BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5233

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011098635.1|  PREDICTED: granule-bound starch synthase 2, ...  79.7    2e-13   Sesamum indicum [beniseed]
ref|XP_011098634.1|  PREDICTED: granule-bound starch synthase 2, ...  79.7    2e-13   Sesamum indicum [beniseed]
ref|XP_011098633.1|  PREDICTED: granule-bound starch synthase 2, ...  79.7    2e-13   Sesamum indicum [beniseed]
ref|NP_001274977.1|  granule-bound starch synthase 2, chloroplast...  75.9    3e-12   Solanum tuberosum [potatoes]
ref|XP_009628770.1|  PREDICTED: granule-bound starch synthase 2, ...  74.7    8e-12   Nicotiana tomentosiformis
ref|XP_004232219.1|  PREDICTED: granule-bound starch synthase 2, ...  74.3    9e-12   Solanum lycopersicum
emb|CDP02238.1|  unnamed protein product                              72.0    5e-11   Coffea canephora [robusta coffee]
ref|XP_002531856.1|  starch synthase, putative                        70.9    1e-10   Ricinus communis
gb|EYU34066.1|  hypothetical protein MIMGU_mgv1a002012mg              70.5    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_009778986.1|  PREDICTED: granule-bound starch synthase 2, ...  70.5    2e-10   Nicotiana sylvestris
ref|XP_002278470.2|  PREDICTED: granule-bound starch synthase 2, ...  68.2    8e-10   Vitis vinifera
ref|XP_011098636.1|  PREDICTED: granule-bound starch synthase 2, ...  68.2    9e-10   
ref|XP_008341578.1|  PREDICTED: LOW QUALITY PROTEIN: granule-boun...  65.5    6e-09   
gb|ABV25894.1|  starch synthase isoform II                            65.1    9e-09   Manihot esculenta [manioc]
gb|AAF13168.1|AF173900_1  granule bound starch synthase II precursor  65.1    9e-09   Manihot esculenta [manioc]
ref|XP_010693244.1|  PREDICTED: granule-bound starch synthase 2, ...  65.1    9e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010032498.1|  PREDICTED: granule-bound starch synthase 2, ...  64.7    1e-08   Eucalyptus grandis [rose gum]
gb|KCW51889.1|  hypothetical protein EUGRSUZ_J01349                   64.3    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010551848.1|  PREDICTED: starch synthase 2, chloroplastic/...  63.9    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_002882195.1|  hypothetical protein ARALYDRAFT_477411           63.9    2e-08   
gb|KJB33541.1|  hypothetical protein B456_006G016400                  63.9    2e-08   Gossypium raimondii
gb|KDO72588.1|  hypothetical protein CISIN_1g006770mg                 61.6    8e-08   Citrus sinensis [apfelsine]
gb|KDO72587.1|  hypothetical protein CISIN_1g006770mg                 62.0    8e-08   Citrus sinensis [apfelsine]
gb|KDO72589.1|  hypothetical protein CISIN_1g006770mg                 61.6    9e-08   Citrus sinensis [apfelsine]
gb|KDO72585.1|  hypothetical protein CISIN_1g006770mg                 61.6    1e-07   Citrus sinensis [apfelsine]
ref|XP_009360619.1|  PREDICTED: granule-bound starch synthase 2, ...  62.0    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_010917861.1|  PREDICTED: granule-bound starch synthase 2, ...  61.6    1e-07   
ref|XP_010917860.1|  PREDICTED: granule-bound starch synthase 2, ...  61.6    1e-07   
ref|XP_010917859.1|  PREDICTED: granule-bound starch synthase 2, ...  61.6    1e-07   Elaeis guineensis
gb|KDO72586.1|  hypothetical protein CISIN_1g006770mg                 61.6    1e-07   Citrus sinensis [apfelsine]
ref|XP_008365401.1|  PREDICTED: granule-bound starch synthase 2, ...  61.6    1e-07   Malus domestica [apple tree]
ref|XP_011467955.1|  PREDICTED: granule-bound starch synthase 2, ...  61.6    1e-07   Fragaria vesca subsp. vesca
ref|XP_006431165.1|  hypothetical protein CICLE_v10011124mg           61.6    1e-07   Citrus clementina [clementine]
ref|XP_008230773.1|  PREDICTED: granule-bound starch synthase 2, ...  61.2    1e-07   Prunus mume [ume]
ref|XP_007214968.1|  hypothetical protein PRUPE_ppa001734mg           61.2    1e-07   Prunus persica
gb|KDO72590.1|  hypothetical protein CISIN_1g006770mg                 60.8    2e-07   Citrus sinensis [apfelsine]
ref|XP_006482606.1|  PREDICTED: granule-bound starch synthase 2, ...  61.2    2e-07   Citrus sinensis [apfelsine]
gb|KJB33542.1|  hypothetical protein B456_006G016400                  61.2    2e-07   Gossypium raimondii
ref|XP_006827270.1|  PREDICTED: granule-bound starch synthase 2, ...  60.8    2e-07   Amborella trichopoda
ref|XP_010485530.1|  PREDICTED: starch synthase 2, chloroplastic/...  60.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009147403.1|  PREDICTED: starch synthase 2, chloroplastic/...  60.8    3e-07   Brassica rapa
gb|KHG22363.1|  Granule-bound starch synthase 2, chloroplastic/am...  60.5    3e-07   Gossypium arboreum [tree cotton]
ref|XP_007032555.1|  Starch synthase 2                                59.7    6e-07   
gb|KFK37580.1|  hypothetical protein AALP_AA3G001700                  59.3    8e-07   Arabis alpina [alpine rockcress]
emb|CDY37538.1|  BnaA05g34030D                                        58.9    1e-06   Brassica napus [oilseed rape]
ref|XP_006408470.1|  hypothetical protein EUTSA_v10020091mg           58.2    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010257576.1|  PREDICTED: granule-bound starch synthase 2, ...  58.2    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010463566.1|  PREDICTED: starch synthase 2, chloroplastic/...  57.4    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006297008.1|  hypothetical protein CARUB_v10013000mg           57.4    4e-06   Capsella rubella
ref|NP_186767.1|  starch synthase 2                                   57.4    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414882.1|  PREDICTED: starch synthase 2, chloroplastic/...  56.6    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008789825.1|  PREDICTED: granule-bound starch synthase 2, ...  56.6    6e-06   Phoenix dactylifera
ref|XP_008789818.1|  PREDICTED: granule-bound starch synthase 2, ...  56.6    6e-06   Phoenix dactylifera
ref|XP_011652235.1|  PREDICTED: granule-bound starch synthase 2, ...  56.2    7e-06   Cucumis sativus [cucumbers]
ref|XP_008443400.1|  PREDICTED: granule-bound starch synthase 2, ...  56.2    8e-06   Cucumis melo [Oriental melon]
emb|CDY43274.1|  BnaC05g48670D                                        56.2    8e-06   Brassica napus [oilseed rape]
gb|ABA64552.1|  starch synthase II                                    55.8    1e-05   Amaranthus hybridus subsp. cruentus [African-spinach]
gb|KHN13221.1|  Granule-bound starch synthase 2, chloroplastic/am...  55.1    2e-05   Glycine soja [wild soybean]
ref|XP_010088149.1|  Granule-bound starch synthase 2                  55.1    2e-05   
ref|XP_011035764.1|  PREDICTED: granule-bound starch synthase 2, ...  54.7    2e-05   Populus euphratica
ref|XP_011035763.1|  PREDICTED: granule-bound starch synthase 2, ...  54.7    2e-05   Populus euphratica
ref|NP_001235796.1|  starch synthase IIa-1                            54.7    2e-05   Glycine max [soybeans]
ref|XP_009376273.1|  PREDICTED: granule-bound starch synthase 2, ...  54.3    3e-05   Pyrus x bretschneideri [bai li]
emb|CDY55806.1|  BnaCnng29150D                                        53.9    4e-05   Brassica napus [oilseed rape]
sp|Q43093.1|SSG2_PEA  RecName: Full=Granule-bound starch synthase...  53.9    5e-05   Pisum sativum [garden pea]
ref|XP_012084711.1|  PREDICTED: granule-bound starch synthase 2, ...  53.1    8e-05   Jatropha curcas
emb|CBI22230.3|  unnamed protein product                              53.1    8e-05   Vitis vinifera
ref|XP_010661072.1|  PREDICTED: granule-bound starch synthase 2, ...  53.1    8e-05   Vitis vinifera
ref|NP_001235811.1|  starch synthase IIa-2                            52.8    1e-04   Glycine max [soybeans]
ref|XP_002324061.2|  glycogen synthase family protein                 52.0    2e-04   



