSLTHLKTLNLENNQFSGSLD  205

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VL+ L L++LN++NN FTGWIP +L+ I++L+ GGNSW+S
Sbjct  206  VLSTLSLEDLNIQNNKFTGWIPNKLKSIHNLKVGGNSWSS  245



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 185/238 (78%), Gaps = 3/238 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL I  ++   PS +  DT+ +DA  L  LFSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  13   LALFILCIVGLKPSFILGDTNASDAVALNNLFSSMNSPGQLSQWTASGGDPCGQNWKGIT  72

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CS +RV +I++SGL L+GS+GF LD+L SVT  D+S NNLG  LPYQLPPN+++LNLA N
Sbjct  73   CSVSRVIQIKLSGLGLSGSLGFMLDKLTSVTELDLSNNNLGGDLPYQLPPNLERLNLANN  132

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P T +S
Sbjct  133  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNTITGSLPNTMTS  191

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            LT+ K++YLQNN FTGTIDVLA LPL+NLN+ NN FTGWIP  L+GIN LQ  GNS+N
Sbjct  192  LTSAKSIYLQNNQFTGTIDVLATLPLENLNIANNRFTGWIPDSLRGIN-LQKDGNSFN  248



>gb|KGN45936.1| hypothetical protein Csa_6G024930 [Cucumis sativus]
Length=696

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 167/222 (75%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + T   D S L  +FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTEI +S   L+
Sbjct  22   SKTKAPDVSALNVMFSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+QL  L SVT FD+S NNL   +PYQLPPN   ++L+GN FTG +PYSISQM+ LE
Sbjct  82   GSMGYQLSNLASVTYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELE  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            +LN+ HN+L  +++ MF  L  L  LD SFNS++GN+PQ+F  L+++  +++Q+N F+G+
Sbjct  142  FLNLGHNKLSNQLSDMFGKLAKLKRLDLSFNSISGNLPQSFKKLSSLTVLHIQDNKFSGS  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+ LA+LPLD+LNV NN FTGWIP  L+ I++L+T GNSW++
Sbjct  202  INFLADLPLDDLNVANNKFTGWIPESLEDIDNLETVGNSWST  243



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 185/242 (76%), Gaps = 5/242 (2%)
 Frame = +1

Query  118  LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK  297
            LP  +  ++GF    P      TD +D S L  +FSS+ SP QL++WTA+GGDPCG++WK
Sbjct  8    LPLFILCIVGF---EPSLIHGATDASDTSALNTMFSSMGSPGQLSQWTASGGDPCGQNWK  64

Query  298  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL  477
            G++CSG+RVT+I++SGL L+GS+G+ LD+L SVT FD+S+NNLG  LPYQLPPNV++LNL
Sbjct  65   GITCSGSRVTQIKLSGLGLSGSLGYMLDKLTSVTEFDLSSNNLGGDLPYQLPPNVERLNL  124

Query  478  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT  657
            A N FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+L+ LD S NS+ G++P T
Sbjct  125  ANNQFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLTILDLSSNSITGSLPST  183

Query  658  FSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
               LT+ K++YLQNN F+GTIDVLA+L L+NLN+ NN FTGWIP  L+GIN LQ  GNS+
Sbjct  184  CRFLTSAKSIYLQNNQFSGTIDVLASLSLENLNIANNRFTGWIPDSLKGIN-LQKDGNSF  242

Query  838  NS  843
            NS
Sbjct  243  NS  244



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 186/239 (78%), Gaps = 3/239 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WT +GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNTMFSSMNSPGQLSQWTTSGGDPCGQNWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++SGL L+GS+G+ LD+L SVT FD+S NN+G  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLSGLGLSGSLGYMLDKLTSVTEFDLSNNNIGGDLPYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P + SS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFTGSLPNSCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LT+ K++YLQNN F+GTID+LA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN  NS
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENLNIANNRFTGWIPYSLKGIN-LQKDGNLLNS  244



>gb|EEC85048.1| hypothetical protein OsI_32379 [Oryza sativa Indica Group]
Length=677

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 167/222 (75%), Gaps = 2/222 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI++SGL L+
Sbjct  31   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEIKLSGLGLS  90

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  91   GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  150

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN+  NQL G++T MF  L  L+T+D SFNS +GN+P +F  L N+K + +++N F+G 
Sbjct  151  TLNLGKNQLSGQLTDMFSQLPKLTTMDLSFNSFSGNLPPSFQYLKNLKTLDVESNQFSGH  210

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLA L L++LNV+NN FTGWIP +L+ I++L+TGGNSW+S
Sbjct  211  INVLAKLSLEDLNVKNNKFTGWIPSKLKSIDNLETGGNSWSS  252



>ref|XP_006488603.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Citrus 
sinensis]
Length=696

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/236 (53%), Positives = 174/236 (74%), Gaps = 6/236 (3%)
 Frame = +1

Query  136  LLIGFLL----NAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            LL+GF +    +     ++ TD  DAS L  +++SL+SP QL+ W A GGDPCGE WKG+
Sbjct  5    LLVGFFIFYLGSFSCHVLSKTDSQDASALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGI  64

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VTEI++SGL L G +G+QL  LKSV+  D+S NNL +S+PYQLPPN++ L+L+ 
Sbjct  65   TCSGSSVTEIKLSGLGLNGQLGYQLTNLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSE  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N F+G +PYSISQM+ L+YLN+  NQL G+++ MF     L TLD S N L G +P++F+
Sbjct  125  NQFSGTVPYSISQMSELKYLNLGSNQLNGQLSDMFQKNEKLETLDLSKNQLTGELPRSFA  184

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            SL+++K +YLQNN FTG+I+VL  LPLD LNVENN F+GW+P +L+ I   +TGGN
Sbjct  185  SLSSLKELYLQNNQFTGSINVLGKLPLDELNVENNKFSGWVPEELKDI--AKTGGN  238



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 174/223 (78%), Gaps = 2/223 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  DAS L  LFSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG
Sbjct  30   DTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTG  89

Query  361  SMGFQLDQLKSVTTFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            ++G+ ++QL S+T  D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  L
Sbjct  90   TLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTL  149

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
            EYLN++HNQLQG +  MF SL+NL+T+D S NSL G++PQ+FSSLT++ ++YL+NN FTG
Sbjct  150  EYLNLAHNQLQGNLGDMFGSLSNLATIDLSSNSLTGDLPQSFSSLTSLTSLYLENNQFTG  209

Query  715  TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             IDVLA LPL NLNV NN FTGWIP QL+GIN+L T  N W+S
Sbjct  210  HIDVLAGLPLQNLNVANNRFTGWIPNQLKGINNLHTENNQWSS  252



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   261 bits (668),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 174/223 (78%), Gaps = 2/223 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  DAS L  LFSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG
Sbjct  30   DTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTG  89

Query  361  SMGFQLDQLKSVTTFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            ++G+ ++QL S+T  D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  L
Sbjct  90   TLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTL  149

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
            EYLN++HNQLQG +  MF SL+NL+T+D S NSL G++PQ+FSSLT++ ++YL+NN FTG
Sbjct  150  EYLNLAHNQLQGNLGDMFGSLSNLATIDLSSNSLTGDLPQSFSSLTSLTSLYLENNQFTG  209

Query  715  TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             IDVLA LPL NLNV NN FTGWIP QL+GIN+L T  N W+S
Sbjct  210  HIDVLAGLPLQNLNVANNRFTGWIPNQLKGINNLHTENNQWSS  252



>ref|XP_010913801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X3 [Elaeis guineensis]
Length=589

 Score =   259 bits (661),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 168/224 (75%), Gaps = 0/224 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            + A+TD  D S L  LF SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL 
Sbjct  19   SFAETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLG  78

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            LTG +G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            +EY+N+  NQL G++  +F  L+ LS +  SFN L+GN+P +  SL  +K ++LQNN  +
Sbjct  139  IEYINLQRNQLNGQLNDVFGKLSRLSEMYLSFNQLSGNLPPSLRSLKGLKTLHLQNNQLS  198

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            G+I+VLANLPL++LNVENN F GWIP +L+ I++LQ GGNSW+S
Sbjct  199  GSINVLANLPLEDLNVENNQFNGWIPNKLKNIDTLQIGGNSWSS  242



>gb|EEE70214.1| hypothetical protein OsJ_30326 [Oryza sativa Japonica Group]
Length=676

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 166/222 (75%), Gaps = 2/222 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+
Sbjct  29   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLS  88

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  89   GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  148

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN+  NQL G++T MF  L  L+T+D SFNS +GN+P +F  L N+K + +++N F+G 
Sbjct  149  TLNLGKNQLSGQLTDMFSQLPKLTTMDLSFNSFSGNLPPSFQYLKNLKTLDVESNQFSGH  208

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLA L L++LNV+NN FTGWIP +L+ I++L+TGGNSW+S
Sbjct  209  INVLAKLSLEDLNVKNNKFTGWIPSKLKSIDNLETGGNSWSS  250



>ref|XP_006389935.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
 gb|ESQ27221.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
Length=699

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 173/238 (73%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V L I  L      A A T+  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C
Sbjct  6    VRLFIASLAIIVTLAQAKTENQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SGL+L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+L+ N 
Sbjct  66   KGSSVTELQLSGLELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDLSENE  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  LE +N+ HN++ GE++ MF  L+ L TLD SFN L+G +PQ+F++L
Sbjct  126  LDGNVPYSLSQMNRLESINLGHNKINGELSDMFQKLSKLETLDLSFNKLSGKLPQSFANL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            T++K ++LQ N FTG I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN W++
Sbjct  186  TSLKKLHLQENRFTGDINVLRNLAIDDLNVEDNQFEGWIPNELKEIDSLLTGGNDWST  243



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 177/227 (78%), Gaps = 3/227 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP+D +VL  LF+SLNSP QL  W ANGGDPCG+SWKG++CSG+ VT+I +S L 
Sbjct  38   AAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNLG  97

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPP-NVQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ L S+   D+S N+LG  + + Y LP   +++LNLAGN F G LPYSIS 
Sbjct  98   LSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIST  157

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F SL +L+ +D SFNSL G++PQ+F+ L+++K++YLQNN
Sbjct  158  MTNLKYLNLNHNQLQGNISDVFSSLYSLTDVDLSFNSLTGDLPQSFTGLSSLKHLYLQNN  217

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTG I+VLANLPL+ LNV NN FTGWIP QL+ INS+QT GNSW++
Sbjct  218  QFTGYINVLANLPLEALNVANNRFTGWIPSQLKKINSIQTDGNSWST  264



>ref|NP_001063921.1| Os09g0559900 [Oryza sativa Japonica Group]
 dbj|BAF25835.1| Os09g0559900 [Oryza sativa Japonica Group]
Length=685

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 166/222 (75%), Gaps = 2/222 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+
Sbjct  53   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLS  112

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  113  GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  172

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN+  NQL G++T MF  L  L+T+D SFNS +GN+P +F  L N+K + +++N F+G 
Sbjct  173  TLNLGKNQLSGQLTDMFSQLPKLTTMDLSFNSFSGNLPPSFQYLKNLKTLDVESNQFSGH  232

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLA L L++LNV+NN FTGWIP +L+ I++L+TGGNSW+S
Sbjct  233  INVLAKLSLEDLNVKNNKFTGWIPSKLKSIDNLETGGNSWSS  274



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 186/236 (79%), Gaps = 4/236 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGV  303
            +AL I  ++   PS + A TD +D S L  +FS++NSP QL++WT++ GGDPCG++WKGV
Sbjct  9    LALFILCIVGLKPSFILAATDASDTSALNYMFSAMNSPGQLSQWTSSSGGDPCGQNWKGV  68

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CS +RVT+I++SGL L+GS+G  LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA 
Sbjct  69   TCSDSRVTQIKLSGLGLSGSLGSALDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLAS  128

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG  PYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS LD S N+L G++P + S
Sbjct  129  NQFTGSAPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLSILDLSSNTLTGSLPNSMS  187

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            SLT+ K++YLQNN F+GTIDVLA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN
Sbjct  188  SLTSAKSIYLQNNQFSGTIDVLATLPLENLNIANNQFTGWIPDSLKGIN-LQKDGN  242



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 159/214 (74%), Gaps = 4/214 (2%)
 Frame = +1

Query  202  SVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLD  381
            S L  LF S+NSP QL  W  NG DPCG+SW G++CSGNR+TEI++ G QLTG++GFQL 
Sbjct  2    SALMALFQSMNSPSQLN-W--NGNDPCGQSWTGITCSGNRITEIKLPGRQLTGTLGFQLQ  58

Query  382  QLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ  561
             L SVT  D+S NNL  +LPYQ PPN+Q LNLA N F GG+PYS S    L  LN  HNQ
Sbjct  59   SLSSVTNLDLSNNNLAGTLPYQFPPNLQHLNLANNNFNGGIPYSFSDTPSLISLNFGHNQ  118

Query  562  LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP  741
             Q  + + F  LT+L+T D SFNSL G++PQT +SL+++  M LQNN FTGTID+LA+LP
Sbjct  119  FQQALNLNFQKLTSLTTFDVSFNSLTGDLPQTMNSLSSISTMNLQNNQFTGTIDILADLP  178

Query  742  LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LDNLN+ENNHFTGWIP QL+ IN LQ  GNSW+S
Sbjct  179  LDNLNIENNHFTGWIPEQLKNIN-LQKNGNSWSS  211



