BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig523

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772211.1|  PREDICTED: probable serine/threonine-protein...    224   8e-65   Nicotiana sylvestris
ref|XP_006359171.1|  PREDICTED: probable serine/threonine-protein...    223   2e-64   Solanum tuberosum [potatoes]
ref|XP_004229357.1|  PREDICTED: probable serine/threonine-protein...    222   9e-64   Solanum lycopersicum
emb|CDP07694.1|  unnamed protein product                                211   2e-63   Coffea canephora [robusta coffee]
ref|XP_011087152.1|  PREDICTED: probable serine/threonine-protein...    219   4e-63   Sesamum indicum [beniseed]
ref|XP_009607019.1|  PREDICTED: probable serine/threonine-protein...    220   5e-63   Nicotiana tomentosiformis
ref|XP_011087144.1|  PREDICTED: AP2-associated protein kinase 1 i...    219   5e-63   Sesamum indicum [beniseed]
ref|XP_011087141.1|  PREDICTED: AP2-associated protein kinase 1 i...    219   6e-63   Sesamum indicum [beniseed]
ref|XP_012092619.1|  PREDICTED: serine/threonine-protein kinase 10      214   3e-61   Jatropha curcas
gb|EYU27100.1|  hypothetical protein MIMGU_mgv1a022935mg                213   6e-61   Erythranthe guttata [common monkey flower]
gb|AFK44489.1|  unknown                                                 198   2e-60   Lotus japonicus
emb|CAN60313.1|  hypothetical protein VITISV_036304                     204   2e-60   Vitis vinifera
emb|CBI32193.3|  unnamed protein product                                206   4e-60   Vitis vinifera
ref|XP_010659600.1|  PREDICTED: probable serine/threonine-protein...    211   6e-60   Vitis vinifera
ref|XP_010659599.1|  PREDICTED: probable serine/threonine-protein...    211   6e-60   Vitis vinifera
ref|XP_008461768.1|  PREDICTED: probable serine/threonine-protein...    210   1e-59   Cucumis melo [Oriental melon]
ref|XP_004149621.1|  PREDICTED: probable serine/threonine-protein...    209   2e-59   Cucumis sativus [cucumbers]
ref|XP_010659601.1|  PREDICTED: probable serine/threonine-protein...    209   4e-59   Vitis vinifera
gb|EPS73129.1|  hypothetical protein M569_01626                         201   4e-59   Genlisea aurea
dbj|BAD95980.1|  Ser/Thr protein kinase                                 198   2e-58   Lotus japonicus
ref|XP_004306499.1|  PREDICTED: AP2-associated protein kinase 1 i...    206   3e-58   Fragaria vesca subsp. vesca
ref|XP_011468799.1|  PREDICTED: AP2-associated protein kinase 1 i...    206   3e-58   Fragaria vesca subsp. vesca
ref|XP_006369447.1|  hypothetical protein POPTR_0001s23520g             206   3e-58   
ref|XP_002512151.1|  serine/threonine protein kinase, putative          205   4e-58   Ricinus communis
ref|XP_010257450.1|  PREDICTED: serine/threonine-protein kinase p...    206   6e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010678702.1|  PREDICTED: probable serine/threonine-protein...    205   7e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010257448.1|  PREDICTED: serine/threonine-protein kinase p...    206   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008808088.1|  PREDICTED: AP2-associated protein kinase 1-like    206   7e-58   Phoenix dactylifera
ref|XP_010257449.1|  PREDICTED: serine/threonine-protein kinase p...    206   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_007052606.1|  Serine/threonine-protein kinase DDB_G0280111...    205   8e-58   
ref|XP_007052605.1|  Serine/threonine-protein kinase DDB_G0280111...    205   8e-58   
ref|XP_007052604.1|  Serine/threonine-protein kinase DDB_G0280111...    205   8e-58   
ref|XP_008392404.1|  PREDICTED: AP2-associated protein kinase 1         205   1e-57   Malus domestica [apple tree]
ref|XP_009339572.1|  PREDICTED: AP2-associated protein kinase 1         205   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_010265879.1|  PREDICTED: probable serine/threonine-protein...    204   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010265881.1|  PREDICTED: probable serine/threonine-protein...    204   2e-57   Nelumbo nucifera [Indian lotus]
gb|KHG06229.1|  putative serine/threonine-protein kinase                204   2e-57   Gossypium arboreum [tree cotton]
ref|XP_003531422.1|  PREDICTED: probable serine/threonine-protein...    204   3e-57   Glycine max [soybeans]
gb|KDO46086.1|  hypothetical protein CISIN_1g005558mg                   204   4e-57   Citrus sinensis [apfelsine]
ref|XP_007149359.1|  hypothetical protein PHAVU_005G063700g             203   4e-57   Phaseolus vulgaris [French bean]
ref|XP_006482821.1|  PREDICTED: probable serine/threonine-protein...    203   4e-57   Citrus sinensis [apfelsine]
ref|XP_007149360.1|  hypothetical protein PHAVU_005G063700g             203   4e-57   Phaseolus vulgaris [French bean]
ref|XP_006482824.1|  PREDICTED: probable serine/threonine-protein...    203   4e-57   Citrus sinensis [apfelsine]
ref|XP_006439043.1|  hypothetical protein CICLE_v10030862mg             203   4e-57   Citrus clementina [clementine]
ref|XP_006482823.1|  PREDICTED: probable serine/threonine-protein...    203   5e-57   Citrus sinensis [apfelsine]
ref|XP_006439041.1|  hypothetical protein CICLE_v10030862mg             203   5e-57   Citrus clementina [clementine]
gb|KDO46085.1|  hypothetical protein CISIN_1g005558mg                   203   5e-57   Citrus sinensis [apfelsine]
ref|XP_006439040.1|  hypothetical protein CICLE_v10030862mg             203   5e-57   
gb|KJB22766.1|  hypothetical protein B456_004G065000                    202   6e-57   Gossypium raimondii
ref|XP_008231321.1|  PREDICTED: AP2-associated protein kinase 1 i...    203   7e-57   Prunus mume [ume]
ref|XP_008231319.1|  PREDICTED: AP2-associated protein kinase 1 i...    203   7e-57   Prunus mume [ume]
ref|XP_008231320.1|  PREDICTED: AP2-associated protein kinase 1 i...    203   7e-57   Prunus mume [ume]
gb|KJB22767.1|  hypothetical protein B456_004G065000                    202   7e-57   Gossypium raimondii
gb|KJB22768.1|  hypothetical protein B456_004G065000                    202   7e-57   Gossypium raimondii
ref|XP_007220628.1|  hypothetical protein PRUPE_ppa002321mg             202   9e-57   
ref|XP_004513162.1|  PREDICTED: probable serine/threonine-protein...    202   1e-56   
ref|XP_010522378.1|  PREDICTED: probable serine/threonine-protein...    201   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_010522383.1|  PREDICTED: probable serine/threonine-protein...    201   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_010943528.1|  PREDICTED: AP2-associated protein kinase 1-like    201   4e-56   Elaeis guineensis
dbj|BAD34081.1|  putative AAK1 protein                                  192   7e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010542987.1|  PREDICTED: AP2-associated protein kinase 1-l...    199   8e-56   Tarenaya hassleriana [spider flower]
ref|XP_010542991.1|  PREDICTED: AP2-associated protein kinase 1-l...    199   8e-56   Tarenaya hassleriana [spider flower]
ref|XP_010670934.1|  PREDICTED: actin-regulating kinase PRK1-like       199   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003546865.1|  PREDICTED: probable serine/threonine-protein...    198   2e-55   Glycine max [soybeans]
ref|XP_010027725.1|  PREDICTED: AP2-associated protein kinase 1 i...    198   3e-55   Eucalyptus grandis [rose gum]
ref|XP_010027724.1|  PREDICTED: AP2-associated protein kinase 1 i...    198   3e-55   
ref|XP_008805476.1|  PREDICTED: AP2-associated protein kinase 1-like    198   4e-55   Phoenix dactylifera
gb|KEH33173.1|  Serine/Threonine kinase family protein                  197   5e-55   Medicago truncatula
ref|XP_002881248.1|  hypothetical protein ARALYDRAFT_482227             196   1e-54   
dbj|BAD34080.1|  cyclin G-associated kinase-like protein                196   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010913910.1|  PREDICTED: probable serine/threonine-protein...    196   2e-54   Elaeis guineensis
ref|XP_006647439.1|  PREDICTED: probable serine/threonine-protein...    195   5e-54   Oryza brachyantha