>ref|XP_011098635.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X3 [Sesamum indicum]
Length=779

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 10/118 (8%)
 Frame = +3

Query  363  VPLLACRPRKSVQSGGSAD-SLIGFRRILSDD--igrlslrhgrsrhhiCRIERVKATGK  533
            +P+LA RPRK V+ GG +D +  GF R L+ +             R      + V+ATG+
Sbjct  27   IPILAFRPRKHVEVGGISDCNSAGFSRDLTLNLCSRLSQCCGRNGRRRRWTTQLVEATGE  86

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKS-QKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            ++ GG++G+E       D+LQATI KS  +VLAMQ DLL+QI+ERK+LVS I++SI+D
Sbjct  87   AAEGGESGDES------DSLQATIDKSMSQVLAMQKDLLQQISERKKLVSSIKNSIID  138



>ref|XP_011098634.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X2 [Sesamum indicum]
Length=792

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 10/118 (8%)
 Frame = +3

Query  363  VPLLACRPRKSVQSGGSAD-SLIGFRRILSDD--igrlslrhgrsrhhiCRIERVKATGK  533
            +P+LA RPRK V+ GG +D +  GF R L+ +             R      + V+ATG+
Sbjct  27   IPILAFRPRKHVEVGGISDCNSAGFSRDLTLNLCSRLSQCCGRNGRRRRWTTQLVEATGE  86

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKS-QKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            ++ GG++G+E       D+LQATI KS  +VLAMQ DLL+QI+ERK+LVS I++SI+D
Sbjct  87   AAEGGESGDES------DSLQATIDKSMSQVLAMQKDLLQQISERKKLVSSIKNSIID  138



>ref|XP_011098633.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Sesamum indicum]
Length=794

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 10/118 (8%)
 Frame = +3

Query  363  VPLLACRPRKSVQSGGSAD-SLIGFRRILSDD--igrlslrhgrsrhhiCRIERVKATGK  533
            +P+LA RPRK V+ GG +D +  GF R L+ +             R      + V+ATG+
Sbjct  27   IPILAFRPRKHVEVGGISDCNSAGFSRDLTLNLCSRLSQCCGRNGRRRRWTTQLVEATGE  86

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKS-QKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            ++ GG++G+E       D+LQATI KS  +VLAMQ DLL+QI+ERK+LVS I++SI+D
Sbjct  87   AAEGGESGDES------DSLQATIDKSMSQVLAMQKDLLQQISERKKLVSSIKNSIID  138