>ref|XP_010913799.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Elaeis guineensis]
Length=685

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 168/224 (75%), Gaps = 0/224 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            + A+TD  D S L  LF SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL 
Sbjct  19   SFAETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLG  78

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            LTG +G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            +EY+N+  NQL G++  +F  L+ LS +  SFN L+GN+P +  SL  +K ++LQNN  +
Sbjct  139  IEYINLQRNQLNGQLNDVFGKLSRLSEMYLSFNQLSGNLPPSLRSLKGLKTLHLQNNQLS  198

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            G+I+VLANLPL++LNVENN F GWIP +L+ I++LQ GGNSW+S
Sbjct  199  GSINVLANLPLEDLNVENNQFNGWIPNKLKNIDTLQIGGNSWSS  242



>ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Cucumis sativus]
Length=662

 Score =   258 bits (660),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 162/209 (78%), Gaps = 0/209 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTEI +S   L+GSMG+QL  L SV
Sbjct  1    MFSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLSGSMGYQLSNLASV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNL   +PYQLPPN   ++L+GN FTG +PYSISQM+ LE+LN+ HN+L  ++
Sbjct  61   TYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELEFLNLGHNKLSNQL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN  756
            + MF  L  L  LD SFNS++GN+PQ+F  L+++  +++Q+N F+G+I+ LA+LPLD+LN
Sbjct  121  SDMFGKLAKLKRLDLSFNSISGNLPQSFKKLSSLTVLHIQDNKFSGSINFLADLPLDDLN  180

Query  757  VENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            V NN FTGWIP  L+ I++L+T GNSW++
Sbjct  181  VANNKFTGWIPESLEDIDNLETVGNSWST  209



>ref|XP_007023606.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
 gb|EOY26228.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
Length=818

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 169/222 (76%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+
Sbjct  228  SKTDSPDVSALNVMFKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELS  287

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G +G+QL  L SVTTFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  288  GQLGYQLSSLTSVTTFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+SHNQL G+++ MF  L  L + D SFN L+  +P +F++L ++  ++LQ+N FTG+
Sbjct  348  DINLSHNQLNGQLSDMFGKLQKLKSFDVSFNQLSDKLPNSFANLASINTLHLQDNQFTGS  407

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLA+LPL++LNVENN FTGWIP +L+ I++L+TGGNSW+S
Sbjct  408  INVLADLPLNDLNVENNKFTGWIPNELKDIDNLETGGNSWSS  449



>ref|XP_010537758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010537760.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X3 [Tarenaya 
hassleriana]
Length=700

 Score =   259 bits (661),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 174/238 (73%), Gaps = 7/238 (3%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            +A+ + F+        A TD  + S L  +F+SLNSP +L  W ++GGDPC ++W G+ C
Sbjct  15   IAVFVAFVR-------AKTDSQEVSALNVMFTSLNSPSKLKGWKSSGGDPCNDAWDGIKC  67

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             GN+V EIQ+S LQL+GS+G+QL  LKS+TT D+S N L  ++PYQLPPN+  L+ + N 
Sbjct  68   DGNKVIEIQLSELQLSGSLGYQLSNLKSLTTLDLSKNKLSGNMPYQLPPNIVHLDFSENE  127

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  L+ +N+ HN+L+G++  MF  L+ L +LD SFN L+GN+PQ+F++L
Sbjct  128  IDGNVPYSLSQMNHLQSVNLGHNKLEGDLQDMFQKLSKLESLDLSFNQLSGNLPQSFANL  187

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            T++K ++LQ N F G+I++L +LPLD+LNVE+N F+GWIP +L+ I+SL TGGN W++
Sbjct  188  TSLKKLHLQENKFKGSINMLRDLPLDDLNVEDNQFSGWIPNELKDIDSLLTGGNDWSA  245



>ref|XP_008653346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Zea mays]
Length=687

 Score =   258 bits (660),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 164/209 (78%), Gaps = 2/209 (1%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
             ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I++SG++L G++G+ ++QL ++
Sbjct  7    FYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAIKLSGMRLNGTLGYNMNQLTAL  66

Query  397  TTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE  573
               D+S NNLG S +PY LPPN+Q LNLA N FTG +PYSISQM  L  LN+ HNQL   
Sbjct  67   VQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTVPYSISQMVALRDLNLDHNQL-SN  125

Query  574  VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  MF  LTNL+TLD S+N+ +G+IP +F+SLT++K +YLQNN F GTIDVL +LPL +L
Sbjct  126  INDMFSQLTNLTTLDLSYNTFSGDIPHSFNSLTSLKTLYLQNNKFNGTIDVLTDLPLTDL  185

Query  754  NVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            NVENN  TGWIP +L+GIN+LQT GNS+N
Sbjct  186  NVENNQLTGWIPDKLKGINNLQTSGNSFN  214



>ref|NP_001064502.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|AAO72637.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABB47491.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26416.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|EEE50892.1| hypothetical protein OsJ_31383 [Oryza sativa Japonica Group]
Length=719

 Score =   259 bits (662),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 173/227 (76%), Gaps = 3/227 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
              A TD  D +VL  LF+SLNSP QL  W  NGGDPCG SW+G++CSG+ VT I++  L 
Sbjct  25   VAATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGASWQGITCSGSSVTAIKLPSLG  84

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ ++S+   D+S NNLG   ++ Y LP   +++LNLAGN F G +PYSIS 
Sbjct  85   LSGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKLERLNLAGNQFAGNVPYSIST  144

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG +T +F +L +LSTLD S NSL G++PQ+F+SL+++K +YLQNN
Sbjct  145  MPKLKYLNLNHNQLQGNMTDVFSNLPSLSTLDLSLNSLTGDLPQSFTSLSSLKTLYLQNN  204

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTG+I+VLANLPLDNLNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct  205  QFTGSINVLANLPLDNLNVGNNRFTGWIPNELKKINSLQTDGNSWST  251



>ref|XP_007023605.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
 gb|EOY26227.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
Length=908

 Score =   262 bits (669),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 169/222 (76%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+
Sbjct  228  SKTDSPDVSALNVMFKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELS  287

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G +G+QL  L SVTTFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  288  GQLGYQLSSLTSVTTFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+SHNQL G+++ MF  L  L + D SFN L+  +P +F++L ++  ++LQ+N FTG+
Sbjct  348  DINLSHNQLNGQLSDMFGKLQKLKSFDVSFNQLSDKLPNSFANLASINTLHLQDNQFTGS  407

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VLA+LPL++LNVENN FTGWIP +L+ I++L+TGGNSW+S
Sbjct  408  INVLADLPLNDLNVENNKFTGWIPNELKDIDNLETGGNSWSS  449



>tpg|DAA46921.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=348

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 171/227 (75%), Gaps = 3/227 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
              A TD  D + L  LF+S+NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L 
Sbjct  26   VAAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLG  85

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLA N F+G +PYSIS 
Sbjct  86   LSGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSIST  145

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  ++YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN
Sbjct  146  MPNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNN  205

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
              TG+I+VLANLPLD+LNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct  206  QLTGSINVLANLPLDDLNVANNRFTGWIPEELKKINSLQTDGNSWST  252



>ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=722

 Score =   259 bits (662),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 167/228 (73%), Gaps = 7/228 (3%)
 Frame = +1

Query  169  SAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGL  348
            S  A TDPT  + L+ +F S+NSP QL  W  N  DPCG+SWKG++CS N VT+I +S L
Sbjct  25   STAATTDPTHVAALKAMFQSMNSPSQL-GWPTNADDPCGQSWKGITCSANSVTQIVLSNL  83

Query  349  QLTGSM---GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  519
             LTG++   GFQ   L S+T  DIS NNL   +PYQLPPNVQ+LN A N  TG +PYSIS
Sbjct  84   ALTGTLLPYGFQ--DLTSLTNLDISNNNLFGPIPYQLPPNVQRLNFAHNNLTGAVPYSIS  141

Query  520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN  699
             +  L  LN+SHNQLQ  + V F  L+ LS LD SFNSLAG++PQT SSL+ +  MYLQN
Sbjct  142  NLTSLTDLNLSHNQLQQALNVNFQYLSTLSKLDLSFNSLAGDLPQTMSSLSGITTMYLQN  201

Query  700  NVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            N FTGTID+LANLPL +LNVENN+FTGWIP +L+ I+ +Q+GGN+W+S
Sbjct  202  NQFTGTIDILANLPLHSLNVENNNFTGWIPERLKNID-IQSGGNAWSS  248



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 186/241 (77%), Gaps = 6/241 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGE  288
            +GL   +  ++G     P   +A TD +D S L  +FS++NSP QL++WT++ GGDPCG+
Sbjct  7    VGLALFMLCIVGL---KPSFILAATDASDTSALNYMFSAMNSPGQLSQWTSSSGGDPCGQ  63

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +WKGV+CS +RVT+I++SGL L+GS+G  LD+L SVT FD+S NNLG  LPYQLPPN+++
Sbjct  64   NWKGVTCSDSRVTQIKLSGLGLSGSLGSALDKLTSVTEFDLSNNNLGGDLPYQLPPNLER  123

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG  PYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS LD S N+L G++
Sbjct  124  LNLASNQFTGSAPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLSILDLSSNTLTGSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P + SSLT+ K++YLQNN F+GTIDVLA LPL+NLN+ NN FTGWIP  L+GIN LQ  G
Sbjct  183  PNSMSSLTSAKSIYLQNNQFSGTIDVLATLPLENLNIANNQFTGWIPDSLKGIN-LQKDG  241

Query  829  N  831
            N
Sbjct  242  N  242



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 171/221 (77%), Gaps = 5/221 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  23   DTDPNDVASLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  79

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ + SVT  D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+S+   L  
Sbjct  80   SLGYQLEPMSSVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLIV  139

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+ HNQLQ  + V F  L++LSTLD SFNSL G++PQT SSL++++ MYLQNN FTGTI
Sbjct  140  LNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFTGTI  199

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLANLPLD LNV NNHFTGWIP QL+ I  +Q  GN+W+S
Sbjct  200  DVLANLPLDTLNVGNNHFTGWIPEQLKNI--IQKDGNAWSS  238



>ref|XP_003558655.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brachypodium 
distachyon]
Length=720

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 186/251 (74%), Gaps = 7/251 (3%)
 Frame = +1

Query  109  LMGLPWAVALLIGFLLNAPPSAV---ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            ++  PW + LL+      P   +   ADT+  D +VL  LF+SLNSP QL  W A+GGDP
Sbjct  10   MLDAPW-LPLLLLVCCAWPQKQILVSADTNANDVTVLNTLFTSLNSPGQLKGWQASGGDP  68

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP  453
            CG+SW+G++CSG+ VT I++  L L+G++ + ++ + SV   D+S NNLG   ++ Y LP
Sbjct  69   CGQSWQGITCSGSSVTAIKLPSLGLSGNLAYNMNTMGSVVEIDMSQNNLGGGQAIQYNLP  128

Query  454  PN-VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN  630
             + +++LNLAGN FTG LPYSI  M+ L+YLN++HNQLQG++T +F +L +L+T+D SFN
Sbjct  129  TDKLERLNLAGNQFTGNLPYSIFSMSKLKYLNLNHNQLQGKMTDVFSNLDSLTTVDLSFN  188

Query  631  SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGIN  810
            SL G++P +F++L+++K +YLQNN F+G+I+VLANLPL +LN+ NN FTGWIP QL+ IN
Sbjct  189  SLTGDLPDSFTALSSLKTLYLQNNQFSGSINVLANLPLTDLNIANNRFTGWIPSQLKKIN  248

Query  811  SLQTGGNSWNS  843
            SLQT GNSW S
Sbjct  249  SLQTDGNSWTS  259



>ref|XP_009386772.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 173/235 (74%), Gaps = 3/235 (1%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVAD-TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            +L+  +L   P  V   TD TDAS L  LF+SLNSP QLT W  +GGDPCG+SW GV+C+
Sbjct  14   VLLACILAGDPGGVGGITDETDASSLNILFTSLNSPSQLTGWVPSGGDPCGDSWLGVTCT  73

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPNVQKLNLAGN  486
            G+ VT I++SGL+L G+ G+ L  + S+   D+S NNLG  + +PY LPPN+Q LN  GN
Sbjct  74   GSAVTAIKLSGLELAGTPGYNLASMSSLAELDMSNNNLGGGDPIPYNLPPNLQSLNFGGN  133

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             F   +PYSI QM  L+YLN++HNQLQG ++ MF SL+NL+T+D SFN L G +PQ+F++
Sbjct  134  QFGANIPYSIFQMVTLKYLNLAHNQLQGNLSDMFGSLSNLTTMDLSFNQLTGELPQSFNN  193

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            L+++  +YL+NN FTG IDVLANLPL +LNV NN FTGWIP +L+ IN+L+T GN
Sbjct  194  LSSLTTLYLENNQFTGQIDVLANLPLQDLNVANNLFTGWIPDRLKKINNLRTDGN  248



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 164/209 (78%), Gaps = 1/209 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +FSSLNSP QLT WTAN GDPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+
Sbjct  1    MFSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSL  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
               D+S NNL   +PY +P N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++
Sbjct  61   KELDLSHNNLAGGIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN  756
              MF  L++LSTLD SFNSL   +PQ+F +LT+MK+MYLQNN FTGTIDVLANLPLDNL 
Sbjct  121  NDMFGPLSSLSTLDLSFNSLTDALPQSFKNLTSMKSMYLQNNQFTGTIDVLANLPLDNLY  180