emb|CDY52551.1|  BnaA05g35100D                                          185   6e-54   Brassica napus [oilseed rape]
ref|XP_006410418.1|  hypothetical protein EUTSA_v10016354mg             194   7e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010469540.1|  PREDICTED: probable serine/threonine-protein...    192   7e-54   Camelina sativa [gold-of-pleasure]
ref|NP_850199.1|  protein kinase superfamily protein                    194   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAL60023.1|  putative serine/threonine protein kinase                193   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413940.1|  PREDICTED: probable serine/threonine-protein...    193   1e-53   Camelina sativa [gold-of-pleasure]
ref|NP_565756.1|  protein kinase superfamily protein                    193   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293803.1|  hypothetical protein CARUB_v10022785mg             193   2e-53   Capsella rubella
ref|XP_010469538.1|  PREDICTED: probable serine/threonine-protein...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010469539.1|  PREDICTED: probable serine/threonine-protein...    192   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008677437.1|  PREDICTED: uncharacterized protein LOC100304...    192   4e-53   
ref|XP_004952949.1|  PREDICTED: AP2-associated protein kinase 1-l...    191   4e-53   Setaria italica
ref|XP_009408443.1|  PREDICTED: AP2-associated protein kinase 1 {...    191   5e-53   
ref|XP_009143925.1|  PREDICTED: probable serine/threonine-protein...    191   5e-53   Brassica rapa
ref|XP_004952948.1|  PREDICTED: AP2-associated protein kinase 1-l...    192   6e-53   Setaria italica
ref|XP_010509956.1|  PREDICTED: probable serine/threonine-protein...    191   8e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006850020.1|  PREDICTED: probable serine/threonine-protein...    191   1e-52   Amborella trichopoda
ref|XP_004956476.1|  PREDICTED: probable serine/threonine-protein...    191   1e-52   Setaria italica
ref|XP_010095876.1|  putative serine/threonine-protein kinase           190   2e-52   
ref|XP_003575255.1|  PREDICTED: probable serine/threonine-protein...    189   4e-52   Brachypodium distachyon [annual false brome]
ref|XP_010235619.1|  PREDICTED: probable serine/threonine-protein...    189   4e-52   Brachypodium distachyon [annual false brome]
gb|EMT28285.1|  Putative serine/threonine-protein kinase                189   5e-52   
ref|XP_009395097.1|  PREDICTED: AP2-associated protein kinase 1 {...    188   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX79504.1|  BnaC03g18400D                                          186   4e-51   
ref|XP_009394517.1|  PREDICTED: AP2-associated protein kinase 1 {...    187   4e-51   
ref|XP_009132906.1|  PREDICTED: probable serine/threonine-protein...    186   5e-51   Brassica rapa
emb|CDX84704.1|  BnaA03g15260D                                          185   1e-50   
tpg|DAA39365.1|  TPA: putative protein kinase superfamily protein       182   8e-50   
ref|XP_008671591.1|  PREDICTED: probable serine/threonine-protein...    182   2e-49   
ref|XP_011042010.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    177   3e-49   Populus euphratica
gb|AFW72092.1|  putative protein kinase superfamily protein             179   5e-49   
gb|AFW72091.1|  putative protein kinase superfamily protein             181   6e-49   
gb|EAZ08411.1|  hypothetical protein OsI_30675                          174   9e-47   Oryza sativa Indica Group [Indian rice]
dbj|BAD26025.1|  putative AAK1 protein                                  174   9e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010237997.1|  PREDICTED: AP2-associated protein kinase 1-like    174   1e-46   Brachypodium distachyon [annual false brome]
dbj|BAJ97005.1|  predicted protein                                      172   7e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09791.1|  Putative serine/threonine-protein kinase                170   3e-45   
gb|EEE69334.1|  hypothetical protein OsJ_28650                          172   5e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002993350.1|  hypothetical protein SELMODRAFT_187420             161   9e-44   
ref|XP_002972735.1|  hypothetical protein SELMODRAFT_98319              165   1e-43   
ref|XP_006660487.1|  PREDICTED: AP2-associated protein kinase 1-like    160   2e-41   Oryza brachyantha
ref|XP_001769351.1|  predicted protein                                  148   3e-37   
emb|CDY12158.1|  BnaC04g11880D                                          123   8e-29   Brassica napus [oilseed rape]
ref|XP_011087160.1|  PREDICTED: AP2-associated protein kinase 1 i...  92.8    6e-18   Sesamum indicum [beniseed]
gb|ENN75844.1|  hypothetical protein YQE_07573                        93.2    8e-18   Dendroctonus ponderosae
gb|ERL88847.1|  hypothetical protein D910_06229                       93.2    8e-18   Dendroctonus ponderosae
ref|XP_967193.1|  PREDICTED: cyclin-G-associated kinase               92.4    2e-17   Tribolium castaneum [rust-red flour beetle]
ref|XP_012023085.1|  PREDICTED: cyclin-G-associated kinase isofor...  90.9    5e-17   Ovis aries musimon
ref|XP_012023082.1|  PREDICTED: cyclin-G-associated kinase isofor...  90.9    6e-17   Ovis aries musimon
pdb|4C59|A  Chain A, Structure Of Gak Kinase In Complex With Nano...  86.7    2e-16   Lama glama
ref|XP_010804661.1|  PREDICTED: cyclin-G-associated kinase isofor...  89.4    2e-16   
ref|NP_001039549.1|  cyclin-G-associated kinase                       89.4    2e-16   Bos taurus [bovine]
tpg|DAA28426.1|  TPA: cyclin-G-associated kinase                      89.4    2e-16   Bos taurus [bovine]
ref|XP_004927169.1|  PREDICTED: cyclin-G-associated kinase-like       86.3    2e-16   Bombyx mori [silk moth]
ref|XP_011427792.1|  PREDICTED: cyclin-G-associated kinase-like       89.0    2e-16   Crassostrea gigas
dbj|BAK62989.1|  cyclin G-associated kinase                           86.7    2e-16   Pan troglodytes
ref|XP_011792184.1|  PREDICTED: cyclin-G-associated kinase isofor...  88.6    3e-16   Colobus angolensis palliatus
gb|EKC40964.1|  Cyclin G-associated kinase                            88.6    3e-16   Crassostrea gigas
ref|XP_003934667.1|  PREDICTED: cyclin-G-associated kinase isofor...  88.2    5e-16   Saimiri boliviensis boliviensis
ref|XP_011598855.1|  PREDICTED: cyclin-G-associated kinase-like       84.3    5e-16   Aquila chrysaetos canadensis
ref|XP_010992167.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  87.8    5e-16   Camelus dromedarius [camel]
ref|XP_009445459.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    5e-16   
ref|XP_008961966.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    5e-16   Pan paniscus [bonobo]
ref|XP_008016367.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    5e-16   Chlorocebus sabaeus
ref|XP_005272327.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    5e-16   Homo sapiens [man]
ref|XP_011743105.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Macaca nemestrina [pigtail macaque]
ref|XP_008016366.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Chlorocebus sabaeus
ref|XP_005554310.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Macaca fascicularis [crab eating macaque]
ref|XP_011511733.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Homo sapiens [man]
ref|XP_009445456.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   
ref|XP_008961964.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Pan paniscus [bonobo]
ref|XP_009445453.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   
ref|XP_008961962.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Pan paniscus [bonobo]
ref|XP_005272325.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Homo sapiens [man]
ref|XP_011511730.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Homo sapiens [man]
ref|XP_009445452.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   
ref|XP_011743104.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Macaca nemestrina [pigtail macaque]
ref|XP_011914720.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Cercocebus atys