>ref|NP_001274977.1| granule-bound starch synthase 2, chloroplastic/amyloplastic precursor 
[Solanum tuberosum]
 sp|Q43847.3|SSY2_SOLTU RecName: Full=Granule-bound starch synthase 2, chloroplastic/amyloplastic; 
AltName: Full=Granule-bound starch synthase II; 
Short=GBSS-II; Short=SS II; Flags: Precursor [Solanum tuberosum]
 emb|CAA61241.2| soluble starch synthase II precursor [Solanum tuberosum]
Length=767

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 72/131 (55%), Gaps = 38/131 (29%)
 Frame = +3

Query  336  MESSIC-------RPTVPLLACRPRK-SVQSGGSADSLIGFRRILSDDigrlslrhgrsr  491
            ME+SI         P +PLLA RP+K S+  G S + +                      
Sbjct  1    MENSILLHSGNQFHPNLPLLALRPKKLSLIHGSSREQM----------------------  38

Query  492  hhiCRIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKE  671
                RI+RVKATG++S     G     +E  DALQ TI+KS+KVLAMQ DLL+QIAER++
Sbjct  39   ---WRIKRVKATGENS-----GEAASADESNDALQVTIEKSKKVLAMQQDLLQQIAERRK  90

Query  672  LVSKIRSSIVD  704
            +VS I+SS+ +
Sbjct  91   VVSSIKSSLAN  101



>ref|XP_009628770.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Nicotiana tomentosiformis]
Length=790

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 13/117 (11%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            +P  P  A +P+K          ++G  R+L +DI +LS+ HG SR    ++ R+KATGK
Sbjct  14   QPKFPFFALKPKKF------PFFVVGCSRVLGEDIVKLSIAHGSSRE---QMWRIKATGK  64

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            +S  G+A N ++E +  DALQATI+KS+KVLAMQ DLL+QIAER+++VS I+SS+ D
Sbjct  65   NS--GEATNIDDESD--DALQATIEKSKKVLAMQKDLLQQIAERRKVVSSIKSSLED  117



>ref|XP_004232219.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Solanum lycopersicum]
Length=768

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 71/130 (55%), Gaps = 36/130 (28%)
 Frame = +3

Query  336  MESSIC-------RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrh  494
            ME+SI         P++P  + RP+K  +  GS+   +                      
Sbjct  1    MENSIVLHTGNQFHPSLPFFSFRPKKLSRIHGSSREQM----------------------  38

Query  495  hiCRIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
               RI+RVKATG++S     G     +E +DALQ TI+KS+KVLAMQ DLL+QIAER+++
Sbjct  39   --WRIKRVKATGENS-----GEAASADESDDALQVTIEKSKKVLAMQQDLLQQIAERRKV  91

Query  675  VSKIRSSIVD  704
            VS I+SS+ D
Sbjct  92   VSSIKSSLAD  101



>emb|CDP02238.1| unnamed protein product [Coffea canephora]
Length=768

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 50/117 (43%), Positives = 63/117 (54%), Gaps = 29/117 (25%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP +PLLA RPR      GS        R L+                   ++R  ATG 
Sbjct  29   RPKLPLLAFRPRNLSSCCGST-----MTRKLT-------------------LQRFNATGS  64

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
             S     G  +  EE +DALQATI+KS++VLAMQ +LL QIAERK+LVS I+ SI+D
Sbjct  65   GS-----GEVQSGEESDDALQATIEKSKRVLAMQKELLNQIAERKKLVSSIKDSIID  116



>ref|XP_002531856.1| starch synthase, putative [Ricinus communis]
 gb|EEF30534.1| starch synthase, putative [Ricinus communis]
Length=754

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 8/67 (12%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSK  683
            R++ V+ATGK     D           DA+Q TI+KS+KVLAMQ DLL+QIAER++LVS 
Sbjct  55   RLKSVRATGKDGVNSDGSE--------DAIQTTIEKSKKVLAMQKDLLQQIAERRKLVSD  106

Query  684  IRSSIVD  704
            I+SSI+D
Sbjct  107  IKSSIID  113



>gb|EYU34066.1| hypothetical protein MIMGU_mgv1a002012mg [Erythranthe guttata]
Length=726

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 69/119 (58%), Gaps = 30/119 (25%)
 Frame = +3

Query  354  RPTVPLLACRPRK-SVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATG  530
            RP +P+LA RPRK S+ +G S     G RR  +                    + VKAT 
Sbjct  24   RPVIPILAYRPRKLSLCNGCSG----GRRRWAA--------------------QHVKATK  59

Query  531  KSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVDP  707
            + +   ++ +E +     DAL ATI+KS+KVLA+Q DLL+QIAERK+LVS I++SI DP
Sbjct  60   EGTERVESDDESD-----DALHATIEKSRKVLALQRDLLQQIAERKKLVSSIKNSINDP  113



>ref|XP_009778986.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Nicotiana sylvestris]
Length=795

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 53/64 (83%), Gaps = 4/64 (6%)
 Frame = +3

Query  513  RVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRS  692
            R+KATGKSS  G+A N ++E +  +ALQATI+KS+KVLAMQ DLL+QIAER+++VS I+S
Sbjct  58   RIKATGKSS--GEAANADDESD--EALQATIEKSKKVLAMQKDLLQQIAERRKVVSSIKS  113

Query  693  SIVD  704
            S  D
Sbjct  114  SFED  117



>ref|XP_002278470.2| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X2 [Vitis vinifera]
Length=777