Query  757  VENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            V NNHFTGWIP QL+ I+ LQ  GNSW+S
Sbjct  181  VSNNHFTGWIPDQLKSID-LQLDGNSWSS  208



>gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula]
Length=723

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 168/227 (74%), Gaps = 5/227 (2%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG---DPCGESWKGVSCSGNRVTEIQIS  342
            A A TDPTD + ++ +F S NS PQL  W ANG    DPCG+SWKG++CS NRVT+I +S
Sbjct  22   ATAATDPTDVASVKAIFQSANSAPQL-GWPANGDTDDDPCGQSWKGITCSDNRVTQINLS  80

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTG++ + L    S+T  D+S NNL  ++PYQLPPN+ +LN A N  TG LPYSIS 
Sbjct  81   NLALTGTLPYGLQGFTSLTILDMSNNNLVGTIPYQLPPNLHRLNFANNNLTGPLPYSISN  140

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN++HNQLQ  + V F +L+ LS LD SFNSL G++PQT SSLT +  MYLQNN
Sbjct  141  LTSLTDLNLNHNQLQQALNVNFQNLSTLSKLDLSFNSLTGDLPQTMSSLTGITTMYLQNN  200

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTG ID+LA+LPL++LNVENN+FTGWIP QL+ I+ LQTGGN+W+S
Sbjct  201  QFTGAIDILADLPLNSLNVENNNFTGWIPEQLKNID-LQTGGNAWSS  246



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 175/235 (74%), Gaps = 5/235 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF    P  A   TD  DAS L G+FSSLNSP QLT WT++ GDPCG+SWKGV+CSG 
Sbjct  18   ILGF---KPRCANGATDQGDASALGGMFSSLNSPQQLTGWTSSNGDPCGQSWKGVTCSGQ  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++S L L+GS+ + L  L S+   D+S NN+   +PY LPPN+Q+LNLA N FTG
Sbjct  75   RVTEIKLSNLGLSGSI-YNLQSLTSLKELDMSQNNIAGEIPYNLPPNLQQLNLAFNQFTG  133

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
             +PY    M  L+YLN+ HNQLQ ++  MF  L++LSTLD SFN+L G++P++F +L+++
Sbjct  134  SVPYVFHDMPSLQYLNLGHNQLQNQLNDMFAPLSSLSTLDLSFNALTGDLPESFKNLSSV  193

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             +MYLQNN FTGTIDVLANLPLDNL V NN FTGWIP QL+ IN LQ  GNSW+S
Sbjct  194  NSMYLQNNQFTGTIDVLANLPLDNLYVSNNRFTGWIPDQLKSIN-LQKDGNSWSS  247



>ref|NP_178019.2| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
 sp|Q6R2K1.1|SRF5_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 5; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF5; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99873.1| strubbelig receptor family 5 [Arabidopsis thaliana]
 gb|ACN59278.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36188.1| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
Length=699

 Score =   256 bits (653),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 164/222 (74%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W ANGGDPC +SW+GV C G+ VTE+Q+SG +L 
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELG  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  82   GSRGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMKNLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L GE+  MF  L+ L TLDFS N L+G +PQ+F++LT++K ++LQ+N FTG 
Sbjct  142  SINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLTSLKKLHLQDNRFTGD  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN W++
Sbjct  202  INVLRNLAIDDLNVEDNQFEGWIPNELKDIDSLLTGGNDWST  243



>ref|XP_004983096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Setaria 
italica]
Length=719

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 173/225 (77%), Gaps = 3/225 (1%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  D + L  LF+S++SP QL  W A+GGDPC ESW+G++CSG+ VT I++ GL L+
Sbjct  28   AATDANDVTALNTLFTSMSSPGQLQGWKASGGDPCSESWQGITCSGSSVTAIKLPGLGLS  87

Query  358  GSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMA  528
            G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLAGN F+G +PYSIS M 
Sbjct  88   GTLAYNMNTMDSLVELDLSQNNLGGGQQIPYNLPNKKLERLNLAGNQFSGAVPYSISTMP  147

Query  529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF  708
             L+YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN  
Sbjct  148  KLQYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQL  207

Query  709  TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            TG+I+VLANLPLD+LNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct  208  TGSINVLANLPLDDLNVANNRFTGWIPNELKKINSLQTDGNSWST  252



>gb|EPS68087.1| hypothetical protein M569_06686, partial [Genlisea aurea]
Length=632

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = +1

Query  199  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  378
             S L  +F+++NSP QL  W ++GGDPC +SWKG+SCSG++VTEI +SGL LTGS+G+ L
Sbjct  1    VSALNVMFATMNSPSQLDGWKSSGGDPCHDSWKGISCSGSKVTEIDLSGLGLTGSIGYML  60

Query  379  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
              LKSV  FD+S N   +S+PYQLPPNVQ+++L+GN F G +PYSIS+M+ L+ +  S+N
Sbjct  61   SDLKSVVNFDVSKNKFKSSIPYQLPPNVQRIDLSGNEFQGTVPYSISEMSHLKQIYFSNN  120

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            +L G++  MFV LT L+ LD SFN L+G++P +F +L+++  + LQNN F+GTIDVL NL
Sbjct  121  KLNGQLNDMFVKLTKLTDLDLSFNLLSGDLPHSFMNLSSLSMLNLQNNKFSGTIDVLTNL  180

Query  739  PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            PLD+LN+ENN+FTG +P QL  I  ++ GGN+W+
Sbjct  181  PLDDLNIENNNFTGSVPGQLMKIKKIKVGGNNWS  214



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 172/240 (72%), Gaps = 2/240 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A   ++ FL        A+TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++
Sbjct  4    ATGAVMLFLAATLSGVSANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGIT  63

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I++SG+ + G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA 
Sbjct  64   CSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAE  123

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L  LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+
Sbjct  124  NNFTGSIPYSISQMIALRILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFN  182

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            SLTN++ + LQNN F GTIDVLA+LPL +LNV NN FTGWIP +L+ I +LQT GNS+ S
Sbjct  183  SLTNLRKLNLQNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGS  242



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 167/240 (70%), Gaps = 5/240 (2%)
 Frame = +1

Query  136  LLIGFLLNAPPSAV-----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            LL GF+L A   AV       TD +D   L+ L++S+NSP QLT W  +GGDPCGESWKG
Sbjct  15   LLTGFVLIASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWKG  74

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V+C G+ V  I++SGL L+G+MG+ L  L S+  FD+S NN  ++LPYQLPPN+  LNLA
Sbjct  75   VTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNLA  134

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N FTG LPYSI+ M  L YLNVSHN L   V  MF +L  L+TLD S N+ +G+IP +F
Sbjct  135  RNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDMFANLVGLATLDLSLNNFSGDIPNSF  194

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +SLTN+ ++Y+QNN  TG+++VL  LPL  LNV NNHF+GWIP +L  I++    GN++ 
Sbjct  195  TSLTNLSSLYVQNNQLTGSLNVLTGLPLTTLNVANNHFSGWIPHELSSIHTFIYDGNAFK  254



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 167/223 (75%), Gaps = 2/223 (1%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A+TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + 
Sbjct  33   ANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGIN  92

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L
Sbjct  93   GTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIAL  152

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
              LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+SLTN++ + LQNN F G
Sbjct  153  RILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKLNLQNNGFNG  211

Query  715  TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            TIDVLA+LPL +LNV NN FTGWIP +L+ I +LQT GNS+ S
Sbjct  212  TIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGS  254



>ref|XP_002465165.1| hypothetical protein SORBIDRAFT_01g033190 [Sorghum bicolor]
 gb|EER92163.1| hypothetical protein SORBIDRAFT_01g033190 [Sorghum bicolor]
Length=718

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 169/222 (76%), Gaps = 2/222 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADT+  D + L   ++++NSP QLT W    GDPCG+SW GV+CSG+RVT I++ G+ L
Sbjct  22   TADTNSDDVTALNTFYTTVNSPSQLTNWAPQNGDPCGQSWLGVTCSGSRVTTIKVPGMGL  81

Query  355  TGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
             G++G+ ++ L  ++  D+S NNLG S +PY LPPN+++LNL  N F G LPYSISQMA 
Sbjct  82   KGTLGYNMNLLTELSELDVSNNNLGGSDIPYNLPPNLERLNLEKNNFIGTLPYSISQMAA  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN+ HNQL  ++ VMF  LTNL+TLDFS+NS +GN+P++F+SLT++  +YLQ+N FT
Sbjct  142  LKYLNLGHNQL-SDINVMFDQLTNLTTLDFSYNSFSGNLPESFNSLTSLSTLYLQDNQFT  200

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            GTIDVL +LPL +LNV NN F+G IP +L+ I++LQT GNS+
Sbjct  201  GTIDVLTDLPLTDLNVANNQFSGSIPDKLKSISNLQTSGNSF  242



>gb|KFK42269.1| hypothetical protein AALP_AA2G233600 [Arabis alpina]
Length=698

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 176/248 (71%), Gaps = 6/248 (2%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            M++L+ L  A   +I  L+ A       TD  + S L  +F+SLNSP +L  W +NGGDP
Sbjct  2    MQKLVHLSIASFAIIVTLVQA------KTDSQEVSALNVMFTSLNSPSKLKGWKSNGGDP  55

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            CG+SW+GV C G+ V+E+Q+SG +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPP 
Sbjct  56   CGDSWEGVKCKGSSVSELQLSGFELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPK  115

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            +  L+ + N   G +PYS+SQM  L+ +N+  N+L G++  MF  ++ L TLD SFN L+
Sbjct  116  LANLDFSENEIDGNVPYSLSQMNHLQSVNLGQNKLNGDLPDMFQKMSKLETLDLSFNKLS  175

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ  819
            G +PQ+F++LT++K ++LQ N FTG I+VL NL LD+LNVE+N F GWIP +L+ I+SL 
Sbjct  176  GKLPQSFANLTSLKKLHLQENRFTGDINVLRNLALDDLNVEDNQFEGWIPNELKEIDSLL  235

Query  820  TGGNSWNS  843
            TGGN W+S
Sbjct  236  TGGNDWSS  243



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   259 bits (662),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 179/244 (73%), Gaps = 4/244 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G+   V LL  FL  A   A A+TD  D + L   ++++NSPPQL  W +   DPCG+S
Sbjct  14   VGIGAGVVLL--FLATASLGANANTDSNDVTALNVFYTTMNSPPQLKNWVSQNADPCGQS  71

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQK  468
            W G++C G+RVT I++SG+ L G++G+ ++ L ++   D+S NNLG S +PY LPPN++K
Sbjct  72   WNGITCLGSRVTTIKLSGMGLNGTLGYNMNLLTALVQLDMSNNNLGGSDIPYNLPPNLEK  131

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLAGN FTG  PYSISQM  L+ LN++HNQ+   ++ MF  LTNL+T+D S+N+ + NI
Sbjct  132  LNLAGNHFTGTTPYSISQMFALKDLNLAHNQI-STISDMFNQLTNLTTMDLSYNAFSANI  190

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            PQ+F+SLT++  +YLQNN F+GTIDVLANLPL +LN+ NN FTGW+P +L+ I +LQT G
Sbjct  191  PQSFNSLTSLTTLYLQNNQFSGTIDVLANLPLTDLNIANNRFTGWVPDKLKKIRTLQTAG  250

Query  829  NSWN  840
            NS++
Sbjct  251  NSFS  254



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 168/221 (76%), Gaps = 5/221 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  24   DTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ L SVT  D+S NN+G ++PYQLPPN+Q LNLA N F G +PYS+S+   L  
Sbjct  81   SLGYQLEPLSSVTNLDLSNNNIGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLVI  140

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+ HNQLQ  + V F  L++LSTLD SFNSL G++PQT SSL++++ MYLQNN FTGTI
Sbjct  141  LNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFTGTI  200

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLANLPL  LNV NNHFTGWIP QL  I  +Q  GN W+S
Sbjct  201  DVLANLPLGTLNVGNNHFTGWIPEQLNNI--IQKDGNEWSS  239



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 171/240 (71%), Gaps = 2/240 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A   ++ FL        A TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++
Sbjct  4    ATGAVMLFLAATLSGVSAHTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGIT  63

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I++SG+ + G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA 
Sbjct  64   CSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAE  123

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L  LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+
Sbjct  124  NNFTGSIPYSISQMIALRILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFN  182

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            SLTN++ + LQNN F GTIDVLA+LPL +LNV NN FTGWIP +L+ I +LQT GNS+ S
Sbjct  183  SLTNLRKLNLQNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGS  242



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   254 bits (648),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 170/253 (67%), Gaps = 1/253 (0%)
 Frame = +1

Query  82   ERASLKMRELMGLPWAVALL-IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW  258
             R SL       +  A+AL  +  ++  PP   A TDP D   L+ L+ SLNSPP+LT W
Sbjct  5    RRTSLSTSRFFTVSSAIALATLTTVIFTPPLVRATTDPLDVQSLQVLYVSLNSPPRLTGW  64

Query  259  TANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL  438
             + GGDPCGESWKGV C G+ V  IQ+ GL L+G++G+ L  L S+ T D+S NN+ +S+
Sbjct  65   KSGGGDPCGESWKGVICQGSAVVAIQLPGLGLSGTLGYMLSSLFSLRTLDLSDNNIHDSI  124