ref|XP_011826281.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Mandrillus leucophaeus
ref|XP_010373626.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Rhinopithecus roxellana
ref|XP_008016365.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Chlorocebus sabaeus
ref|NP_005246.2|  cyclin-G-associated kinase isoform 1                87.8    6e-16   Homo sapiens [man]
dbj|BAA22623.1|  HsGAK                                                87.8    6e-16   Homo sapiens [man]
ref|XP_005554309.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Macaca fascicularis [crab eating macaque]
ref|XP_004038357.1|  PREDICTED: cyclin-G-associated kinase isoform 1  87.8    6e-16   
ref|XP_003811350.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Pan paniscus [bonobo]
gb|EHH14197.1|  Cyclin-G-associated kinase                            87.8    6e-16   Macaca mulatta [rhesus macaque]
ref|XP_001140835.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   
ref|XP_011914718.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Cercocebus atys
ref|XP_011511729.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Homo sapiens [man]
ref|XP_010992219.1|  PREDICTED: cyclin-G-associated kinase            86.7    6e-16   Camelus dromedarius [camel]
ref|XP_011511728.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Homo sapiens [man]
ref|XP_009445451.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   
ref|XP_008961961.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Pan paniscus [bonobo]
ref|XP_011511727.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Homo sapiens [man]
ref|XP_009445450.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   
ref|XP_008961960.1|  PREDICTED: cyclin-G-associated kinase isofor...  87.8    6e-16   Pan paniscus [bonobo]
ref|XP_003801191.1|  PREDICTED: cyclin-G-associated kinase            87.4    7e-16   
ref|XP_006747975.1|  PREDICTED: cyclin-G-associated kinase-like       87.4    8e-16   Leptonychotes weddellii
gb|EAW82645.1|  cyclin G associated kinase, isoform CRA_b             86.7    8e-16   Homo sapiens [man]
ref|XP_004396292.1|  PREDICTED: cyclin-G-associated kinase            87.0    9e-16   Odobenus rosmarus divergens
gb|EDL20101.1|  cyclin G associated kinase, isoform CRA_c             81.6    9e-16   Mus musculus [mouse]
ref|XP_003280582.1|  PREDICTED: cyclin-G-associated kinase            87.0    1e-15   
pdb|4O38|A  Chain A, Crystal Structure Of The Human Cyclin G Asso...  84.3    1e-15   Homo sapiens [man]
ref|XP_536279.4|  PREDICTED: cyclin-G-associated kinase isoform X7    87.0    1e-15   Canis lupus familiaris [dogs]
ref|XP_004432258.1|  PREDICTED: cyclin-G-associated kinase            86.7    1e-15   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005504640.1|  PREDICTED: cyclin-G-associated kinase            86.7    1e-15   Columba livia [carrier pigeon]
gb|KDR23238.1|  Cyclin G-associated kinase                            86.3    2e-15   Zootermopsis nevadensis
gb|EMC87866.1|  Cyclin G-associated kinase                            86.3    2e-15   
ref|NP_001125100.1|  cyclin-G-associated kinase                       86.3    2e-15   Pongo abelii [orang utan]
ref|XP_005001604.1|  PREDICTED: cyclin-G-associated kinase isofor...  86.3    2e-15   
ref|XP_003465097.1|  PREDICTED: cyclin-G-associated kinase isofor...  86.3    2e-15   Cavia porcellus [guinea pig]
ref|XP_424873.4|  PREDICTED: cyclin-G-associated kinase               85.9    2e-15   Gallus gallus [bantam]
ref|XP_010227060.1|  PREDICTED: cyclin-G-associated kinase            85.9    2e-15   Tinamus guttatus
ref|XP_004319454.1|  PREDICTED: cyclin-G-associated kinase-like       85.9    2e-15   
ref|XP_008062193.1|  PREDICTED: cyclin-G-associated kinase            85.9    2e-15   Carlito syrichta
ref|XP_004265273.1|  PREDICTED: cyclin-G-associated kinase            85.9    2e-15   
ref|XP_010787144.1|  PREDICTED: cyclin-G-associated kinase-like       82.4    2e-15   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006874199.1|  PREDICTED: cyclin-G-associated kinase            85.9    2e-15   Chrysochloris asiatica
gb|EDL20100.1|  cyclin G associated kinase, isoform CRA_b             80.1    3e-15   Mus musculus [mouse]
ref|XP_006259318.1|  PREDICTED: cyclin-G-associated kinase            85.5    3e-15   Alligator mississippiensis
ref|XP_002187781.1|  PREDICTED: cyclin-G-associated kinase            85.5    3e-15   Taeniopygia guttata
ref|XP_004383590.1|  PREDICTED: cyclin-G-associated kinase            85.5    4e-15   Trichechus manatus latirostris
ref|XP_005486323.1|  PREDICTED: cyclin-G-associated kinase            85.1    4e-15   Zonotrichia albicollis
ref|XP_005530967.1|  PREDICTED: cyclin-G-associated kinase            85.1    4e-15   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005154929.1|  PREDICTED: cyclin-G-associated kinase            85.1    4e-15   Melopsittacus undulatus
ref|XP_004617496.1|  PREDICTED: cyclin-G-associated kinase            85.1    4e-15   Sorex araneus [Eurasian shrew]
ref|XP_005061068.1|  PREDICTED: cyclin-G-associated kinase            85.1    4e-15   Ficedula albicollis
ref|XP_007671015.1|  PREDICTED: cyclin-G-associated kinase isofor...  85.1    4e-15   Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001016350.2|  cyclin-G-associated kinase                       85.1    4e-15   Xenopus tropicalis [western clawed frog]
ref|XP_007953955.1|  PREDICTED: cyclin-G-associated kinase isofor...  85.1    4e-15   Orycteropus afer afer
ref|XP_007671016.1|  PREDICTED: cyclin-G-associated kinase isofor...  85.1    4e-15   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_003341497.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  85.1    5e-15   
ref|XP_007671018.1|  PREDICTED: cyclin-G-associated kinase isofor...  85.1    5e-15   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007671017.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    5e-15   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_005359727.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    5e-15   Microtus ochrogaster [prairie voles]
ref|XP_005359726.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    5e-15   
ref|XP_005359725.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    5e-15   
ref|XP_008840008.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    6e-15   Nannospalax galili
ref|XP_008840007.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    6e-15   Nannospalax galili
ref|XP_008840006.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    6e-15   Nannospalax galili
ref|XP_008840005.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    6e-15   Nannospalax galili
ref|XP_006985869.1|  PREDICTED: cyclin-G-associated kinase            84.7    6e-15   Peromyscus maniculatus bairdii
ref|XP_006534969.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    6e-15   
ref|XP_006534968.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.7    6e-15   Mus musculus [mouse]
gb|EDL20099.1|  cyclin G associated kinase, isoform CRA_a             84.7    6e-15   Mus musculus [mouse]
dbj|BAE27365.1|  unnamed protein product                              84.7    6e-15   Mus musculus [mouse]
ref|NP_705797.1|  cyclin-G-associated kinase isoform 1                84.7    6e-15   Mus musculus [mouse]
sp|Q99KY4.2|GAK_MOUSE  RecName: Full=Cyclin-G-associated kinase       84.7    6e-15   Mus musculus [mouse]
ref|XP_004656112.1|  PREDICTED: cyclin-G-associated kinase            84.7    6e-15   Jaculus jaculus
gb|EDL20105.1|  cyclin G associated kinase, isoform CRA_g             84.7    6e-15   Mus musculus [mouse]
ref|XP_004847543.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   
ref|XP_006250646.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Rattus norvegicus [brown rat]
ref|XP_006250645.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Rattus norvegicus [brown rat]
ref|XP_005077467.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005077466.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   