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 5/64 (8%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+A G+ S  G+ G+  E     DA  ATI+KS+KVLAMQ DLL+QIAER++LVS I+SS
Sbjct  77   VRARGEGSVEGEDGDRLE-----DAFDATIEKSKKVLAMQRDLLQQIAERRKLVSSIKSS  131

Query  696  IVDP  707
            I++P
Sbjct  132  IINP  135



>ref|XP_011098636.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X4 [Sesamum indicum]
Length=768

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 30/115 (26%)
 Frame = +3

Query  363  VPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGKSSA  542
            +P+LA RPRK V+  G       +   L                       V+ATG+++ 
Sbjct  27   IPILAFRPRKHVECCGRNGRRRRWTTQL-----------------------VEATGEAAE  63

Query  543  GGDAGNeeeeeeeeDALQATIKKS-QKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            GG++G+E       D+LQATI KS  +VLAMQ DLL+QI+ERK+LVS I++SI+D
Sbjct  64   GGESGDES------DSLQATIDKSMSQVLAMQKDLLQQISERKKLVSSIKNSIID  112



>ref|XP_008341578.1| PREDICTED: LOW QUALITY PROTEIN: granule-bound starch synthase 
2, chloroplastic/amyloplastic [Malus domestica]
Length=778

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 20/119 (17%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQ------SGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIER  515
            R   P L  RPR S++      S G +   +G  R  +D           SR ++ RI+ 
Sbjct  28   RLRFPFLTNRPRSSIEVSGINASAGGSSEAVGMCRGQND---------WCSRGNLWRIKP  78

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRS  692
            + A GKSSA G+ G E E     D LQATI+KS+KVLA Q +LL+QIAER++L+S I+S
Sbjct  79   LHAIGKSSAQGEDGGEPE-----DPLQATIEKSKKVLATQRELLQQIAERRKLLSSIQS  132



>gb|ABV25894.1| starch synthase isoform II [Manihot esculenta]
Length=751

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 8/63 (13%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+ATGK    GD           D LQATI+KS+KVLA+Q DLL++IAER++LVS I+SS
Sbjct  55   VRATGKEGVSGDGSE--------DTLQATIEKSKKVLALQRDLLQKIAERRKLVSSIQSS  106

Query  696  IVD  704
            + D
Sbjct  107  VGD  109



>gb|AAF13168.1|AF173900_1 granule bound starch synthase II precursor [Manihot esculenta]
Length=751

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 8/63 (13%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+ATGK    GD           D LQATI+KS+KVLA+Q DLL++IAER++LVS I+SS
Sbjct  55   VRATGKEGVSGDGSE--------DTLQATIEKSKKVLALQRDLLQKIAERRKLVSSIQSS  106

Query  696  IVD  704
            + D
Sbjct  107  VGD  109



>ref|XP_010693244.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010693245.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
Length=801

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  549  DAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            D+G  E+ +E EDA+QATI+KS KVLAMQ +LL+QIAERK+LVS I+SSIV+
Sbjct  82   DSGEAEDNKETEDAIQATIEKSNKVLAMQKELLQQIAERKKLVSSIKSSIVN  133



>ref|XP_010032498.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Eucalyptus grandis]
 gb|KCW51888.1| hypothetical protein EUGRSUZ_J01349 [Eucalyptus grandis]
Length=790

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+A G  SA GD G+  E E   D LQATI+KS++VLAMQ DLL QIAER++LVS I++S
Sbjct  86   VRAAGMGSAEGDDGDSLETE---DKLQATIEKSKRVLAMQRDLLNQIAERRKLVSTIKNS  142

Query  696  IV  701
             +
Sbjct  143  TI  144



>gb|KCW51889.1| hypothetical protein EUGRSUZ_J01349 [Eucalyptus grandis]
Length=732

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+A G  SA GD G+  E E   D LQATI+KS++VLAMQ DLL QIAER++LVS I++S
Sbjct  86   VRAAGMGSAEGDDGDSLETE---DKLQATIEKSKRVLAMQRDLLNQIAERRKLVSTIKNS  142

Query  696  IV  701
             +
Sbjct  143  TI  144



>ref|XP_010551848.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic isoform 
X1 [Tarenaya hassleriana]
Length=846

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +3

Query  513  RVKATGKSSAGGDAGNeeeeee------eeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            RV+ATG  SA G  G++ +E+       +EDALQATI+KS+KVL MQ DLL+QIAER++L
Sbjct  67   RVEATGSDSAEGARGDKPQEDALLQDEEQEDALQATIEKSKKVLDMQRDLLQQIAERRKL  126

Query  675  VSKIRSSI  698
            VS I+ S+
Sbjct  127  VSSIKDSV  134



>ref|XP_002882195.1| hypothetical protein ARALYDRAFT_477411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58454.1| hypothetical protein ARALYDRAFT_477411 [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 12/67 (18%)
 Frame = +3

Query  507  IERVKATG----KSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            + RV+ATG    +S++GGD          EDALQATI+KS+KVLAMQ +LL+QIAER++L
Sbjct  61   VRRVEATGSDSSESASGGDE--------PEDALQATIEKSKKVLAMQRNLLQQIAERRKL  112

Query  675  VSKIRSS  695
            VS I+ S
Sbjct  113  VSSIKES  119



>gb|KJB33541.1| hypothetical protein B456_006G016400 [Gossypium raimondii]
Length=756

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 6/64 (9%)
 Frame = +3

Query  513  RVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRS  692
            RV +TG +   GD  + E      ++LQATI+KS+KVLAMQ DLL+QIAER++LVS I+ 
Sbjct  60   RVASTGDAVGLGDGDDSE------NSLQATIEKSKKVLAMQRDLLQQIAERRKLVSSIKG  113