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PYQLPPN+  LNLA N  +G LPYSIS M  L YLN+SHN +   +  +F +L  LS LD
Sbjct  125  PYQLPPNLTSLNLASNNLSGNLPYSISSMVSLNYLNLSHNSIFQSIGDIFANLQGLSILD  184

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL  798
             SFN+ +G++P +F SL+N+  +YLQ+N  TG++++LA+LPLDNLN+ NNHFTGW+P + 
Sbjct  185  LSFNNFSGDLPNSFGSLSNLSTLYLQSNQLTGSVNILADLPLDNLNIANNHFTGWVPREF  244

Query  799  QGINSLQTGGNSW  837
              I +    GNS+
Sbjct  245  SSIPNFIYDGNSF  257



>ref|XP_006657962.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=721

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 167/223 (75%), Gaps = 2/223 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A+TD  D + L  L++S+NSP  LT W +  GDPCG+SW G++CS +RVT I++SG++
Sbjct  20   ASANTDSDDVNALNVLYTSMNSPALLTNWVSQNGDPCGQSWLGITCSNSRVTTIKLSGMR  79

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  528
            L G++G+ ++ L ++   D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM 
Sbjct  80   LNGTLGYNMNLLTALVELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMI  139

Query  529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF  708
             L  LN+ HN L      MF  LTNL+TLD S+NSL+GNIPQ+F+SLT+++ +YLQNN F
Sbjct  140  ALRILNLGHNHLT-TTNDMFNQLTNLTTLDLSYNSLSGNIPQSFNSLTSLRKLYLQNNRF  198

Query  709  TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
             GTIDVLA+LPL +LNV NN FTGWIP +L+ I +LQT GNS+
Sbjct  199  NGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSF  241



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 182/241 (76%), Gaps = 2/241 (1%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            W + +L   +L   P ++ A TDP D S L+ L+SSLNSP QLT+W+A+G DPCG+SWKG
Sbjct  7    WVLLVLSICILGWSPGSINAATDPADVSALKTLYSSLNSPSQLTQWSASGDDPCGQSWKG  66

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V CSG+RVTEI +S LQL+GS+   L  L ++T  D+S NNL  S+PY LPPN+ +LNLA
Sbjct  67   VKCSGSRVTEIDVSNLQLSGSLWSSLQSLTALTNLDMSHNNLAGSIPYSLPPNMTRLNLA  126

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N F  G+PYSIS +  LEYLN+SHNQLQ +V  +F  L++LSTLD SFNSL+GN+P++ 
Sbjct  127  ANNFNQGIPYSISLITSLEYLNISHNQLQNQVDDIFGKLSSLSTLDLSFNSLSGNLPESL  186

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            SSL++M  M LQNN  TG I+VLANLPL+NLN++NN FTGWIP QL+ IN L+  GN+WN
Sbjct  187  SSLSSMTTMNLQNNQLTGPINVLANLPLENLNIQNNQFTGWIPEQLKNIN-LEKDGNTWN  245

Query  841  S  843
            S
Sbjct  246  S  246



>ref|XP_008659003.1| PREDICTED: leucine-rich repeat transmembrane protein kinase 2 
isoform X1 [Zea mays]
Length=684

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 166/216 (77%), Gaps = 3/216 (1%)
 Frame = +1

Query  205  VLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQ  384
            VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L LTG++ + ++ 
Sbjct  5    VLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNLSLTGNLAYNMNN  64

Query  385  LKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH  555
            L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M  L+YLN++H
Sbjct  65   LGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNH  124

Query  556  NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN  735
            NQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN FTG I+VLAN
Sbjct  125  NQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQFTGYINVLAN  184

Query  736  LPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            LPL+ LNV NNHFTGWIP QL+ IN+LQT GNSW++
Sbjct  185  LPLETLNVGNNHFTGWIPSQLKKINNLQTDGNSWST  220



>tpg|DAA46922.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=632

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 171/226 (76%), Gaps = 3/226 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             A TD  D + L  LF+S+NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L L
Sbjct  27   AAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLGL  86

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLA N F+G +PYSIS M
Sbjct  87   SGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSISTM  146

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              ++YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN 
Sbjct  147  PNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQ  206

Query  706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             TG+I+VLANLPLD+LNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct  207  LTGSINVLANLPLDDLNVANNRFTGWIPEELKKINSLQTDGNSWST  252



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  23   DTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  79

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ L SVT  D+S NN+G ++PYQ PPN+Q LNLA N F G +PYS+S+   L  
Sbjct  80   SLGYQLEPLSSVTNLDLSNNNIGGTIPYQFPPNLQYLNLANNNFNGAIPYSLSEKTSLVI  139

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+ HNQLQ  + V F  L++LSTLD SFNSL G++PQT SSL++++ MYLQNN FTGTI
Sbjct  140  LNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFTGTI  199

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            DVLANLPL  LNV NNHFTGWIP QL  I  +Q  GN W+S
Sbjct  200  DVLANLPLGTLNVGNNHFTGWIPEQLNNI--IQKDGNEWSS  238



>emb|CDX88495.1| BnaC06g39390D [Brassica napus]
Length=692

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 172/239 (72%), Gaps = 1/239 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            + LLI  L      A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C
Sbjct  2    MRLLIASLAIIVTLAHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKC  61

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SG +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N 
Sbjct  62   KGSSVTELQLSGYELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENE  121

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  L+ +N+  N+L GE++ MF  L+ L T+DFS N L+G +PQ+F++L
Sbjct  122  LDGNVPYSLSQMNKLKSINLGQNKLDGELSDMFQKLSKLETVDFSLNKLSGKLPQSFANL  181

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT-GGNSWNS  843
            T++K ++LQ N F G I+VL NLP+D+LN+E+N F GWIP +L+ I+SL T GGN W++
Sbjct  182  TSLKKLHLQENRFKGDINVLRNLPIDDLNIEDNQFEGWIPNELKEIDSLLTGGGNDWST  240



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 181/232 (78%), Gaps = 6/232 (3%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSG  315
            ++GF    P   +A T+ +D S L  +FS++NSP QL+ WT++ GGDPC ++WKG++C G
Sbjct  4    IVGF---KPSLILAATNASDTSALNFMFSAMNSPGQLSHWTSSSGGDPCEQNWKGITCFG  60

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVT+I++SGL L+GS+G+ LD L SVT  D+S NNLG  LPYQLPPN+++LNLA N FT
Sbjct  61   SRVTQIKLSGLGLSGSLGYALDNLTSVTELDLSNNNLGGDLPYQLPPNLERLNLASNQFT  120

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS LD S N++ G++P + SSLT+
Sbjct  121  GSLPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLSILDLSSNTITGSLPNSMSSLTS  179

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             K++YLQNN F+GTIDVLA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN
Sbjct  180  AKSIYLQNNQFSGTIDVLATLPLENLNIANNQFTGWIPDSLKGIN-LQKDGN  230



>emb|CDX87418.1| BnaA07g34550D [Brassica napus]
Length=692

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 167/225 (74%), Gaps = 1/225 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +
Sbjct  16   AHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYE  75

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  
Sbjct  76   LSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNK  135

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+ +N+  N+L GE++ MF  L+ L T+DFS N L+G +P +F++LT++K ++LQ N FT
Sbjct  136  LKSINLGQNKLDGELSDMFQKLSKLETVDFSLNKLSGKLPHSFANLTSLKKLHLQENRFT  195

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT-GGNSWNS  843
            G I+VL NLP+D+LN+E+N F GWIP +L+ I+SL T GGN W++
Sbjct  196  GDINVLRNLPIDDLNIEDNQFEGWIPNELKEIDSLLTGGGNDWST  240



>ref|XP_009106613.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Brassica rapa]
Length=692

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 167/225 (74%), Gaps = 1/225 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +
Sbjct  16   AHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYE  75

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  
Sbjct  76   LSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNK  135

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+ +N+  N+L GE++ MF  L+ L T+DFS N L+G +P +F++LT++K ++LQ N FT
Sbjct  136  LKSINLGQNKLDGELSDMFQKLSKLETVDFSLNKLSGKLPHSFANLTSLKKLHLQENRFT  195

Query  712  GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT-GGNSWNS  843
            G I+VL NLP+D+LN+E+N F GWIP +L+ I+SL T GGN W++
Sbjct  196  GDINVLRNLPIDDLNIEDNQFEGWIPNELKEIDSLLTGGGNDWST  240



>ref|XP_009391183.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 166/220 (75%), Gaps = 0/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  L+ SLNSP QLT W+++GGDPCG  W+G+ CSG+ VTEI +SGL LTG+
Sbjct  24   TDPPDVSALNDLYRSLNSPSQLTGWSSSGGDPCGNDWQGIKCSGSSVTEIILSGLGLTGT  83

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L SVT FD+S NNL   +PYQLPPN   ++L+GN FTGG+ YSISQM  L YL
Sbjct  84   IGYQLSSLTSVTYFDLSKNNLHGDIPYQLPPNAIHIDLSGNVFTGGISYSISQMTDLNYL  143

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+++NQL G++T MF  L +LS LD SFN  +G +PQ+F SL+++K + LQNN F+G++ 
Sbjct  144  NLANNQLSGQLTDMFRKLPSLSLLDLSFNHFSGTLPQSFGSLSSLKTLRLQNNQFSGSLG  203

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLA L LD+LNV+NN FTGWIP +L+ I+  +  GNSW+S
Sbjct  204  VLATLSLDDLNVQNNQFTGWIPNKLKSIDDFKIDGNSWSS  243



>ref|XP_004510591.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=711

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 174/221 (79%), Gaps = 3/221 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP DA+ L  LF SLNSP QL  W ANG DPCG+SWKG++CSGNR+TEI++ GL L+G
Sbjct  22   DTDPNDAAALTLLFQSLNSPAQLN-WPANGNDPCGQSWKGITCSGNRITEIKLPGLGLSG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L ++TT D+S NN+G+++PY LP N+Q LNLA N   GG+PYS+S +  L  
Sbjct  81   TLGYQL-SLSALTTLDLSNNNIGSNIPYSLPQNLQHLNLANNNLNGGIPYSLSDITSLIS  139

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            +N+ HNQLQ  +T+ F  LT+LSTLD SFNSL G++PQT +SL+++  MYLQNN  TGTI
Sbjct  140  MNLGHNQLQQGLTLNFQKLTSLSTLDLSFNSLTGDLPQTMNSLSSITTMYLQNNQLTGTI  199

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +VLA+LPL++LNVENNHFTGWIP QL+ IN +Q  GNSW+S
Sbjct  200  NVLADLPLESLNVENNHFTGWIPEQLKNIN-IQKDGNSWSS  239



>gb|KHG18134.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=721

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 174/235 (74%), Gaps = 4/235 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF    P   + +TD  DAS L  +++SLNSP QLT WTA+ GDPCG+SWKGV+CS  
Sbjct  18   ILGF---KPRCVIGETDQADASALGVMYTSLNSPQQLTGWTASNGDPCGQSWKGVTCSNK  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++S L L+GS+G+    L S+   D+S NN    +PY   PN+Q+LNL  N FTG
Sbjct  75   RVTEIKLSNLGLSGSVGYSFQSLTSLKELDLSHNNFAGDIPYFTLPNLQRLNLEYNQFTG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
             +P++ISQM  L+YLN++HNQLQ  +T MF  L++LSTLD SFNSL G +P++F +LT++
Sbjct  135  SVPFAISQMPSLQYLNLAHNQLQNALTDMFGPLSSLSTLDLSFNSLNGGLPESFKNLTSI  194

Query  679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             +MYLQNN F+GTIDVLANLPLD L+V NN FTGW+P QL+ IN L+  GNSW+S
Sbjct  195  NSMYLQNNQFSGTIDVLANLPLDTLDVSNNRFTGWVPDQLKSIN-LKKDGNSWSS  248



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 166/238 (70%), Gaps = 0/238 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            +A+A++   ++   P   + TD +D   L+ L+SSLNS P LT W +N GDPCGESWKGV
Sbjct  19   YAIAVVALTVIFTLPLVRSATDSSDVQALQVLYSSLNSSPLLTGWKSNAGDPCGESWKGV  78

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C G+ V  IQISGL L+G++G+ L  L S+   D+S NN+ +S+PYQLPPN+  LNLA 
Sbjct  79   TCQGSSVVAIQISGLGLSGTLGYMLSSLFSLKALDLSGNNIHDSIPYQLPPNLTSLNLAN  138

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N  +G LPYSIS M  L YLN+ HN +   +  +F +L +LS LD SFN+ +GN+P +F 
Sbjct  139  NNLSGNLPYSISTMVSLNYLNLGHNSISQSIGDIFANLQSLSVLDLSFNNFSGNLPNSFG  198

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            SL+N+  +YLQNN  TG+I++LA+LPLDNLNV NNHFTGWIP +   I S    GNS+
Sbjct  199  SLSNLSTLYLQNNQLTGSINLLADLPLDNLNVANNHFTGWIPREFTSIPSFIYDGNSF  256



>ref|NP_001167741.1| uncharacterized protein LOC100381429 precursor [Zea mays]
 gb|ACN25932.1| unknown [Zea mays]
Length=720

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 171/226 (76%), Gaps = 3/226 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             A TD  D + L  LF+S+NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L L
Sbjct  27   AAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLGL  86