ref|NP_112292.1|  cyclin-G-associated kinase                          84.3    8e-15   Rattus norvegicus [brown rat]
ref|XP_004847542.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Heterocephalus glaber [naked mole rat]
ref|XP_004847541.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Heterocephalus glaber [naked mole rat]
ref|XP_005408741.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Chinchilla lanigera
ref|XP_004847540.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Heterocephalus glaber [naked mole rat]
ref|XP_005319114.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Ictidomys tridecemlineatus
ref|XP_005319113.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Ictidomys tridecemlineatus
ref|XP_004847539.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   
ref|XP_004847536.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Heterocephalus glaber [naked mole rat]
ref|XP_005408740.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   
ref|XP_005408739.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.3    8e-15   Chinchilla lanigera
ref|XP_004579463.1|  PREDICTED: cyclin-G-associated kinase            84.0    8e-15   Ochotona princeps [southern American pika]
ref|XP_008250941.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  84.0    9e-15   
ref|XP_004624694.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.0    9e-15   
ref|XP_004624693.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.0    9e-15   Octodon degus
ref|XP_007557930.1|  PREDICTED: cyclin-G-associated kinase            84.0    9e-15   Poecilia formosa
ref|XP_008416260.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.0    9e-15   Poecilia reticulata
ref|XP_008416258.1|  PREDICTED: cyclin-G-associated kinase isofor...  84.0    9e-15   Poecilia reticulata
gb|AAH63606.1|  GAK protein                                           83.2    9e-15   Homo sapiens [man]
ref|XP_011551363.1|  PREDICTED: cyclin-G-associated kinase            84.0    9e-15   Plutella xylostella [cabbage moth]
ref|XP_006790164.1|  PREDICTED: cyclin-G-associated kinase-like       83.6    1e-14   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004546976.1|  PREDICTED: cyclin-G-associated kinase-like i...  83.6    1e-14   
ref|XP_004546975.1|  PREDICTED: cyclin-G-associated kinase-like i...  83.6    1e-14   
ref|XP_005738184.1|  PREDICTED: cyclin-G-associated kinase-like       83.6    1e-14   Pundamilia nyererei
ref|XP_004546974.1|  PREDICTED: cyclin-G-associated kinase-like i...  83.6    1e-14   
ref|XP_005924577.1|  PREDICTED: cyclin-G-associated kinase-like       83.6    1e-14   
ref|XP_007467967.1|  PREDICTED: cyclin-G-associated kinase            83.6    1e-14   Lipotes vexillifer [baiji]
ref|XP_009052187.1|  hypothetical protein LOTGIDRAFT_174596           83.2    2e-14   Lottia gigantea
ref|XP_009299489.1|  PREDICTED: cyclin-G-associated kinase isofor...  83.2    2e-14   Danio rerio [leopard danio]
ref|XP_009299488.1|  PREDICTED: cyclin-G-associated kinase isofor...  83.2    2e-14   Danio rerio [leopard danio]
ref|XP_011914723.1|  PREDICTED: cyclin-G-associated kinase isofor...  83.2    2e-14   Cercocebus atys
ref|XP_011914722.1|  PREDICTED: cyclin-G-associated kinase isofor...  83.2    2e-14   Cercocebus atys
ref|XP_011914719.1|  PREDICTED: cyclin-G-associated kinase isofor...  83.2    2e-14   Cercocebus atys
ref|XP_011914717.1|  PREDICTED: cyclin-G-associated kinase isofor...  83.2    2e-14   Cercocebus atys
ref|XP_005801068.1|  PREDICTED: cyclin-G-associated kinase-like       83.2    2e-14   
ref|XP_001742841.1|  hypothetical protein                             81.6    2e-14   Monosiga brevicollis MX1
ref|XP_005309018.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Chrysemys picta bellii
ref|XP_006893652.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Elephantulus edwardii [Cape long-eared elephant shrew]
emb|CBY34407.1|  unnamed protein product                              82.4    2e-14   Oikopleura dioica
emb|CBY18714.1|  unnamed protein product                              82.4    2e-14   Oikopleura dioica
gb|KFB52665.1|  AGAP003715-PA-like protein                            82.8    2e-14   Anopheles sinensis
ref|XP_008281749.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Stegastes partitus
ref|XP_008281748.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Stegastes partitus
ref|XP_008281747.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Stegastes partitus
ref|XP_008281746.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Stegastes partitus
ref|XP_009299490.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.8    2e-14   Danio rerio [leopard danio]
ref|XP_003411399.1|  PREDICTED: cyclin-G-associated kinase            82.4    3e-14   
ref|XP_005459853.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.4    3e-14   Oreochromis niloticus
ref|XP_005459852.1|  PREDICTED: cyclin-G-associated kinase isofor...  82.4    3e-14   Oreochromis niloticus
ref|XP_006008247.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  82.0    5e-14   
ref|XP_011477121.1|  PREDICTED: cyclin-G-associated kinase isofor...  81.6    5e-14   
ref|XP_011477119.1|  PREDICTED: cyclin-G-associated kinase isofor...  81.6    6e-14   
ref|XP_007641164.1|  PREDICTED: cyclin-G-associated kinase isofor...  81.6    6e-14   
emb|CAG08624.1|  unnamed protein product                              81.6    6e-14   
ref|XP_007641163.1|  PREDICTED: cyclin-G-associated kinase isofor...  81.6    6e-14   
ref|XP_003502409.1|  PREDICTED: cyclin-G-associated kinase isofor...  81.6    6e-14   
gb|ETN63491.1|  cyclin G-associated kinase                            81.3    7e-14   
ref|XP_012023084.1|  PREDICTED: cyclin-G-associated kinase isofor...  80.9    1e-13   
ref|XP_012023083.1|  PREDICTED: cyclin-G-associated kinase isofor...  80.9    1e-13   
ref|XP_012023081.1|  PREDICTED: cyclin-G-associated kinase isofor...  80.9    1e-13   
ref|XP_310244.7|  AGAP003715-PA                                       80.5    1e-13   
gb|KFO25685.1|  Cyclin-G-associated kinase                            80.5    1e-13   
gb|KGB40797.1|  Cyclin-G-associated kinase                            80.1    2e-13   
ref|XP_008334592.1|  PREDICTED: cyclin-G-associated kinase-like i...  80.1    2e-13   
ref|XP_008334591.1|  PREDICTED: cyclin-G-associated kinase-like i...  80.1    2e-13   
ref|XP_008334590.1|  PREDICTED: cyclin-G-associated kinase-like i...  80.1    2e-13   
ref|XP_011614316.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  79.7    2e-13   
ref|XP_005095147.1|  PREDICTED: BMP-2-inducible protein kinase-li...  79.7    2e-13   
ref|XP_005095146.1|  PREDICTED: BMP-2-inducible protein kinase-li...  79.7    2e-13   
ref|XP_004521204.1|  PREDICTED: cyclin-G-associated kinase-like i...  79.3    3e-13   
ref|XP_004521203.1|  PREDICTED: cyclin-G-associated kinase-like i...  79.3    3e-13   
ref|XP_008333412.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  78.2    7e-13   
ref|XP_004993486.1|  NAK protein kinase                               77.8    9e-13   
ref|XP_005177594.2|  PREDICTED: uncharacterized protein LOC101899618  77.4    1e-12   
ref|XP_011680532.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  77.4    1e-12   
ref|XP_011180272.1|  PREDICTED: probable serine/threonine-protein...  77.4    1e-12   
ref|XP_011180270.1|  PREDICTED: mucin-4-like isoform X1               77.4    1e-12   
ref|XP_006815331.1|  PREDICTED: cyclin-G-associated kinase-like       77.0    2e-12   
ref|XP_003737181.1|  PREDICTED: cyclin-G-associated kinase-like       76.6    2e-12   
ref|XP_009562989.1|  PREDICTED: cyclin-G-associated kinase            76.6    2e-12   
emb|CCD82118.1|  serine/threonine kinase                              76.6    2e-12   
ref|XP_010887763.1|  PREDICTED: cyclin-G-associated kinase isofor...  76.3    3e-12   
ref|XP_010887761.1|  PREDICTED: cyclin-G-associated kinase isofor...  76.3    3e-12   
ref|XP_011210451.1|  PREDICTED: cyclin-G-associated kinase            75.9    4e-12   
emb|CDR17154.1|  serine/threonine protein kinase, putative            75.5    4e-12   