Query  693  SIVD  704
            S+ D
Sbjct  114  SVTD  117



>gb|KDO72588.1| hypothetical protein CISIN_1g006770mg [Citrus sinensis]
Length=405

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>gb|KDO72587.1| hypothetical protein CISIN_1g006770mg [Citrus sinensis]
Length=478

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>gb|KDO72589.1| hypothetical protein CISIN_1g006770mg [Citrus sinensis]
Length=397

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>gb|KDO72585.1| hypothetical protein CISIN_1g006770mg [Citrus sinensis]
Length=632

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>ref|XP_009360619.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Pyrus x bretschneideri]
Length=778

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 64/114 (56%), Gaps = 20/114 (18%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQ------SGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIER  515
            R   P L  RPR S++      S G +   +G  R  +D           SR ++ RI+ 
Sbjct  28   RLRFPFLTNRPRSSIEVGGINASAGGSSEAVGMCRGQND---------WCSRGNLWRIKP  78

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            + A GKSSA G+ G E E     D LQATI+KS+KVLA Q +LL+QIAER++LV
Sbjct  79   LNAIGKSSAQGEDGGEPE-----DPLQATIEKSKKVLATQRELLQQIAERRKLV  127



>ref|XP_010917861.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X3 [Elaeis guineensis]
Length=749

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +3

Query  504  RIERVKATGKSS---AGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            R E ++A G S+      ++G+E+ E+  +DAL+ATI+KS+KVLAMQ +LLRQI ER++L
Sbjct  89   RGEALRAVGGSNDDEGQEESGDEDVEDITDDALRATIRKSKKVLAMQRNLLRQIVERRKL  148

Query  675  VSKIRSSIVD  704
            VS I+ S+V+
Sbjct  149  VSSIKDSVVN  158



>ref|XP_010917860.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Elaeis guineensis]
Length=767

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +3

Query  504  RIERVKATGKSS---AGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            R E ++A G S+      ++G+E+ E+  +DAL+ATI+KS+KVLAMQ +LLRQI ER++L
Sbjct  89   RGEALRAVGGSNDDEGQEESGDEDVEDITDDALRATIRKSKKVLAMQRNLLRQIVERRKL  148

Query  675  VSKIRSSIVD  704
            VS I+ S+V+
Sbjct  149  VSSIKDSVVN  158



>ref|XP_010917859.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Elaeis guineensis]
Length=801

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +3

Query  504  RIERVKATGKSS---AGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            R E ++A G S+      ++G+E+ E+  +DAL+ATI+KS+KVLAMQ +LLRQI ER++L
Sbjct  89   RGEALRAVGGSNDDEGQEESGDEDVEDITDDALRATIRKSKKVLAMQRNLLRQIVERRKL  148

Query  675  VSKIRSSIVD  704
            VS I+ S+V+
Sbjct  149  VSSIKDSVVN  158



>gb|KDO72586.1| hypothetical protein CISIN_1g006770mg [Citrus sinensis]
Length=617

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>ref|XP_008365401.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Malus domestica]
Length=777

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 7/65 (11%)
 Frame = +3

Query  504  RIERVKATGKSSAGG-DAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVS  680
            RI+ ++A  KSSA G DAG  E      DALQATI+KS+KVLA+Q +LL+QI+ER++LVS
Sbjct  75   RIKPLRAIRKSSAEGEDAGEPE------DALQATIEKSKKVLAVQRELLQQISERRKLVS  128

Query  681  KIRSS  695
             I++S
Sbjct  129  SIQNS  133



>ref|XP_011467955.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Fragaria vesca subsp. vesca]
Length=783

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSK  683
            R++ V+A  K S  G+  N E E    DALQATI+KS+KVLAMQ  LL+QIAER++LVS 
Sbjct  75   RVKPVRAIRKVSVDGEEDNGESE----DALQATIEKSKKVLAMQRGLLQQIAERRKLVSS  130

Query  684  IRSSI  698
            I S I
Sbjct  131  ITSDI  135



>ref|XP_006431165.1| hypothetical protein CICLE_v10011124mg [Citrus clementina]
 gb|ESR44405.1| hypothetical protein CICLE_v10011124mg [Citrus clementina]
Length=769

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>ref|XP_008230773.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Prunus mume]
Length=773

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 5/58 (9%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            +IE ++ATGK S  G+ G E E     DAL+ATI+KS+KVLAMQ DLL+QIAER++LV
Sbjct  69   KIEPLRATGKVSVEGEDGGEPE-----DALRATIEKSKKVLAMQRDLLQQIAERRKLV  121



>ref|XP_007214968.1| hypothetical protein PRUPE_ppa001734mg [Prunus persica]
 gb|EMJ16167.1| hypothetical protein PRUPE_ppa001734mg [Prunus persica]
Length=773

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 5/58 (9%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            +IE ++ATGK S  G+ G E E     DAL+ATI+KS+KVLAMQ DLL+QIAER++LV
Sbjct  69   KIEPLRATGKVSVEGEDGGEPE-----DALRATIEKSKKVLAMQRDLLQQIAERRKLV  121



>gb|KDO72590.1| hypothetical protein CISIN_1g006770mg [Citrus sinensis]
Length=349

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SFRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>ref|XP_006482606.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Citrus sinensis]
Length=769

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 17/117 (15%)
 Frame = +3

Query  354  RPTVPLLACRPRKSVQSGGSADSLIGFRRILSDDigrlslrhgrsrhhiCRIERVKATGK  533
            RP+    A RP+KS       +S+ GF                    H+ +++ VKATG 
Sbjct  28   RPSSSFSAFRPKKSPIFAFLNNSVSGF------------SCRSNKSGHLLKVKHVKATGA  75