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLA N F+G +PYSIS M
Sbjct  87   SGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSISTM  146

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              ++YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN 
Sbjct  147  PNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQ  206

Query  706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             TG+I+VLANLPLD+LNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct  207  LTGSINVLANLPLDDLNVANNRFTGWIPEELKKINSLQTDGNSWST  252



>gb|KJB70030.1| hypothetical protein B456_011G054100 [Gossypium raimondii]
Length=709

 Score =   251 bits (641),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 178/249 (71%), Gaps = 6/249 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGF----LLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            M   W  AL++      +L   P  V  +TD  DAS L  +++SLNSP QLT WTA+ GD
Sbjct  1    MVKKWKKALILVLFTVCILGFKPRCVNGETDQADASALGVMYTSLNSPQQLTGWTASNGD  60

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SWKGV+CS  RVTEI++S L L+GS+G+    L S+   D+S NN    +PY   P
Sbjct  61   PCGQSWKGVTCSNKRVTEIKLSNLGLSGSVGYSFQSLTSLKELDLSHNNFAGDIPYFTLP  120

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
            N+Q+LNL  N FTG +P++ISQM  L+YLN++HNQLQ  +T MF  L++LSTLD SFNSL
Sbjct  121  NLQRLNLEYNQFTGSIPFAISQMPSLQYLNLAHNQLQNALTDMFGPLSSLSTLDLSFNSL  180

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL  816
             G +P++F +LT++ +MYLQNN F+GTIDVLANLPLD L+V NN FTGW+P QL+ IN L
Sbjct  181  NGGLPESFKNLTSISSMYLQNNQFSGTIDVLANLPLDTLDVSNNQFTGWVPDQLKSIN-L  239

Query  817  QTGGNSWNS  843
            +  GNSW+S
Sbjct  240  KKDGNSWSS  248



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 166/240 (69%), Gaps = 5/240 (2%)
 Frame = +1

Query  136  LLIGFLLNAPPSAV-----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            LL GF+L A   AV       TD +D   L+ L++S+NSP QLT W  +GGDPCGESWKG
Sbjct  15   LLTGFVLIASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWKG  74

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V+C G+ V  I++SGL L+G+MG+ L  L S+  FD+S NN  ++LPYQLPPN+  LN+A
Sbjct  75   VTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNIA  134

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N FTG LPYSI+ M  L YLNVSHN L   V  +F +L  L+TLD S N+ +G+IP +F
Sbjct  135  RNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDIFANLVGLATLDLSLNNFSGDIPNSF  194

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +SLTN+ ++Y+QNN  TG+++VL  LPL  LNV NNHF GWIP +L  I++    GN++ 
Sbjct  195  TSLTNLSSLYVQNNQLTGSLNVLTGLPLTTLNVANNHFNGWIPHELSSIHTFIYDGNAFK  254



>ref|XP_006836581.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 174/220 (79%), Gaps = 0/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD  D S L  +++SLNSP QL+ WT+NGGDPCG++W+GV+CSG+ VTE+++SGL L+GS
Sbjct  28   TDAADVSALNVMYNSLNSPGQLSGWTSNGGDPCGQNWRGVTCSGSSVTELKLSGLGLSGS  87

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+TTFD+S NN GN +PYQLPPN+ +LNLA N FTG + YSI+QM+ L+YL
Sbjct  88   LGYQLTSLTSLTTFDVSNNNFGNDIPYQLPPNLSRLNLAENSFTGNIQYSIAQMSALQYL  147

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQG+++ +F  L++L+TLD S N L GN+P++FSSLT++  + LQ+N FTG ID
Sbjct  148  NIGHNQLQGQLSDIFGQLSSLTTLDLSSNRLNGNLPESFSSLTSLTTLSLQDNQFTGPID  207

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLANLPL NLNV NNHF+GWIP  L  I + Q  GNSW S
Sbjct  208  VLANLPLQNLNVANNHFSGWIPGSLNNIRNFQKDGNSWTS  247



>ref|XP_009406399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=723

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 175/234 (75%), Gaps = 8/234 (3%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNR  321
            +G LL +P S+         S L  ++SSLNSP QLT W ++GGDPCG  WKG+ CSG+ 
Sbjct  45   VGTLLLSPTSSF--------SALNVMYSSLNSPSQLTGWGSSGGDPCGNDWKGIKCSGSS  96

Query  322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG  501
            VTEI++SGL LTG+MG+QL  L SVT FD+S NNL   +PYQLPPN   +NLAGN  TGG
Sbjct  97   VTEIKLSGLGLTGTMGYQLSSLTSVTYFDLSKNNLQGDVPYQLPPNAIHINLAGNALTGG  156

Query  502  LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK  681
            +PYSISQM  L YLN+++NQL G++T +F  L +LS LD SFN  +GN+PQ+F SL+++K
Sbjct  157  VPYSISQMTDLNYLNLANNQLSGQLTDVFGKLHSLSLLDLSFNHFSGNLPQSFGSLSSLK  216

Query  682  NMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             + +QNN F+G++ VLA L L++LN++NNHFTGWIP +L+ I++L+  GNSW+S
Sbjct  217  TLNIQNNQFSGSLGVLAPLSLEDLNIQNNHFTGWIPNKLRSIDNLKVDGNSWSS  270



>ref|XP_010474484.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Camelina 
sativa]
Length=701

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 169/238 (71%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V LLI  L        A TD  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C
Sbjct  6    VHLLIVSLAIVVTLVQAKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SGL+L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N 
Sbjct  66   KGSSVTELQLSGLELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNLANLDFSENE  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  ++ +N+  N+L G++  MF  L+ L TLD S N L+G +PQ+F++L
Sbjct  126  LDGNVPYSLSQMKSIQSINLGQNKLNGDLPHMFQKLSKLETLDLSLNQLSGKLPQSFANL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            T++K ++LQ N FTG I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN W++
Sbjct  186  TSLKKLHLQENRFTGDINVLRNLAVDDLNVEDNRFEGWIPNELKDIDSLLTGGNDWST  243



>ref|XP_008783422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 181/223 (81%), Gaps = 2/223 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DT   D S L  L+SSLNSP QLT WT+N GDPCG+SW GV+CSG  VT I++SGL L+G
Sbjct  32   DTKSDDVSALNVLYSSLNSPSQLTGWTSNAGDPCGQSWLGVTCSGQAVTTIKLSGLGLSG  91

Query  361  SMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            S+G+Q+  + S+T  D+S NNLG    +PY LPPN++KLNLAGN FTG +PYSISQM PL
Sbjct  92   SLGYQMSGMTSLTELDMSNNNLGGGQQIPYNLPPNLEKLNLAGNQFTGNVPYSISQMIPL  151

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
            +YLN+SHNQLQG ++ MF  LTNL+T+D S N+L G++PQ+FSSL+++  ++LQNN FTG
Sbjct  152  KYLNLSHNQLQGNLSDMFGQLTNLTTMDLSSNALTGDLPQSFSSLSSLTTLHLQNNQFTG  211

Query  715  TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +IDVLA+LPL++LNV NN FTGWIP +L+GIN+LQTGGNSW+S
Sbjct  212  SIDVLASLPLNDLNVANNRFTGWIPDKLRGINNLQTGGNSWSS  254



>ref|XP_002889223.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65482.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 168/238 (71%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V+LLI  L        A TD  + S L  +F+SLNSP +L  W  NGGDPC  SW+GV C
Sbjct  6    VSLLIVSLAIIVTLVQAKTDNQEVSGLNVMFTSLNSPSKLKGWKPNGGDPCDGSWEGVKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SG +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N 
Sbjct  66   KGSSVTELQLSGFELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIVNLDFSENE  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  L+ +N+  N+L GE+  MF  L+ L TLD S N L+G +PQ+F++L
Sbjct  126  LDGNVPYSLSQMKSLQSINLGQNKLNGELPDMFQKLSKLVTLDLSLNQLSGKLPQSFANL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            T++K ++LQ N FTG I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN W++
Sbjct  186  TSLKKLHLQENRFTGDINVLRNLAIDDLNVEDNQFEGWIPNELKDIDSLLTGGNDWST  243



>ref|XP_010429764.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Camelina 
sativa]
Length=621

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 163/222 (73%), Gaps = 0/222 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+ L  LKS+T FD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  82   GSLGYLLSNLKSLTNFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L G++  MF  L+ L TLD S N L+G +PQ+F++LT++K ++LQ N FTG 
Sbjct  142  SINLGQNKLNGDLQDMFQKLSKLETLDLSLNQLSGKLPQSFANLTSLKKLHLQENRFTGD  201

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN W++
Sbjct  202  INVLRNLAIDDLNVEDNRFKGWIPNELKDIDSLLTGGNDWST  243



>gb|KJB56462.1| hypothetical protein B456_009G120500 [Gossypium raimondii]
Length=710

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 162/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD  D + L  +F SL +P QL+ W  +GGDPC +SW+GV CSG+RVTEI +S   L G 
Sbjct  24   TDSRDVNALNVMFKSLKAPSQLSGWRVSGGDPCSDSWQGVKCSGSRVTEISLSNYGLNGE  83

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+T+ D+S NNL + +PYQLPPN  ++NL+ N FTG +PYSISQM+ +E +
Sbjct  84   LGYQLSNLTSLTSLDVSKNNLNDQIPYQLPPNAVRINLSHNQFTGNVPYSISQMSNIESI  143

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+S+N+L G ++ MF  +  L + D S N L   +P +F++LTN+  + LQNN  TGT++
Sbjct  144  NLSNNKLDGTLSDMFAKVKKLKSFDLSNNELTDKLPNSFANLTNLNTLRLQNNQLTGTLN  203

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            VLA+LP+++LNVENN F+GWIP +L+GI SL+TGGNSW++
Sbjct  204  VLADLPIEDLNVENNKFSGWIPNELKGIRSLKTGGNSWST  243



>gb|KCW77015.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=696

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 168/242 (69%), Gaps = 4/242 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+T DFS+N+ +G++P
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLP  190

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             +FS+L N+ ++Y+QNN  TG+++VL  LPL  LNV NNHF+GWIP +   + +    GN
Sbjct  191  ASFSALANLSSLYMQNNQLTGSLNVLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGN  250

Query  832  SW  837
            S+
Sbjct  251  SF  252



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 164/235 (70%), Gaps = 1/235 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +  A P     TD +D   L+ +++S+NSPPQLT W ++GGDPCGESWKGV+C G
Sbjct  31   VLLGLVFAALPRISGTTDASDVQALQVMYTSVNSPPQLTNWKSSGGDPCGESWKGVTCEG  90

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
              V  I++SGL L+G+MG+ L  L S+  FD+S NN  + +PYQLPPN+  LNLA N F+
Sbjct  91   TAVVAIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDIIPYQLPPNLTSLNLARNNFS  150

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVSHN L   +  +F +L+ L+TLD S N+ +G+IP +FSSL+N
Sbjct  151  GNLPYSISAMGSLNYLNVSHNSLSQSIQDIFANLS-LATLDLSLNNFSGDIPVSFSSLSN  209

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +  +Y+QNN  TG+++ L  LPL  LNV NNHF+GWIP +L  + +    GNS++
Sbjct  210  LSALYVQNNQLTGSLNALTGLPLTTLNVANNHFSGWIPRELSSLQTFIYDGNSFD  264



>ref|XP_006850999.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Amborella trichopoda]
Length=717

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 165/237 (70%), Gaps = 0/237 (0%)
 Frame = +1

Query  133  ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            ALL G L          TD  D S L  +F+SLNSPPQLT WT++GGDPC      +  S
Sbjct  9    ALLYGILCPLIVYVHGGTDAPDVSALNVMFTSLNSPPQLTGWTSSGGDPCXXXXXXLYYS  68

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  492
             +  +  +++GL L+GSMG+QL  L S+T  D+S NNL   +PY LPPNV  +NLAGNGF
Sbjct  69   FSVESSSKLAGLGLSGSMGYQLRSLTSLTYLDMSRNNLEGDVPYNLPPNVLHINLAGNGF  128

Query  493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT  672
            TG +PYSIS M  L+YLN+ HNQL G++  MF +L  L  LD SFNS++GN+PQ+F SL+
Sbjct  129  TGVVPYSISSMTDLKYLNLGHNQLNGQLNDMFGNLRKLRVLDLSFNSISGNLPQSFGSLS  188

Query  673  NMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            ++  + LQNN FTG IDVLA++PLD L++ENN F GWIP +L+ I S+QT GNSW+S
Sbjct  189  SLNTLRLQNNQFTGPIDVLASIPLDELHLENNKFGGWIPEELKHIKSIQTSGNSWSS  245



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 168/242 (69%), Gaps = 4/242 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+T DFS+N+ +G++P
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLP  190

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             +FS+L N+ ++Y+QNN  TG+++VL  LPL  LNV NNHF+GWIP +   + +    GN
Sbjct  191  ASFSALANLSSLYMQNNQLTGSLNVLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGN  250

Query  832  SW  837
            S+
Sbjct  251  SF  252



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 168/242 (69%), Gaps = 4/242 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+T DFS+N+ +G++P
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLP  190

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             +FS+L N+ ++Y+QNN  TG+++VL  LPL  LNV NNHF+GWIP +   + +    GN
Sbjct  191  ASFSALANLSSLYMQNNQLTGSLNVLVGLPLTTLNVANNHFSGWIPKEFSSLQTFIYDGN  250