ref|XP_001650843.1|  AAEL005425-PA                                    75.5    5e-12   
ref|XP_001183215.2|  PREDICTED: AP2-associated protein kinase 1       75.1    6e-12   
ref|XP_002002050.1|  GI17169                                          75.1    8e-12   
emb|CDS52482.1|  serine/threonine protein kinase, putative            74.3    8e-12   
ref|XP_011293498.1|  PREDICTED: cyclin-G-associated kinase            74.7    8e-12   
ref|XP_008622630.1|  NAK protein kinase                               74.3    9e-12   
ref|XP_009860888.1|  PREDICTED: AP2-associated protein kinase 1-like  73.9    1e-11   
ref|XP_008549661.1|  PREDICTED: cyclin-G-associated kinase            74.3    1e-11   
dbj|GAM19078.1|  hypothetical protein SAMD00019534_022530             74.3    1e-11   
ref|XP_002052662.1|  GJ17674                                          74.3    1e-11   
gb|ETW47992.1|  NAK protein kinase                                    73.6    1e-11   
ref|XP_641248.1|  hypothetical protein DDB_G0280111                   74.3    1e-11   
gb|ETW35160.1|  NAK protein kinase                                    73.6    1e-11   
gb|ETW29800.1|  NAK protein kinase                                    73.2    1e-11   
gb|ETW59946.1|  NAK protein kinase                                    73.6    1e-11   
ref|XP_001989216.1|  GH11600                                          74.3    1e-11   
ref|XP_011178096.1|  PREDICTED: cyclin-G-associated kinase            73.9    1e-11   
ref|XP_006626815.1|  PREDICTED: BMP-2-inducible protein kinase-like   73.9    2e-11   
gb|EUD74684.1|  NAK protein kinase                                    73.6    2e-11   
gb|ELU08049.1|  hypothetical protein CAPTEDRAFT_20343                 73.9    2e-11   
gb|EHJ76158.1|  hypothetical protein KGM_16646                        73.6    2e-11   
gb|EWC87212.1|  NAK protein kinase                                    73.2    2e-11   
gb|KIH69066.1|  hypothetical protein ANCDUO_00593                     70.9    2e-11   
emb|CDO65747.1|  serine/threonine protein kinase, putative            73.2    2e-11   
dbj|BAH70871.1|  ACYPI007546                                          68.6    2e-11   
gb|EUT81971.1|  NAK protein kinase                                    73.2    2e-11   
gb|KIO24181.1|  hypothetical protein M407DRAFT_9071                   73.2    2e-11   
gb|KDR18287.1|  AP2-associated protein kinase 1                       73.6    2e-11   
ref|XP_001614000.1|  cyclin g-associated kinase                       73.2    2e-11   
gb|ETW56100.1|  hypothetical protein PFUGPA_01883                     73.2    2e-11   
gb|ETW17328.1|  hypothetical protein PFFVO_03760                      73.2    2e-11   
gb|ETW41321.1|  NAK protein kinase                                    73.2    3e-11   
gb|EUR67530.1|  NAK protein kinase                                    73.2    3e-11   
ref|XP_006454173.1|  hypothetical protein AGABI2DRAFT_113930          73.2    3e-11   
ref|XP_007325758.1|  hypothetical protein AGABI1DRAFT_124351          73.2    3e-11   
emb|CDU20974.1|  serine/threonine protein kinase, putative            72.8    3e-11   
gb|EWC75117.1|  NAK protein kinase                                    73.2    3e-11   
gb|ETB62031.1|  NAK protein kinase                                    72.8    3e-11   
ref|XP_001350860.1|  cyclin g-associated kinase, putative             72.8    3e-11   
ref|XP_007181552.1|  PREDICTED: cyclin-G-associated kinase            72.8    3e-11   
ref|NP_995725.1|  Numb-associated kinase, isoform C                   72.4    3e-11   
gb|ENN71442.1|  hypothetical protein YQE_11861                        72.4    3e-11   
gb|ERL92584.1|  hypothetical protein D910_09897                       72.4    4e-11   
gb|AAM50024.1|  SD07306p                                              72.4    4e-11   
ref|XP_011640359.1|  PREDICTED: cyclin-G-associated kinase            72.8    4e-11   
ref|XP_007895169.1|  PREDICTED: BMP-2-inducible protein kinase is...  72.8    4e-11   
ref|XP_007895168.1|  PREDICTED: BMP-2-inducible protein kinase is...  72.8    4e-11   
ref|XP_007895167.1|  PREDICTED: BMP-2-inducible protein kinase is...  72.8    4e-11   
gb|KIJ66181.1|  hypothetical protein HYDPIDRAFT_109176                72.4    5e-11   
ref|XP_008185577.1|  PREDICTED: cyclin-G-associated kinase            72.4    5e-11   
gb|KDQ31201.1|  hypothetical protein PLEOSDRAFT_166468                72.4    5e-11   
ref|XP_008187196.1|  PREDICTED: AP2-associated protein kinase 1-like  71.6    5e-11   
gb|KIJ53530.1|  hypothetical protein M422DRAFT_154775                 70.9    6e-11   
ref|XP_003394812.1|  PREDICTED: hypothetical protein LOC100649017     72.0    7e-11   
ref|XP_003485667.1|  PREDICTED: hypothetical protein LOC100743336     72.0    7e-11   
ref|XP_001607688.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.6    7e-11   
ref|XP_006569449.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.0    7e-11   
ref|XP_006611765.1|  PREDICTED: uncharacterized protein LOC102671523  72.0    8e-11   
ref|XP_011162063.1|  PREDICTED: cyclin-G-associated kinase            71.6    8e-11   
gb|KJP87608.1|  NAK protein kinase                                    71.2    9e-11   
gb|EEZ99550.1|  hypothetical protein TcasGA2_TC000132                 71.6    9e-11   
ref|XP_008199560.1|  PREDICTED: serine/threonine-protein kinase HSL1  71.6    9e-11   
gb|KDR85677.1|  hypothetical protein GALMADRAFT_234684                71.6    9e-11   
ref|XP_001659927.1|  AAEL009305-PA                                    71.2    1e-10   
ref|XP_001962020.1|  GF14645                                          71.6    1e-10   
ref|XP_012135003.1|  PREDICTED: uncharacterized protein LOC100882...  71.2    1e-10   
ref|XP_012135002.1|  PREDICTED: uncharacterized protein LOC100882...  71.2    1e-10   
ref|XP_010900693.1|  PREDICTED: BMP-2-inducible protein kinase        70.9    1e-10   
ref|NP_001286075.1|  Numb-associated kinase, isoform E                70.9    1e-10   
ref|XP_008818509.1|  NAK protein kinase                               70.9    1e-10   
gb|EYB87444.1|  hypothetical protein Y032_0263g606                    70.9    1e-10   
ref|XP_002066824.1|  GK24682                                          70.9    1e-10   
gb|EYB87446.1|  hypothetical protein Y032_0263g606                    70.5    2e-10   
ref|XP_001356891.2|  GA10457                                          70.9    2e-10   
ref|XP_002015291.1|  GL19623                                          70.9    2e-10   
ref|XP_002039039.1|  GM17048                                          70.9    2e-10   
ref|XP_002090632.1|  GE12690                                          70.9    2e-10   
ref|XP_001974326.1|  GG21669                                          70.9    2e-10   
ref|NP_477165.1|  Numb-associated kinase, isoform A                   70.9    2e-10   
gb|AAF15596.1|AF197910_1  Numb-associated kinase                      70.9    2e-10   
ref|XP_002079851.1|  GD21795                                          70.9    2e-10   
gb|KJA28499.1|  hypothetical protein HYPSUDRAFT_197351                70.9    2e-10   
ref|XP_004474659.1|  PREDICTED: cyclin-G-associated kinase            70.5    2e-10   
emb|CDS29298.1|  cyclin g associated kinase                           70.5    2e-10   
ref|XP_007250558.1|  PREDICTED: BMP-2-inducible protein kinase        70.5    2e-10   
ref|XP_011866350.1|  PREDICTED: cyclin-G-associated kinase            70.5    2e-10   
gb|KIM47542.1|  hypothetical protein M413DRAFT_439207                 70.5    2e-10   
ref|XP_001635989.1|  predicted protein                                70.1    2e-10   
gb|KFD58715.1|  hypothetical protein M513_00408                       70.1    2e-10   
gb|KHJ44106.1|  kinase domain protein                                 70.1    2e-10   
dbj|GAM17149.1|  hypothetical protein SAMD00019534_003240             70.1    2e-10   
ref|XP_011253194.1|  PREDICTED: cyclin-G-associated kinase            70.1    2e-10   