Query  534  SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
                 ++GNE E     D+LQATI+KS+KVLAMQ  LL+QI+ER++LVS I+S I +
Sbjct  76   GFVEDESGNEPE-----DSLQATIEKSKKVLAMQKQLLQQISERRKLVSSIKSDIAN  127



>gb|KJB33542.1| hypothetical protein B456_006G016400 [Gossypium raimondii]
Length=544

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 6/64 (9%)
 Frame = +3

Query  513  RVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRS  692
            RV +TG +   GD  + E      ++LQATI+KS+KVLAMQ DLL+QIAER++LVS I+ 
Sbjct  60   RVASTGDAVGLGDGDDSE------NSLQATIEKSKKVLAMQRDLLQQIAERRKLVSSIKG  113

Query  693  SIVD  704
            S+ D
Sbjct  114  SVTD  117



>ref|XP_006827270.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Amborella trichopoda]
 gb|ERM94507.1| hypothetical protein AMTR_s00010p00263000 [Amborella trichopoda]
Length=763

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +3

Query  501  CRIERVKATGK--SSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            CR    K  G   + A G   N EE +  EDAL AT++KS+KVLAMQ DLL+QIAERK++
Sbjct  52   CRERSKKGRGSLVAKAAGKDLNNEEGDVTEDALNATLEKSKKVLAMQKDLLQQIAERKKI  111

Query  675  VSKIRSSIVDP  707
            VS I+ +I  P
Sbjct  112  VSSIKKNIGSP  122



>ref|XP_010485530.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like 
[Camelina sativa]
Length=804

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 4/63 (6%)
 Frame = +3

Query  507  IERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKI  686
            + RV+AT  S +    G +E E    DALQATI+KS+KVLAMQ +LL+QIAER++LVS I
Sbjct  63   VRRVEATSSSDSSEPTGGDEPE----DALQATIEKSKKVLAMQRNLLQQIAERRKLVSSI  118

Query  687  RSS  695
            + S
Sbjct  119  KES  121



>ref|XP_009147403.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic [Brassica 
rapa]
Length=791

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+ATG  S+G  +G++E+E    DALQATI KS+KVL MQ +LL QIAER++LVS I+ S
Sbjct  63   VEATGPDSSGSPSGDDEQE----DALQATIDKSKKVLDMQRNLLHQIAERRKLVSSIKES  118



>gb|KHG22363.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Gossypium 
arboreum]
Length=750

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 6/62 (10%)
 Frame = +3

Query  513  RVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRS  692
            RV +TG     GD  + E      ++LQATI+KS+KVLAMQ DLL+QIAER++LVS I+ 
Sbjct  60   RVASTGDVVGFGDGDDSE------NSLQATIEKSKKVLAMQRDLLQQIAERRKLVSSIKG  113

Query  693  SI  698
            S+
Sbjct  114  SV  115



>ref|XP_007032555.1| Starch synthase 2 [Theobroma cacao]
 gb|EOY03481.1| Starch synthase 2 [Theobroma cacao]
Length=754

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  591  LQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
             QATI+KS+KVLAMQ DLL+QIAER++LVS I+SSI D
Sbjct  81   FQATIEKSKKVLAMQRDLLQQIAERRKLVSSIKSSITD  118



>gb|KFK37580.1| hypothetical protein AALP_AA3G001700 [Arabis alpina]
Length=807

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 5/63 (8%)
 Frame = +3

Query  507  IERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKI  686
            ++RV+ATG      D+     ++E+EDALQATI+KS+KVL MQ +LL+QIAER++LVS I
Sbjct  61   VKRVEATGS-----DSSEAVNDDEQEDALQATIEKSKKVLEMQRNLLQQIAERRKLVSSI  115

Query  687  RSS  695
              S
Sbjct  116  EES  118



>emb|CDY37538.1| BnaA05g34030D [Brassica napus]
Length=677

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 4/60 (7%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+ATG  S+G  +G++E+E    DALQATI KS+KVL MQ +LL QIAER++LVS I+ S
Sbjct  63   VEATGPDSSGSPSGDDEQE----DALQATIDKSKKVLDMQRNLLHQIAERRKLVSSIKES  118



>ref|XP_006408470.1| hypothetical protein EUTSA_v10020091mg [Eutrema salsugineum]
 gb|ESQ49923.1| hypothetical protein EUTSA_v10020091mg [Eutrema salsugineum]
Length=805

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 5/60 (8%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+ATG  S+   +G+E+E     DALQATI+KS+KVL MQ +LL QIAER++LVS I+ S
Sbjct  64   VEATGPDSSEAASGDEQE-----DALQATIEKSKKVLDMQRNLLHQIAERRKLVSSIKES  118



>ref|XP_010257576.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Nelumbo nucifera]
Length=782

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 5/58 (9%)
 Frame = +3

Query  519  KATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRS  692
            +A GK S  G   ++       D LQATI+KS+KVLAMQ DLL+QIAER++LVS I++
Sbjct  82   RAVGKDSVEGKDSDDSV-----DTLQATIEKSKKVLAMQKDLLQQIAERRKLVSSIKN  134



>ref|XP_010463566.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic [Camelina 
sativa]
Length=805

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            DALQATI+KS+KVLAMQ +LL+QIAER++LVS I+ S
Sbjct  85   DALQATIEKSKKVLAMQRNLLQQIAERRKLVSSIKES  121