Query  832  SW  837
            S+
Sbjct  251  SF  252



>ref|XP_009344017.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 167/236 (71%), Gaps = 6/236 (3%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L+GF         + T+  D S L  +++S  S  +L  W ++GGDPCGESWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSFQSRSKLKGWKSSGGDPCGESWKGI  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VTEI +S L L+GSMG+QL  L SVT FD+S NNL   +PYQLPP+ + ++L+ 
Sbjct  66   TCSGSSVTEIDLSDLGLSGSMGYQLASLTSVTKFDLSKNNLNGDIPYQLPPSAKYIDLSQ  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L  LD S+NS+ GN+PQ+F 
Sbjct  126  NGFSNTVPYSVSQMSGLETLNLGRNKLNGQLSDMFGKLTKLKELDLSYNSITGNLPQSFG  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             L+++K +YLQNN  TG I+VL N P++ LN+ENN F+GWIP  L+GIN +++GGN
Sbjct  186  KLSSLKKLYLQNNQLTGQINVLVNTPVEELNIENNRFSGWIPNDLKGIN-IKSGGN  240



>gb|EYU33875.1| hypothetical protein MIMGU_mgv1a002066mg [Erythranthe guttata]
Length=720

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 160/220 (73%), Gaps = 0/220 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TDP+D   L+ L++SLNSP QLT W ++GGDPCGESWKG++C G+ V  IQISGL +T
Sbjct  31   AATDPSDVQGLQVLYTSLNSPSQLTGWKSSGGDPCGESWKGITCQGSSVVSIQISGLGIT  90

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+ L  L S+ T D+S NN+ +S+PYQLPPN+  LNLAGN FTG +PYSI+ M  L 
Sbjct  91   GSMGYLLSNLASLKTLDMSNNNIHDSIPYQLPPNLTSLNLAGNNFTGNIPYSIATMGSLN  150

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+S N L   +  MF + + L+TLD S NS  G++P +F+SL+N+  + +QNN  TG+
Sbjct  151  YLNISRNMLSQGIGDMFANHSALATLDLSSNSFTGDLPPSFTSLSNLSTLQVQNNQLTGS  210

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            ++VL  LPL NLNV NNHF+GWIP +L  I + +  GN++
Sbjct  211  LNVLVGLPLTNLNVANNHFSGWIPQELISIPNFKNDGNTF  250



>ref|XP_006301930.1| hypothetical protein CARUB_v10022406mg [Capsella rubella]
 gb|EOA34828.1| hypothetical protein CARUB_v10022406mg [Capsella rubella]
Length=696

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 173/248 (70%), Gaps = 6/248 (2%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            M++L+ L   V+L I F L       A TD  + S L  +F+SLNSP +L  W ++GGDP
Sbjct  2    MQKLVSL-LIVSLAILFTL-----VQAKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDP  55

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            C  SW+GV C G+ VTE+Q+S  +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN
Sbjct  56   CDGSWEGVKCKGSSVTELQLSSFELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPN  115

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            +  L+ + N   G +PYS+SQM  L+ +N+  N+L GE+  MF  L+ L TLD S N L+
Sbjct  116  LANLDFSENELDGNVPYSLSQMKSLQSINLGQNKLNGELPDMFQKLSKLETLDLSLNQLS  175

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ  819
            G +PQ+F++LT++K ++LQ N F G I+VL NL +D+LNVE+N F GWIP +L+ I+SL 
Sbjct  176  GKLPQSFANLTSLKKLHLQENRFKGDINVLRNLAIDDLNVEDNQFQGWIPNELKDIDSLL  235

Query  820  TGGNSWNS  843
            TGGN W++
Sbjct  236  TGGNDWST  243



>ref|XP_009346024.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=698

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 168/236 (71%), Gaps = 6/236 (3%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L+GF         + T+  D S L  +++SL S  +L+ W ++GGDPCG+SWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSLQSRSKLSGWKSSGGDPCGDSWKGI  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VT+I +S L L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ 
Sbjct  66   TCSGSSVTQIDLSDLGLSGSMGYQLASLTSVTKFDLSKNNLNGDIPYQLPPNAKYIDLSQ  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L  LD S+NSL GN+PQ+F 
Sbjct  126  NGFSNTVPYSVSQMSDLETLNLGRNKLNGQLSDMFGKLTKLKELDLSYNSLTGNLPQSFG  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             L+++K +YLQNN  TG I+VL   P++ LN+ENN F+GWIP  L+GIN +++GGN
Sbjct  186  KLSSLKKLYLQNNQLTGQINVLMYTPVEELNIENNRFSGWIPNDLKGIN-IKSGGN  240



>ref|XP_008228078.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Prunus mume]
Length=719

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 168/236 (71%), Gaps = 6/236 (3%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L GF         + T+  D S L  +++S+NS  +L+ W ++GGDPCG+SWKG+
Sbjct  21   WVV--LFGFFTTG---VYSKTNSQDVSSLNVMYNSINSRSKLSGWKSSGGDPCGDSWKGI  75

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
             CSG+ VTEI ++ L L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ 
Sbjct  76   KCSGSSVTEIDLADLGLSGSMGYQLASLTSVTRFDLSKNNLNGDIPYQLPPNAKYIDLSQ  135

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGFT  +PYSISQM+ LE LN+  N+L G++T MF  LT L  LD S+NS+ GN+PQ+F 
Sbjct  136  NGFTNTVPYSISQMSDLETLNLGRNKLNGQLTDMFGKLTKLKELDLSYNSMTGNLPQSFG  195

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             L+++K + LQNN FTG I +L   P+++LN+ENN F+GWIP +L+GIN +++GGN
Sbjct  196  KLSSLKKLNLQNNQFTGQITLLVYTPVEDLNIENNRFSGWIPNELKGIN-IKSGGN  250



>ref|XP_010235400.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Brachypodium distachyon]
Length=712

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 163/213 (77%), Gaps = 2/213 (1%)
 Frame = +1

Query  202  SVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLD  381
            + L   ++++NSPPQL  W +   DPCG+SW G++C G+RVT I++SG+ L G++G+ ++
Sbjct  34   TALNVFYTTMNSPPQLKNWVSQNADPCGQSWNGITCLGSRVTTIKLSGMGLNGTLGYNMN  93

Query  382  QLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
             L ++   D+S NNLG S +PY LPPN++KLNLAGN FTG  PYSISQM  L+ LN++HN
Sbjct  94   LLTALVQLDMSNNNLGGSDIPYNLPPNLEKLNLAGNHFTGTTPYSISQMFALKDLNLAHN  153

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            Q+   ++ MF  LTNL+T+D S+N+ + NIPQ+F+SLT++  +YLQNN F+GTIDVLANL
Sbjct  154  QI-STISDMFNQLTNLTTMDLSYNAFSANIPQSFNSLTSLTTLYLQNNQFSGTIDVLANL  212

Query  739  PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            PL +LN+ NN FTGW+P +L+ I +LQT GNS+
Sbjct  213  PLTDLNIANNRFTGWVPDKLKKIRTLQTAGNSF  245



>ref|XP_010417514.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Camelina sativa]
Length=697

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V LLI  L        A TD  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C
Sbjct  6    VHLLIVSLAIVVTLVQAKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SGL+L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N 
Sbjct  66   KGSSVTELQLSGLELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNLANLDFSENE  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  ++ +N+  N+L G++  MF  L+ L TLD S N L+G +PQ+F++L
Sbjct  126  LDGNVPYSLSQMKSIQSINLGQNKLNGDLPHMFQKLSKLETLDLSLNQLSGKLPQSFANL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
            T++K ++LQ+N FTG I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN
Sbjct  186  TSLKKLHLQDNRFTGDINVLRNLAIDDLNVEDNRFEGWIPNELKDIDSLLTGGN  239



>ref|XP_009781362.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Nicotiana sylvestris]
Length=724

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 170/225 (76%), Gaps = 1/225 (0%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE-SWKGVSCSGNRVTEIQIS  342
            P  ++ TD    S L  ++  L    +L  W  +GGDPCG+ SW+G+ CSG+ + EI +S
Sbjct  31   PVVLSKTDSRQVSALNNMYQYLKPSSKLEGWKKDGGDPCGDDSWQGIKCSGSDIIEIDLS  90

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
            GL L+GS+GFQLD+L+ VT FD+S NNL +++PYQLPP  Q L+L+GN F+G +PYSISQ
Sbjct  91   GLGLSGSLGFQLDKLEKVTYFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFSGTVPYSISQ  150

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            MA L++LN++HN++ G ++ MF  LT L+ +D SFNS++G++PQ+F SL+++  +++QNN
Sbjct  151  MADLKFLNLNHNKISGSLSDMFGQLTKLTEMDLSFNSISGSLPQSFRSLSSLSKLHMQNN  210

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
             FTG+I+VLA+LPLD+LNV NN  TGWIP +L+ I  L+TGGNSW
Sbjct  211  QFTGSINVLADLPLDDLNVANNQLTGWIPDELKDIKKLETGGNSW  255



>ref|XP_008380425.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Malus domestica]
Length=697

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 166/236 (70%), Gaps = 6/236 (3%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L+GF         + T+  D S L  +++S  S  +L  W ++GGDPCGESWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSFQSRSKLKGWKSSGGDPCGESWKGI  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VTEI +  L L+GSMG+QL  L SVT FD+S NNL   +PYQLPP+ + ++L+ 
Sbjct  66   TCSGSSVTEIDLXDLGLSGSMGYQLASLTSVTXFDLSKNNLNGDIPYQLPPSAKYIDLSQ  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L  LD S+NS+ GN+PQ+F 
Sbjct  126  NGFSNTVPYSVSQMSGLETLNLGRNKLNGQLSDMFGKLTKLKELDLSYNSITGNLPQSFG  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN  831
             L+++K +YLQNN  TG I+VL   P++ LN+ENNHF+GWIP  L+GIN +++GGN
Sbjct  186  KLSSLKKLYLQNNQLTGQINVLVYTPVEELNIENNHFSGWIPNDLKGIN-IKSGGN  240



>ref|XP_010937237.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Elaeis 
guineensis]
Length=724

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 185/238 (78%), Gaps = 2/238 (1%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            LL+   +  P      T+  D S L  L+SSLNSP QLT WT+NGGDPCG+SW GV+CSG
Sbjct  17   LLVCIWIWNPSFVHGATNSADVSALNVLYSSLNSPGQLTGWTSNGGDPCGQSWLGVTCSG  76

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPNVQKLNLAGNG  489
              VT I++SGL L+GS+G+Q+  + S+T  DIS NNLG    +PY LPPN+++LNLAGN 
Sbjct  77   QAVTTIKLSGLGLSGSLGYQMASMASLTELDISNNNLGGGQQIPYNLPPNLERLNLAGNQ  136

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            F G +PYSIS M PL+YLN+ HNQLQG ++ +F  LTNL+T+D S NSL G++PQ+FSSL
Sbjct  137  FNGNVPYSISLMFPLKYLNLGHNQLQGNLSDIFGKLTNLTTMDLSSNSLTGDLPQSFSSL  196

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +++  +YLQNN FTG+IDVLA+LPL++LNV NNHFTGWIP +L+GIN+LQTGGNSW+S
Sbjct  197  SSLTTLYLQNNQFTGSIDVLASLPLNDLNVANNHFTGWIPDKLRGINNLQTGGNSWSS  254



>ref|XP_008651696.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Zea 
mays]
Length=712

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 162/227 (71%), Gaps = 27/227 (12%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+I      
Sbjct  48   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKI------  101

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
                              D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS 
Sbjct  102  ------------------DMSQNNLGGGGQIQYNLPNMKLEKLNLAGNQFGGNLPYSIST  143

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN
Sbjct  144  MPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNN  203

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             FTG I+VLANLPL+ LNV NNHFTGWIP QL+ INSLQT GNSW++
Sbjct  204  QFTGNINVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST  250



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 169/221 (76%), Gaps = 4/221 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP D + L+ +F S+NSPPQL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  24   ETDPNDVASLKVMFQSMNSPPQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ L  VT  D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+SQ   L  
Sbjct  81   SLGYQLESLSLVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGEVPYSLSQKTSLVV  140

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            +N+ HNQLQ  + V F  L++LSTLD SFNSL GN+PQT SSL+++  MYLQNN FTGTI
Sbjct  141  VNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGNLPQTLSSLSSISTMYLQNNQFTGTI  200

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +VLANLPL+ LNV NNHFTGWIP QL  IN LQ  GN W+S
Sbjct  201  NVLANLPLETLNVGNNHFTGWIPEQLNNIN-LQKDGNDWSS  240



>ref|XP_004985464.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Setaria italica]
Length=752

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 177/257 (69%), Gaps = 33/257 (13%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP+D +VL  LF+SLNSP QL  W ANGGDPCG+SWKG++CSG+ VT+I +S L 
Sbjct  38   AAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNLG  97

Query  352  LTGSMGFQLDQLKSVTTFDISTNNL--GNSLPYQLPP-NVQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ L S+   D+S N+L  G+ + Y LP   +++LNLAGN F G LPYSIS 
Sbjct  98   LSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIST  157

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM-----  687
            M  L+YLN++HNQLQG ++ +F SL +L+ +D SFNSL G++PQ+F+ L+++K++     
Sbjct  158  MTNLKYLNLNHNQLQGNISDVFSSLYSLTDVDLSFNSLTGDLPQSFTGLSSLKHLYERMP  217