ref|XP_011689691.1|  PREDICTED: uncharacterized protein LOC105451122  70.1    3e-10   
ref|XP_006006887.1|  PREDICTED: BMP-2-inducible protein kinase        69.7    3e-10   
gb|KIK99482.1|  hypothetical protein PAXRUDRAFT_8860                  69.7    3e-10   
ref|XP_011336642.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    3e-10   
gb|EYB87445.1|  hypothetical protein Y032_0263g606                    69.7    3e-10   
ref|XP_011499712.1|  PREDICTED: cyclin-G-associated kinase            69.3    4e-10   
gb|KIL71569.1|  hypothetical protein M378DRAFT_155155                 69.3    4e-10   
ref|XP_011501176.1|  PREDICTED: probable serine/threonine-protein...  69.3    4e-10   
ref|XP_011309991.1|  PREDICTED: cyclin-G-associated kinase            69.3    5e-10   
gb|KIJ21989.1|  hypothetical protein PAXINDRAFT_105693                69.3    5e-10   
gb|EFA74620.1|  putative protein serine/threonine kinase              68.9    5e-10   
ref|XP_011978217.1|  PREDICTED: BMP-2-inducible protein kinase is...  69.3    5e-10   
ref|XP_011978216.1|  PREDICTED: BMP-2-inducible protein kinase is...  69.3    5e-10   
ref|XP_005965721.1|  PREDICTED: BMP-2-inducible protein kinase        69.3    5e-10   
ref|XP_009028576.1|  hypothetical protein HELRODRAFT_194118           68.9    5e-10   
ref|XP_003288978.1|  hypothetical protein DICPUDRAFT_98203            68.9    5e-10   
gb|EGO04436.1|  hypothetical protein SERLA73DRAFT_68122               68.9    6e-10   
ref|XP_003370575.1|  cyclin G-associated kinase                       67.8    6e-10   
ref|XP_008291952.1|  PREDICTED: AP2-associated protein kinase 1-l...  68.9    6e-10   
ref|XP_012061212.1|  PREDICTED: cyclin-G-associated kinase            68.9    6e-10   
ref|XP_008291951.1|  PREDICTED: AP2-associated protein kinase 1-l...  68.9    7e-10   
ref|XP_008291950.1|  PREDICTED: AP2-associated protein kinase 1-l...  68.9    7e-10   
ref|XP_010844280.1|  PREDICTED: BMP-2-inducible protein kinase        68.9    7e-10   
ref|XP_007763588.1|  hypothetical protein CONPUDRAFT_134281           68.9    7e-10   
ref|XP_002432640.1|  Actin-regulating kinase, putative                68.2    8e-10   
gb|ETN84914.1|  kinase domain protein                                 67.4    8e-10   
ref|XP_011252925.1|  PREDICTED: AP2-associated protein kinase 1 i...  68.6    9e-10   
ref|XP_011252924.1|  PREDICTED: uncharacterized protein LOC105249...  68.6    9e-10   
ref|XP_011252923.1|  PREDICTED: uncharacterized protein LOC105249...  68.6    9e-10   
ref|XP_011252922.1|  PREDICTED: uncharacterized protein LOC105249...  68.6    9e-10   
ref|XP_011252921.1|  PREDICTED: uncharacterized protein LOC105249...  68.6    9e-10   
ref|XP_011311807.1|  PREDICTED: BMP-2-inducible protein kinase is...  68.2    9e-10   
ref|XP_011311806.1|  PREDICTED: BMP-2-inducible protein kinase is...  68.2    9e-10   
ref|XP_005165360.1|  PREDICTED: BMP-2-inducible protein kinase is...  68.2    1e-09   
ref|NP_001180469.1|  BMP-2-inducible protein kinase isoform 1         68.2    1e-09   
ref|NP_001008644.2|  BMP-2-inducible protein kinase isoform 2         67.8    1e-09   
gb|KIM32268.1|  hypothetical protein M408DRAFT_326890                 68.2    1e-09   
ref|XP_011478072.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.8    1e-09   
ref|XP_011478071.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.8    1e-09   
ref|XP_006053805.1|  PREDICTED: LOW QUALITY PROTEIN: BMP-2-induci...  67.8    1e-09   
ref|NP_001291194.1|  BMP2 inducible kinase                            67.8    1e-09   
ref|XP_010804567.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.8    1e-09   
ref|XP_011697793.1|  PREDICTED: cyclin-G-associated kinase            67.8    1e-09   
ref|XP_011631109.1|  PREDICTED: uncharacterized protein LOC105423...  67.8    1e-09   
ref|XP_011631108.1|  PREDICTED: uncharacterized protein LOC105423...  67.8    1e-09   
ref|XP_011631107.1|  PREDICTED: uncharacterized protein LOC105423...  67.8    1e-09   
ref|XP_003374041.1|  putative cyclin G-associated kinase              67.4    1e-09   
ref|XP_006607605.1|  PREDICTED: cyclin-G-associated kinase-like       67.8    1e-09   
ref|XP_003694148.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  67.8    1e-09   
ref|XP_396906.3|  PREDICTED: cyclin-G-associated kinase-like          67.8    1e-09   
ref|XP_004681247.1|  PREDICTED: BMP-2-inducible protein kinase        67.8    1e-09   
gb|KII93982.1|  hypothetical protein PLICRDRAFT_411608                67.8    2e-09   
gb|AAH86712.1|  BMP2 inducible kinase                                 67.4    2e-09   
ref|XP_005730713.1|  PREDICTED: BMP-2-inducible protein kinase-like   67.4    2e-09   
ref|XP_011865252.1|  PREDICTED: uncharacterized protein LOC105560...  67.8    2e-09   
ref|XP_002162944.2|  PREDICTED: cyclin-G-associated kinase-like       67.4    2e-09   
ref|XP_011865251.1|  PREDICTED: uncharacterized protein LOC105560...  67.8    2e-09   
ref|XP_011865249.1|  PREDICTED: uncharacterized protein LOC105560...  67.8    2e-09   
gb|EGI68289.1|  AP2-associated protein kinase 1                       67.8    2e-09   
ref|XP_011050023.1|  PREDICTED: uncharacterized protein LOC105143408  67.8    2e-09   
ref|XP_011058228.1|  PREDICTED: cyclin-G-associated kinase            67.4    2e-09   
gb|EGI63215.1|  Cyclin G-associated kinase                            67.4    2e-09   
ref|XP_005735412.1|  PREDICTED: AP2-associated protein kinase 1-like  67.4    2e-09   
ref|XP_005451328.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_001874050.1|  predicted protein                                67.4    2e-09   
ref|XP_011154788.1|  PREDICTED: uncharacterized protein LOC105192...  67.4    2e-09   
ref|XP_011154787.1|  PREDICTED: uncharacterized protein LOC105192...  67.4    2e-09   
ref|XP_011154785.1|  PREDICTED: uncharacterized protein LOC105192...  67.4    2e-09   
ref|XP_007858874.1|  serine threonine protein                         67.4    2e-09   
ref|XP_007337431.1|  hypothetical protein AURDEDRAFT_156362           67.4    2e-09   
ref|XP_004538215.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_006788892.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_005451327.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_011432303.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_011432282.1|  PREDICTED: BMP-2-inducible protein kinase-li...  67.4    2e-09   
gb|EKC19678.1|  AP2-associated protein kinase 1                       67.4    2e-09   
ref|XP_006788891.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_007298975.1|  hypothetical protein STEHIDRAFT_164868           67.4    2e-09   
ref|XP_006788890.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_005934691.1|  PREDICTED: AP2-associated protein kinase 1-like  67.4    2e-09   
ref|XP_004538214.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_006788889.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_005451326.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.4    2e-09   
ref|XP_011173538.1|  PREDICTED: uncharacterized protein LOC105205...  67.4    2e-09   
ref|XP_011173537.1|  PREDICTED: uncharacterized protein LOC105205...  67.4    2e-09   
ref|XP_011173536.1|  PREDICTED: uncharacterized protein LOC105205...  67.4    2e-09   
gb|KIK30275.1|  hypothetical protein PISMIDRAFT_671449                67.4    2e-09   
ref|XP_011149264.1|  PREDICTED: cyclin-G-associated kinase            67.4    2e-09   
gb|KFB52772.1|  AGAP002469-PA-like protein                            67.0    2e-09   
ref|XP_012062779.1|  PREDICTED: uncharacterized protein LOC105626079  67.4    2e-09   
ref|NP_001107518.1|  AP2 associated kinase 1                          67.0    2e-09   
ref|XP_002262548.1|  cyclin g-associated kinase                       67.0    2e-09   
ref|XP_008422368.1|  PREDICTED: AP2-associated protein kinase 1-l...  67.0    2e-09   
ref|XP_002128252.1|  PREDICTED: cyclin-G-associated kinase            67.0    2e-09   
ref|XP_008333860.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.0    2e-09   