>ref|XP_006297008.1| hypothetical protein CARUB_v10013000mg [Capsella rubella]
 gb|EOA29906.1| hypothetical protein CARUB_v10013000mg [Capsella rubella]
Length=804

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            DALQATI+KS+KVLAMQ +LL+QIAER++LVS I+ S
Sbjct  79   DALQATIEKSKKVLAMQRNLLQQIAERRKLVSSIKES  115



>ref|NP_186767.1| starch synthase 2 [Arabidopsis thaliana]
 sp|Q9MAC8.1|SSY2_ARATH RecName: Full=Starch synthase 2, chloroplastic/amyloplastic; 
Short=AtSS2; AltName: Full=Soluble starch synthase II; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF26156.1|AC008261_13 putative glycogen synthase [Arabidopsis thaliana]
 gb|AAK96659.1| putative glycogen synthase [Arabidopsis thaliana]
 gb|AAO00915.1| putative glycogen synthase [Arabidopsis thaliana]
 gb|AEE73621.1| starch synthase 2 [Arabidopsis thaliana]
 gb|AHL38788.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=792

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            DALQATI KS+KVLAMQ +LL QIAER++LVS I+ S  D
Sbjct  72   DALQATIDKSKKVLAMQRNLLHQIAERRKLVSSIKESTPD  111



>ref|XP_010414882.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010415549.1| PREDICTED: starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Camelina sativa]
Length=802

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            DALQATI KS+KVLAMQ +LL+QIAER++LVS I+ S
Sbjct  85   DALQATIDKSKKVLAMQRNLLQQIAERRKLVSSIKES  121



>ref|XP_008789825.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X2 [Phoenix dactylifera]
Length=799

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  504  RIERVKATGKSS--AGGDAG-NeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            R E ++A G S+   G + G +E+ E+  +DAL+ATI+KS+KVLA+Q  LL+QI ER+EL
Sbjct  84   RGEALRAVGGSNLDEGQEEGSDEDVEDITDDALRATIRKSKKVLAVQRKLLQQIVERREL  143

Query  675  VSKIRSSIVD  704
            VS I+ S+V+
Sbjct  144  VSSIKDSVVN  153



>ref|XP_008789818.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
isoform X1 [Phoenix dactylifera]
Length=801

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +3

Query  504  RIERVKATGKSS--AGGDAG-NeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKEL  674
            R E ++A G S+   G + G +E+ E+  +DAL+ATI+KS+KVLA+Q  LL+QI ER+EL
Sbjct  86   RGEALRAVGGSNLDEGQEEGSDEDVEDITDDALRATIRKSKKVLAVQRKLLQQIVERREL  145

Query  675  VSKIRSSIVD  704
            VS I+ S+V+
Sbjct  146  VSSIKDSVVN  155



>ref|XP_011652235.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Cucumis sativus]
Length=816

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            +A+QATI+KS+KVLAMQ  LL QIAERK+LVS I+S+  D
Sbjct  81   EAIQATIEKSKKVLAMQQQLLEQIAERKKLVSSIKSTSAD  120



>ref|XP_008443400.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Cucumis melo]
Length=796

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSI  698
            +A+QATI+KS+KVLAMQ  LL QIAERK+LVS I+S++
Sbjct  81   EAIQATIEKSKKVLAMQQQLLEQIAERKKLVSSIKSTV  118



>emb|CDY43274.1| BnaC05g48670D [Brassica napus]
Length=698

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 4/60 (7%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSS  695
            V+AT   S+G  +G++E+E    DALQATI KS+KVL MQ +LL QIAER++LVS I+ S
Sbjct  63   VEATAPDSSGSPSGDDEQE----DALQATIDKSKKVLDMQRNLLHQIAERRKLVSSIKES  118



>gb|ABA64552.1| starch synthase II [Amaranthus cruentus]
Length=809

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSK  683
            R  R+KA G     G+  ++E+++E EDAL A I+KS KV AMQ +LL QIAERK+LVS 
Sbjct  69   RYNRLKAIGDDLNEGEH-SKEDKDENEDALDAAIEKSNKVSAMQKELLLQIAERKKLVSS  127

Query  684  IRSSIVD  704
            IR+S+++
Sbjct  128  IRNSVIN  134



>gb|KHN13221.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Glycine 
soja]
Length=776

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  501  CRIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVS  680
            C +E+ K    S+ G  +G  E+++E E+ LQATI+KS+KVLA+Q +LL+QI+ER++LVS
Sbjct  64   CLVEKNKHI--SALGKSSGTSEDKDESEEVLQATIEKSKKVLALQRELLQQISERRKLVS  121

Query  681  KIRS  692
             I S
Sbjct  122  SINS  125



>ref|XP_010088149.1| Granule-bound starch synthase 2 [Morus notabilis]
 gb|EXB31961.1| Granule-bound starch synthase 2 [Morus notabilis]
Length=946

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  585  DALQATIKKSQKVLAMQNDLLRQIAERKELVSKIRSSIVD  704
            + LQA I+KS+KVLA+Q DLL+QIAER++LVS I+SS VD
Sbjct  96   ETLQANIEKSKKVLAVQRDLLQQIAERRKLVSSIKSSTVD  135



>ref|XP_011035764.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X2 [Populus euphratica]
Length=740

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 8/54 (15%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            V+AT +  A GD           DALQA+I+KS+KVLAMQ DLL+QIAER+++V
Sbjct  59   VRATVEEGASGDESE--------DALQASIEKSKKVLAMQRDLLQQIAERRKMV  104



>ref|XP_011035763.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Populus euphratica]
Length=755