Query  688  -------------------------YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPP  792
                                     YLQNN FTG I+VLANLPL+ LNV NN FTGWIP 
Sbjct  218  VHLFSSPIHISLELFCINPFLFFLRYLQNNQFTGYINVLANLPLEALNVANNRFTGWIPS  277

Query  793  QLQGINSLQTGGNSWNS  843
            QL+ INS+QT GNSW++
Sbjct  278  QLKKINSIQTDGNSWST  294



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 164/235 (70%), Gaps = 1/235 (0%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTD-ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L+G   +A     A   P +    L+ +++SLNSP QLT WT+NGGDPCGESWKG++C G
Sbjct  28   LVGAFTDASDEIFATAYPDNFVQALQVMYTSLNSPSQLTGWTSNGGDPCGESWKGITCEG  87

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I+ISGL L+G+MG+ L  L S+  FD+S NN+ +++PYQLPPN+  LNLA N  +
Sbjct  88   SAVVSIEISGLGLSGTMGYMLANLVSLRKFDLSDNNIHDTIPYQLPPNLTSLNLAKNNLS  147

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYS S M+ L YLNVS N L   +  +FV+L++L TLD SFN+ +G++P T  SL N
Sbjct  148  GNLPYSFSTMSSLNYLNVSRNSLAQSIGDVFVNLSSLGTLDLSFNNFSGDLPNTLGSLFN  207

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            + ++Y+QNN  TG+++VL  LPL  LNV NNHFTGWIP +L  I+S    GNS++
Sbjct  208  LSSLYMQNNQLTGSLNVLTGLPLTTLNVANNHFTGWIPQELSSIHSFIYDGNSFD  262



>ref|XP_010939841.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Elaeis guineensis]
Length=699

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 182/229 (79%), Gaps = 2/229 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P  A  DTDP D S L GL++SL SP QLT WT+NGGDPCG+SW GV+CSG+ VT I++S
Sbjct  16   PSFANGDTDPADVSALNGLYNSLQSPGQLTGWTSNGGDPCGQSWLGVTCSGSAVTTIKLS  75

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPNVQKLNLAGNGFTGGLPYSI  516
            GL L+G++G+Q+  + S+T  D+S N LG    + Y LP N+++LNLAGN FTG +PYSI
Sbjct  76   GLGLSGTLGYQMLSMTSLTELDMSNNKLGGGQQITYNLPLNLERLNLAGNQFTGNVPYSI  135

Query  517  SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ  696
            SQM PL+YLN+  NQLQG +  MF  LTNL+T+D S NSL+G++P++FSSL+++  +YLQ
Sbjct  136  SQMVPLKYLNLGRNQLQGSLNDMFGQLTNLTTMDLSSNSLSGDLPESFSSLSSLTTLYLQ  195

Query  697  NNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            NN FTG+I+VLANL LD+LNV NNHFTGWIP +L+GIN+LQTGGNSW+S
Sbjct  196  NNQFTGSINVLANLLLDDLNVANNHFTGWIPDKLKGINNLQTGGNSWSS  244



>ref|XP_007217699.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
 gb|EMJ18898.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
Length=670

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +++S+NS  +L+ W ++GGDPCG+SWKG+ CSG+ VTEI +S L L+GSMG+QL  L SV
Sbjct  1    MYNSINSRSKLSGWKSSGGDPCGDSWKGIKCSGSSVTEIDLSDLGLSGSMGYQLASLTSV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNL   +PYQLPPN + ++L+ NGFT  +PYSISQM+ LE LN+  N+L G++
Sbjct  61   TRFDLSKNNLNGDIPYQLPPNAKYIDLSQNGFTNTVPYSISQMSDLETLNLGRNKLNGQL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN  756
            T MF  LT L  LD S+NS+ GN+PQ+F  L+++K + LQNN FTG I +L   P+++LN
Sbjct  121  TDMFGKLTKLKVLDLSYNSMTGNLPQSFGKLSSLKKLNLQNNQFTGQITLLVYTPVEDLN  180

Query  757  VENNHFTGWIPPQLQGINSLQTGGN  831
            +ENN F+GWIP +L+GIN +++GGN
Sbjct  181  IENNRFSGWIPNELKGIN-IKSGGN  204



>gb|KJB69229.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=537

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVS N L   V  +F +LT+L TLD SFN+ +G++P +FSSLTN
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDLGTLDLSFNNFSGDLPVSFSSLTN  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +  +Y+QNN F+G+++VL+ LPL+ LNV NN+ +GWIP +L  + +    GNS+
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTLNVANNNLSGWIPQELFSLPTFICDGNSF  259



>gb|KDO78353.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=442

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            V + LPL  LNV NNHF+GWIP +L  I +    GNS++
Sbjct  219  VFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD  257



>dbj|BAG99361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=683

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = +1

Query  229  LNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFD  408
            +NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + G++G+ ++ L S+   D
Sbjct  1    MNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELD  60

Query  409  ISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM  585
             S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L  LN+ HN L      M
Sbjct  61   TSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALRILNLGHNHL-ATTNDM  119

Query  586  FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVEN  765
            F  LTNL+TLD S+N+L+GNIPQ+F+SLTN++ + LQNN F GTIDVLA+LPL +LNV N
Sbjct  120  FNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKLNLQNNGFNGTIDVLADLPLTDLNVAN  179

Query  766  NHFTGWIPPQLQGINSLQTGGNSWNS  843
            N FTGWIP +L+ I +LQT GNS+ S
Sbjct  180  NQFTGWIPDKLKKIKNLQTNGNSFGS  205



>gb|AAP12946.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABF96436.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
Length=753

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 172/243 (71%), Gaps = 4/243 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN-SLPYQLPPNVQK  468
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNLG   +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLATLDLSDNTFSGTL  196

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P +FS+LT++  ++LQ+N FTGTIDVL++LPL +LNV+NN  +G IP +L+GI++LQ  G
Sbjct  197  PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDLNVQNNQLSGAIPDKLKGISNLQISG  256

Query  829  NSW  837
            NS+
Sbjct  257  NSF  259



>gb|EAY90345.1| hypothetical protein OsI_11922 [Oryza sativa Indica Group]
Length=753

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 172/243 (71%), Gaps = 4/243 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN-SLPYQLPPNVQK  468
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNLG   +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLATLDLSDNTFSGTL  196

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P +FS+LT++  ++LQ+N FTGTIDVL++LPL +LNV+NN  +G IP +L+GI++LQ  G
Sbjct  197  PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDLNVQNNQLSGAIPDKLKGISNLQISG  256

Query  829  NSW  837
            NS+
Sbjct  257  NSF  259



>gb|AAC27896.1| leucine-rich repeat transmembrane protein kinase 3 [Zea mays]
Length=358

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  256  WTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN-  432
            W ANGGDPCG+SWKG++CSG+ VT+IQ+  L L G++ + ++ L S+   D+S NNLG  
Sbjct  3    WQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLAGNLAYNMNNLGSLVELDMSQNNLGGG  62

Query  433  -SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL  606
              + Y LP   ++KLNLAGN F G LPYSIS M  L+YLN++HNQLQG +T +F +L +L
Sbjct  63   GQIQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSL  122

Query  607  STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWI  786
            S LD SFNSL G++PQ F+ L+++K MYLQNN FT  I+VLANLPL+ LNV NNHFTGWI
Sbjct  123  SELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTSYINVLANLPLETLNVGNNHFTGWI  182

Query  787  PPQLQGINSLQTGGNSWNS  843
            P QL+ IN+LQT GNSW++
Sbjct  183  PSQLKKINNLQTDGNSWST  201



>gb|EMS47769.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Triticum urartu]
Length=619

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 165/219 (75%), Gaps = 3/219 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             A TD TD + L  LF+SLNSP QL  W  NGGDPCGESW+G++CSG+ VT I++  L L
Sbjct  26   AATTDATDLTALNTLFTSLNSPGQLKGWQVNGGDPCGESWQGITCSGSSVTAIKLPSLGL  85

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++G+ ++ + S+   D+S N+LG   ++ Y LP   +++LNLAGN F G LPYSI  M
Sbjct  86   SGNLGYNMNTMSSLVEIDMSQNSLGGGQAIQYNLPTAKLERLNLAGNQFGGNLPYSIFSM  145

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG++T +F +L +L+T+D SFNSL G++P+  SSL+++K +YLQNN 
Sbjct  146  NNLKYLNLNHNQLQGKMTDVFSNLGSLTTVDLSFNSLTGDLPEGLSSLSSVKTLYLQNNQ  205

Query  706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT  822
             TG+I+VLA+LPL +LNV NN FTGWIP QL+ INSLQT
Sbjct  206  LTGSINVLADLPLSDLNVANNRFTGWIPSQLKKINSLQT  244



>ref|XP_009616310.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=724

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 172/225 (76%), Gaps = 1/225 (0%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE-SWKGVSCSGNRVTEIQIS  342
            P  ++ TD    S L  ++  L    +L  W  +GGDPCG+ SW+G+ CSG+ VTEI +S
Sbjct  31   PVVLSKTDSRQVSALNNMYQYLKPSSKLDGWKKDGGDPCGDDSWQGIKCSGSDVTEIDLS  90

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
            GL L+GS+GFQLD+L+ VT FD+S NNL +++PYQLPP  Q L+L+GN F+G +PYSISQ
Sbjct  91   GLGLSGSLGFQLDKLEKVTYFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFSGTVPYSISQ  150

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            MA L++LN++HN++ G ++ MF  LT L+ +D SFNSL+G++PQ+F SL+++  +++QNN
Sbjct  151  MADLKFLNLNHNKISGSLSDMFGQLTKLTEMDLSFNSLSGSLPQSFKSLSSLSKLHMQNN  210

Query  703  VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
             FTG+I+VLA+LPLD+LNV NN FTGWIP +L+ I  L+TGGNSW
Sbjct  211  QFTGSINVLADLPLDDLNVANNQFTGWIPDELKDIKKLETGGNSW  255



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 164/244 (67%), Gaps = 3/244 (1%)
 Frame = +1

Query  109  LMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            L  L + + LL G  L       A+TD  DA  L  L+ +LN+P QLT W A+GGDPCGE
Sbjct  3    LNSLSFCILLLFGISLVL---VRANTDANDAQALHVLYGALNNPSQLTGWKADGGDPCGE  59

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            SWKGV C G+ V  + ISGL ++G+MG+ L  L S+ T D+S NN+ +++P+QLPPN+  
Sbjct  60   SWKGVKCDGSAVVSLDISGLGVSGTMGYLLTNLASLKTLDMSDNNIHDAIPFQLPPNLTS  119

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N  +GGLPYSI  M  L YLNVS N L   +  +F + T L+T+D S N+ +G I
Sbjct  120  LNLAHNNLSGGLPYSIVSMVSLAYLNVSSNSLSQPIADVFSNHTALATIDLSHNNFSGEI  179

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P TF +LTN+  + +QNN  TG++D+L +LPLD LNV NNHFTGW+P +L+ I++    G
Sbjct  180  PPTFRNLTNISTLEIQNNQLTGSLDILTSLPLDTLNVANNHFTGWVPQELKSISNFIYDG  239

Query  829  NSWN  840
            NS++
Sbjct  240  NSFD  243



>gb|KJB69230.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=684

 Score =   239 bits (611),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVS N L   V  +F +LT+L TLD SFN+ +G++P +FSSLTN
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDLGTLDLSFNNFSGDLPVSFSSLTN  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +  +Y+QNN F+G+++VL+ LPL+ LNV NN+ +GWIP +L  + +    GNS+
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTLNVANNNLSGWIPQELFSLPTFICDGNSF  259



>gb|KDO78351.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78352.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=577

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            V + LPL  LNV NNHF+GWIP +L  I +    GNS++
Sbjct  219  VFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD  257



>emb|CDO97730.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   241 bits (614),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 176/240 (73%), Gaps = 2/240 (1%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W + LL  F  N     +  T+  D S L  +++S+NSP +L  W +NGGDPCG+SW G+
Sbjct  45   WLLFLLTSF--NFTTFVLCKTNAPDVSALNVMYTSMNSPSKLDGWKSNGGDPCGQSWHGI  102

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
             CSG+ VTEI +S L+LTGSMG+QL  L SVT FD+S NNL   +PYQLPPN Q ++L+ 
Sbjct  103  KCSGSSVTEIDLSDLELTGSMGYQLSSLTSVTYFDLSKNNLKGDIPYQLPPNAQYIDLSR  162

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+G +PYSISQM  LEYLN+++NQL G++  MF  L+ LS LD SFNS  G +P +F 
Sbjct  163  NGFSGSVPYSISQMINLEYLNLNNNQLNGQLNDMFGQLSKLSKLDLSFNSFTGTLPPSFK  222

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            SL+++  ++LQNN FTG+I+VLA+LPLD+LNV NN FTGWIP +L+ I  ++TGGNSW+S
Sbjct  223  SLSSLSTLHLQNNQFTGSINVLADLPLDDLNVANNQFTGWIPDELKSIKDIKTGGNSWSS  282



>gb|EEC81030.1| hypothetical protein OsI_23812 [Oryza sativa Indica Group]
Length=712