>ref|XP_009772211.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
 ref|XP_009772212.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
Length=699

 Score =   224 bits (572),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  311  IMWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            +MWRFKPF  KEQ GLEGRTIDIG+LKV VRN IAEGGFSCVYL RDV+HGSKQYALKHI
Sbjct  1    MMWRFKPFMPKEQAGLEGRTIDIGSLKVHVRNAIAEGGFSCVYLARDVLHGSKQYALKHI  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  670
            I NDEES+DLVLKEI+VMKSLKGHPNIVTL AH+  DMGRTKEAL+ MEYCEKSLVSVLE
Sbjct  61   IVNDEESLDLVLKEISVMKSLKGHPNIVTLNAHTFLDMGRTKEALLVMEYCEKSLVSVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ+L
Sbjct  121  NRGAGFFEEKQVL  133



>ref|XP_006359171.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Solanum tuberosum]
Length=694

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGR+IDIGNLKV VRN IAEGGFSCVYL RD++HGSKQYALKH+I
Sbjct  1    MWRFKPFMPKEQTGLEGRSIDIGNLKVHVRNAIAEGGFSCVYLARDMLHGSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
             NDEES+DLVLKEI+VMKSLKGHPN+VTL AH+I DMGRTKEAL+ MEYCE+SLVSVLE 
Sbjct  61   VNDEESLDLVLKEISVMKSLKGHPNVVTLHAHTILDMGRTKEALLVMEYCEQSLVSVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFEEKQVL  132



>ref|XP_004229357.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Solanum lycopersicum]
Length=698

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGR+IDIGN+KV VRN IAEGGFSCVYL RD++HGSKQYALKH+I
Sbjct  1    MWRFKPFMPKEQTGLEGRSIDIGNIKVHVRNAIAEGGFSCVYLARDILHGSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
             NDEES+DLVLKEI+VMKSLKGHPN+VTL AH+I DMGRTKEAL+ MEYCE+SLVSVLE 
Sbjct  61   VNDEESLDLVLKEISVMKSLKGHPNVVTLHAHTILDMGRTKEALLVMEYCEQSLVSVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ L
Sbjct  121  RGAGFFEEKQAL  132