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 8/54 (15%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            V+AT +  A GD           DALQA+I+KS+KVLAMQ DLL+QIAER+++V
Sbjct  59   VRATVEEGASGDESE--------DALQASIEKSKKVLAMQRDLLQQIAERRKMV  104



>ref|NP_001235796.1| starch synthase IIa-1 [Glycine max]
 gb|ACL98479.1| starch synthase IIa-1 precursor [Glycine max]
Length=757

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  501  CRIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVS  680
            C +E+ K    S+ G  +G  E+++E E+ LQATI+KS+KVLA+Q +LL+QI+ER++LVS
Sbjct  45   CLVEKNKHI--SALGKSSGTSEDKDESEEVLQATIEKSKKVLALQRELLQQISERRKLVS  102

Query  681  KIRS  692
             I S
Sbjct  103  SINS  106



>ref|XP_009376273.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like 
[Pyrus x bretschneideri]
Length=777

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = +3

Query  504  RIERVKATGKSSAGG-DAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            RI+ ++A  KSS  G DAG  E      DALQATI+KS+KVLA+Q +LL+QI+ER++LV
Sbjct  75   RIKPLRAIRKSSVEGEDAGEPE------DALQATIEKSKKVLAVQKELLQQISERRKLV  127



>emb|CDY55806.1| BnaCnng29150D [Brassica napus]
Length=553

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSK  683
            R + V   G  S+G  +G ++E++E  DALQATI KS+KVL MQ +LL QIAER++LVS 
Sbjct  52   RWKFVSCVGSDSSGAASGGDDEQQE--DALQATIDKSKKVLDMQRNLLHQIAERRKLVSS  109

Query  684  IRSS  695
            I+ +
Sbjct  110  IKDT  113



>sp|Q43093.1|SSG2_PEA RecName: Full=Granule-bound starch synthase 2, chloroplastic/amyloplastic; 
AltName: Full=Granule-bound starch synthase II; 
Short=GBSS-II; Flags: Precursor [Pisum sativum]
 emb|CAA61269.1| glycogen (starch) synthase [Pisum sativum]
Length=752

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +3

Query  510  ERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVSKIR  689
            + V+A GKS    + G+  E+    D + ATI+KS+KVLA+Q +L++QIAERK+LVS I 
Sbjct  54   QHVRAVGKSFGADENGDGSED----DVVNATIEKSKKVLALQRELIQQIAERKKLVSSID  109

Query  690  S  692
            S
Sbjct  110  S  110



>ref|XP_012084711.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
[Jatropha curcas]
 gb|KDP27156.1| hypothetical protein JCGZ_19855 [Jatropha curcas]
Length=749

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 8/58 (14%)
 Frame = +3

Query  504  RIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELV  677
            R + V+AT K     D  +        D LQATI+KS+KVLA+Q DLL+QI+ER++LV
Sbjct  54   RFKPVRATAKEGVNDDGSD--------DPLQATIEKSKKVLALQRDLLQQISERRKLV  103



>emb|CBI22230.3| unnamed protein product [Vitis vinifera]
Length=788

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 33/92 (36%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQ--------------  653
            V+A G+ S  G+ G+  E     DA  ATI+KS+KVLAMQ DLL+Q              
Sbjct  77   VRARGEGSVEGEDGDRLE-----DAFDATIEKSKKVLAMQRDLLQQNGHEDPKVGVEQDF  131

Query  654  --------------IAERKELVSKIRSSIVDP  707
                          IAER++LVS I+SSI++P
Sbjct  132  DVGAASVSVTFNISIAERRKLVSSIKSSIINP  163



>ref|XP_010661072.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010661073.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010661074.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic 
isoform X1 [Vitis vinifera]
Length=805

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 48/92 (52%), Gaps = 33/92 (36%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQ--------------  653
            V+A G+ S  G+ G+  E     DA  ATI+KS+KVLAMQ DLL+Q              
Sbjct  77   VRARGEGSVEGEDGDRLE-----DAFDATIEKSKKVLAMQRDLLQQNGHEDPKVGVEQDF  131

Query  654  --------------IAERKELVSKIRSSIVDP  707
                          IAER++LVS I+SSI++P
Sbjct  132  DVGAASVSVTFNISIAERRKLVSSIKSSIINP  163



>ref|NP_001235811.1| starch synthase IIa-2 [Glycine max]
 gb|ACL98480.1| starch synthase IIa-2 precursor [Glycine max]
 gb|KHN45503.1| Granule-bound starch synthase 2, chloroplastic/amyloplastic [Glycine 
soja]
Length=774

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  501  CRIERVKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERKELVS  680
            C +E+ K    S+ G  +G  E++++ ++ LQATI+KS+KVLA+Q +LL+QI+ERK+LVS
Sbjct  63   CLVEKNKHI--SALGKSSGTSEDKDDSDEVLQATIEKSKKVLALQRELLQQISERKKLVS  120

Query  681  KIRS  692
             I S
Sbjct  121  SINS  124



>ref|XP_002324061.2| glycogen synthase family protein [Populus trichocarpa]
 gb|EEF04194.2| glycogen synthase family protein [Populus trichocarpa]
Length=742

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 8/51 (16%)
 Frame = +3

Query  516  VKATGKSSAGGDAGNeeeeeeeeDALQATIKKSQKVLAMQNDLLRQIAERK  668
            V+AT +  A GD           DALQA+I+KS+KVLAMQ DLL+QIAER+
Sbjct  59   VRATVEEGASGDESE--------DALQASIEKSKKVLAMQRDLLQQIAERR  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1267397107886