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 159/219 (73%), Gaps = 0/219 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  DA+ L  L+SS NSP QLT W+A GGDPCG +W GVSC G+ VT I++SG+ L G
Sbjct  21   DTDGGDAAALGNLYSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L ++ T D+S+NNL +S+PYQLPPN+  LNLAGN F+G LPYSIS M  L Y
Sbjct  81   TLGYQLSNLLALKTMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNY  140

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  E+  MF +LT LS LD SFN+L GN+P +  SL+N+  +YLQNN  +GT+
Sbjct  141  LNLSHNLLFQEIGEMFGNLTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTV  200

Query  721  DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +VL+NL L  LN+ NN+F+G IP     I+ L  GGNS+
Sbjct  201  NVLSNLSLTTLNIANNNFSGSIPQDFSSISHLILGGNSF  239



>gb|KDO78348.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=621

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            V + LPL  LNV NNHF+GWIP +L  I +    GNS++
Sbjct  219  VFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD  257



>gb|EAZ27223.1| hypothetical protein OsJ_11161 [Oryza sativa Japonica Group]
Length=831

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 172/243 (71%), Gaps = 4/243 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN-SLPYQLPPNVQK  468
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNLG   +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLATLDLSDNTFSGTL  196

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG  828
            P +FS+LT++  ++LQ+N FTGTIDVL++LPL +LNV+NN  +G IP +L+GI++LQ  G
Sbjct  197  PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDLNVQNNQLSGAIPDKLKGISNLQISG  256

Query  829  NSW  837
            NS+
Sbjct  257  NSF  259



>gb|KDO78349.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78350.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=618

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            V + LPL  LNV NNHF+GWIP +L  I +    GNS++
Sbjct  219  VFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD  257



>gb|KJB69228.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=726

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 167/234 (71%), Gaps = 0/234 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVS N L   V  +F +LT+L TLD SFN+ +G++P +FSSLTN
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDLGTLDLSFNNFSGDLPVSFSSLTN  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +  +Y+QNN F+G+++VL+ LPL+ LNV NN+ +GWIP +L  + +    GNS+
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTLNVANNNLSGWIPQELFSLPTFICDGNSF  259



>gb|KHN01483.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=675

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 159/205 (78%), Gaps = 5/205 (2%)
 Frame = +1

Query  229  LNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFD  408
            +NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+GS+G+QL+ + SVT  D
Sbjct  1    MNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSGSLGYQLEPMSSVTNLD  57

Query  409  ISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF  588
            +S NNLG ++PYQLPPN+Q LNLA N F G +PYS+S+   L  LN+ HNQLQ  + V F
Sbjct  58   LSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLIVLNLGHNQLQQALNVDF  117

Query  589  VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENN  768
              L++LSTLD SFNSL G++PQT SSL++++ MYLQNN  TGTIDVLANLPLD LNV NN
Sbjct  118  QKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQLTGTIDVLANLPLDTLNVGNN  177

Query  769  HFTGWIPPQLQGINSLQTGGNSWNS  843
            HFTGWIP QL+ I  +Q  GN+W+S
Sbjct  178  HFTGWIPEQLKNI--IQKDGNAWSS  200



>ref|XP_008649053.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X3 [Zea mays]
Length=720

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 162/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +DVL+N+ L  LN+ +N+F+G IP +   I +L  GGNS+
Sbjct  204  VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSF  243



>gb|ACG49227.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=676

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 161/208 (77%), Gaps = 3/208 (1%)
 Frame = +1

Query  229  LNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFD  408
            +NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L L+G++ + ++ + S+   D
Sbjct  1    MNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLGLSGNLAYNMNTMDSLVELD  60

Query  409  ISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT  579
            +S NNLG    +PY LP   +++LNLA N F+G +PYSIS M  ++YLN++HNQL G++T
Sbjct  61   MSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSISTMPNIKYLNLNHNQLSGDIT  120

Query  580  VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNV  759
             +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN  TG+I+VLANLPLD+LNV
Sbjct  121  DIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQLTGSINVLANLPLDDLNV  180

Query  760  ENNHFTGWIPPQLQGINSLQTGGNSWNS  843
             NN FTGWIP +L+ INSLQT GNSW++
Sbjct  181  ANNRFTGWIPEELKKINSLQTDGNSWST  208



>ref|XP_006845116.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Amborella trichopoda]
Length=721

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 157/220 (71%), Gaps = 0/220 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L  L+++LN P QLT W +NGGDPCGESWKG+SCSG  VT IQI GL L+G+
Sbjct  29   TDQSDVGALEILYNALNDPVQLTGWKSNGGDPCGESWKGISCSGTAVTSIQIPGLGLSGT  88

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ L  L S+ T D+S NNL + +PYQLPPN   LNLA N F+G LPYSIS M  L YL
Sbjct  89   LGYGLSGLLSLITLDVSGNNLHDIIPYQLPPNTTFLNLANNNFSGNLPYSISGMTSLNYL  148

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N SHN L   +  +F +L +LS LD SFN+L G++P +F SL+N+  +YLQ+N  TG ++
Sbjct  149  NASHNSLSQSIGDLFTNLQDLSALDLSFNNLTGDLPNSFGSLSNLSTLYLQDNQLTGPVN  208

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            +L+++PL +LN+E N F+GWIP + + I +L   GNS+++
Sbjct  209  LLSSVPLSDLNIEKNRFSGWIPEKFKTIPNLSISGNSFDT  248



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 159/239 (67%), Gaps = 3/239 (1%)
 Frame = +1

Query  133  ALLIGFLLNA---PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            ALL+ F  +A   P S    TDP+D   L+ +++SLN P QLT WT + GDPCGESWKGV
Sbjct  21   ALLVLFSFSAILPPLSVYGATDPSDVQGLQVIYNSLNGPSQLTGWTNSSGDPCGESWKGV  80

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C G+ V  IQISGL L G+MG+ L    S+ T D+S NN+ +++PYQLPPN+  LNLA 
Sbjct  81   TCEGSAVVSIQISGLGLNGTMGYLLSNFLSLRTLDMSDNNIHDTIPYQLPPNLTNLNLAS  140

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N  TG  PYSIS M  L YLNVSHN +   +  +F  L  L+ LD S N+  G++P +F+
Sbjct  141  NNLTGSFPYSISTMVSLNYLNVSHNSISQSIGDIFAKLAGLTILDLSVNNFTGDLPNSFT  200

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            SL+N+  +YLQNN  TG + VL  LPL +LNV NN+F+GWIP +L+ I      GNS++
Sbjct  201  SLSNLSTLYLQNNQLTGPLSVLTGLPLTDLNVANNNFSGWIPSELRSIRKFIYDGNSFD  259



>ref|XP_008649054.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X4 [Zea mays]
Length=719

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 162/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +DVL+N+ L  LN+ +N+F+G IP +   I +L  GGNS+
Sbjct  204  VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSF  243



>ref|XP_008649051.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Zea mays]
Length=735

 Score =   239 bits (609),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 162/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +DVL+N+ L  LN+ +N+F+G IP +   I +L  GGNS+
Sbjct  204  VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSF  243



>ref|XP_008649052.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=734

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 162/220 (74%), Gaps = 0/220 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            +DVL+N+ L  LN+ +N+F+G IP +   I +L  GGNS+
Sbjct  204  VDVLSNISLATLNIADNNFSGMIPQEFSSIPNLIVGGNSF  243



>ref|XP_009386651.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD  D   L  L++SLNSP QL+ WT +GGDPCG SW GVSCSG+ V  I +SGL L GS
Sbjct  43   TDSLDVPALGVLYASLNSPRQLSGWTRSGGDPCGTSWLGVSCSGSAVVAIHLSGLGLNGS  102

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ L  L S+ T D+S NN+  ++PYQLPPN+  LNLAGN  +G LPYSIS M  L YL
Sbjct  103  LGYLLSDLLSLKTLDLSNNNIHETIPYQLPPNLTYLNLAGNDLSGNLPYSISSMVSLNYL  162

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHN L   V  +F  L +LS LD SFNS  G++P +F SL+N+ N+YLQ+N F G ++
Sbjct  163  NLSHNLLSQTVGDIFSDLQDLSELDLSFNSFTGDLPNSFGSLSNLSNLYLQDNQFMGPVN  222

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +L NL L  LN+ NN F GWIP + + I +L+ GGNS++
Sbjct  223  ILVNLDLTTLNIANNQFNGWIPQEFKSITNLEIGGNSFS  261



>ref|XP_006357453.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Solanum tuberosum]
Length=661

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 161/209 (77%), Gaps = 0/209 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            ++  L    +L  W ++GG+PC +SWKG+ CSG+ VTEI +SGL LTGS+GFQLD+L+ V
Sbjct  1    MYQYLKPHSKLDGWKSDGGNPCDDSWKGIKCSGSDVTEIDLSGLGLTGSLGFQLDKLEKV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNL +++PYQLPP  + L+L+GN F G +PYSISQM  L+ +N++HN+L G +
Sbjct  61   TYFDVSKNNLKDNIPYQLPPRTKHLDLSGNQFGGTVPYSISQMTELKSMNLNHNKLSGSL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN  756
            + +F  LT L+ +D S+NS++G++PQ   SL+++  +++QNN FTG+I+VLA+L LD+LN
Sbjct  121  SDLFGKLTKLTEMDLSYNSISGSLPQGLKSLSSLSKLHIQNNQFTGSINVLADLELDDLN  180

Query  757  VENNHFTGWIPPQLQGINSLQTGGNSWNS  843
            V NN F GWIP +L+ I +L+TGGNSW++
Sbjct  181  VANNQFNGWIPDELKDIKNLETGGNSWST  209



>ref|XP_009146553.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4 [Brassica rapa]
Length=688

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 162/237 (68%), Gaps = 1/237 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            + L I  L      A+A TD  D S L   + S+NSP +L+ W+++GGDPCG+SW G++C
Sbjct  8    IILFIACLGFFTSHALAKTDSQDVSALNDAYKSMNSPSKLSGWSSSGGDPCGDSWDGITC  67

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTEI++SG  L+GS+G+QL  LKS+T  D+S NNL  +LPYQLP N+  L  + N 
Sbjct  68   KGSSVTEIKVSGRGLSGSLGYQLANLKSLTYLDVSKNNLNGNLPYQLPENLVYLEASEND  127

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            F G +PYS+S M  L YLN   N L GE++ MF  L  L T+D S N L G +PQ+F++L
Sbjct  128  FNGNVPYSVSLMNDLTYLNFGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANL  187

Query  670  TNMKNMYLQNNVFTGTIDVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            T +K ++LQ+N F G+I+ L +LP +D++NV NN FTGWIP +L+ I +L+TGGN W
Sbjct  188  TGLKTIHLQDNQFKGSINSLRDLPQIDDVNVANNQFTGWIPNELKNIGNLETGGNRW  244



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   237 bits (605),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQLTGSLN  218

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            V + LPL  LNV NNHF+GWIP +L  I +    GNS++
Sbjct  219  VFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD  257



>gb|KDO78347.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=720

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            V + LPL  LNV NNHF+GWIP +L  I +    GNS++
Sbjct  219  VFSGLPLTTLNVANNHFSGWIPRELISIRTFIYDGNSFD  257



>ref|XP_009781363.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X2 [Nicotiana sylvestris]
Length=706

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 165/214 (77%), Gaps = 7/214 (3%)
 Frame = +1

Query  217  LFSSLNSPPQLTK------WTANGGDPCGE-SWKGVSCSGNRVTEIQISGLQLTGSMGFQ  375
            L SS   P  L+K      W  +GGDPCG+ SW+G+ CSG+ + EI +SGL L+GS+GFQ
Sbjct  24   LTSSFTIPVVLSKTDSRQGWKKDGGDPCGDDSWQGIKCSGSDIIEIDLSGLGLSGSLGFQ  83

Query  376  LDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH  555
            LD+L+ VT FD+S NNL +++PYQLPP  Q L+L+GN F+G +PYSISQMA L++LN++H
Sbjct  84   LDKLEKVTYFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFSGTVPYSISQMADLKFLNLNH  143

Query  556  NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN  735
            N++ G ++ MF  LT L+ +D SFNS++G++PQ+F SL+++  +++QNN FTG+I+VLA+
Sbjct  144  NKISGSLSDMFGQLTKLTEMDLSFNSISGSLPQSFRSLSSLSKLHMQNNQFTGSINVLAD  203

Query  736  LPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW  837
            LPLD+LNV NN  TGWIP +L+ I  L+TGGNSW
Sbjct  204  LPLDDLNVANNQLTGWIPDELKDIKKLETGGNSW  237



>gb|AAV64203.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 gb|AAV64241.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 tpg|DAA63621.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=693

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 159/232 (69%), Gaps = 25/232 (11%)
 Frame = +1

Query  148  FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT  327
            FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT
Sbjct  13   FLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVT  72

Query  328  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGL  504
             I++SG++L G++G+ ++QL ++   D+S NNLG S +PY LPPN+Q LNLA N FTG +
Sbjct  73   AIKLSGMRLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTV  132

Query  505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN  684
            PYSISQM  L                          LD S+N+ +G+IP +F+SLT++K 
Sbjct  133  PYSISQMVALR------------------------DLDLSYNTFSGDIPHSFNSLTSLKT  168

Query  685  MYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN  840
            +YLQNN F GTIDVL +LPL +LNVENN  TGWIP +L+GIN+LQT GNS+N
Sbjct  169  LYLQNNKFNGTIDVLTDLPLTDLNVENNQLTGWIPDKLKGINNLQTSGNSFN  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1826294691389