>emb|CDP07694.1| unnamed protein product [Coffea canephora]
Length=301

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQ GLEGRTIDIGNLK+QVRN IAEGGFSCVYL RD IHG+KQYALKHII
Sbjct  1    MWRFKPFMPKEQAGLEGRTIDIGNLKIQVRNAIAEGGFSCVYLARDAIHGTKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++LV++EI+VMK LKGHPN+V L AH+IFDMGRTKEAL+ M+YCEKSLV++L+ 
Sbjct  61   CNDEESLELVMREISVMKLLKGHPNVVPLSAHTIFDMGRTKEALLVMDYCEKSLVTMLDN  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_011087152.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X3 [Sesamum indicum]
Length=669

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGR IDIGN KVQ+RN IAEGGFSCVY  RD +HGSKQYALKHII
Sbjct  1    MWRFKPFMQKEQTGLEGRFIDIGNFKVQIRNAIAEGGFSCVYSARDAVHGSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES +LV+KEI+VMK+LKGHPN+VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE 
Sbjct  61   CNDEESQELVMKEISVMKTLKGHPNVVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFDEKQVL  132



>ref|XP_009607019.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
 ref|XP_009607020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
Length=700

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  311  IMWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            +MWRFKPF  KEQ GLEGRTIDIG+LKV VRN IAEGGFSCVYL RDV+HGSKQYALKHI
Sbjct  1    MMWRFKPFMPKEQAGLEGRTIDIGSLKVHVRNAIAEGGFSCVYLARDVLHGSKQYALKHI  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  670
            I +DEE +DLVLKEI+VMKSLKGHPNIVTL AH+  DMGRTKEAL+ MEYCEKSLVSVLE
Sbjct  61   IVSDEELLDLVLKEISVMKSLKGHPNIVTLNAHTFLDMGRTKEALLVMEYCEKSLVSVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ+L
Sbjct  121  NRGAGFFEEKQVL  133



>ref|XP_011087144.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Sesamum 
indicum]
Length=690

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGR IDIGN KVQ+RN IAEGGFSCVY  RD +HGSKQYALKHII
Sbjct  1    MWRFKPFMQKEQTGLEGRFIDIGNFKVQIRNAIAEGGFSCVYSARDAVHGSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES +LV+KEI+VMK+LKGHPN+VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE 
Sbjct  61   CNDEESQELVMKEISVMKTLKGHPNVVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFDEKQVL  132



>ref|XP_011087141.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Sesamum 
indicum]
Length=695

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGR IDIGN KVQ+RN IAEGGFSCVY  RD +HGSKQYALKHII
Sbjct  1    MWRFKPFMQKEQTGLEGRFIDIGNFKVQIRNAIAEGGFSCVYSARDAVHGSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES +LV+KEI+VMK+LKGHPN+VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE 
Sbjct  61   CNDEESQELVMKEISVMKTLKGHPNVVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFDEKQVL  132



>ref|XP_012092619.1| PREDICTED: serine/threonine-protein kinase 10 [Jatropha curcas]
 gb|KDP20398.1| hypothetical protein JCGZ_05281 [Jatropha curcas]
Length=669

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF+ KE  GLEGR++D+GNLK+ VRN+IAEGGFSCVYL RD +H SKQYALKH+I
Sbjct  1    MWRFKPFSQKEPAGLEGRSLDVGNLKIHVRNVIAEGGFSCVYLARDAMHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++L LKEI+VMKSLKGHPNIVTL A +IFDMGRTKEAL+ +E+CEKSLVSVLE 
Sbjct  61   CNDEESLELALKEIDVMKSLKGHPNIVTLYADAIFDMGRTKEALLVLEFCEKSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>gb|EYU27100.1| hypothetical protein MIMGU_mgv1a022935mg [Erythranthe guttata]
Length=634

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGR IDIGN KVQVRN IAEGGFSCVYL RD IHGSKQYALKHII
Sbjct  1    MWRFKPFAHKEQTGLEGRVIDIGNFKVQVRNAIAEGGFSCVYLARDAIHGSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
             +DEES +LV KEI VMK+LKGHPN+VTL AH+IFDMGRTKEAL+ +EYCEKSLV+VLE 
Sbjct  61   YSDEESEELVKKEILVMKTLKGHPNVVTLHAHAIFDMGRTKEALLLLEYCEKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ++
Sbjct  121  RGAGFFDEKQVI  132



>gb|AFK44489.1| unknown [Lotus japonicus]
Length=147

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+IDIGNLK+ V+  IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKINVQKAIAEGGFSCVYLARDAVHMSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+V+KSL GHPN+VTL AH+IFDMGRTKEA + ME+CEKSLV+VLE 
Sbjct  61   CNDEESLGLVKKEISVIKSLVGHPNVVTLLAHTIFDMGRTKEAFLVMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>emb|CAN60313.1| hypothetical protein VITISV_036304 [Vitis vinifera]
Length=303

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQ GLEGR+ID+GN+KV VRN IAEGGFSCVYL RD I+ SKQYALKHII
Sbjct  1    MWRFKPFMPKEQAGLEGRSIDVGNVKVYVRNAIAEGGFSCVYLARDAINSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+DLV KEI VMK L+GHPN+VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CNDEESLDLVKKEILVMKVLRGHPNVVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>emb|CBI32193.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +2

Query  278  TDKCIVYSELQIMWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVI  457
            +++C+    + IMWRFKPF  KEQ GLEGR+ID+GN+KV VRN IAEGGFSCVYL RD I
Sbjct  80   SEQCVFIVPI-IMWRFKPFMPKEQAGLEGRSIDVGNVKVYVRNAIAEGGFSCVYLARDAI  138

Query  458  HGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICME  637
            + SKQYALKHIICNDEES+DLV KEI VMK L+GHPN+VTL AH+I DMGRTKEAL+ ME
Sbjct  139  NSSKQYALKHIICNDEESLDLVKKEILVMKVLRGHPNVVTLHAHTILDMGRTKEALLVME  198

Query  638  YCEKSLVSVLEGR-IRLF*RKQIL  706
            +CEKSLV+VLE R    F  KQ+L
Sbjct  199  FCEKSLVNVLESRGAGYFEEKQVL  222



>ref|XP_010659600.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Vitis vinifera]
Length=710

 Score =   211 bits (538),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 102/142 (72%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = +2

Query  284  KCIVYSELQIMWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHG  463
            KC+    + IMWRFKPF  KEQ GLEGR+ID+GN+KV VRN IAEGGFSCVYL RD I+ 
Sbjct  5    KCVFIVPI-IMWRFKPFMPKEQAGLEGRSIDVGNVKVYVRNAIAEGGFSCVYLARDAINS  63

Query  464  SKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYC  643
            SKQYALKHIICNDEES+DLV KEI VMK L+GHPN+VTL AH+I DMGRTKEAL+ ME+C
Sbjct  64   SKQYALKHIICNDEESLDLVKKEILVMKVLRGHPNVVTLHAHTILDMGRTKEALLVMEFC  123

Query  644  EKSLVSVLEGR-IRLF*RKQIL  706
            EKSLV+VLE R    F  KQ+L
Sbjct  124  EKSLVNVLESRGAGYFEEKQVL  145



>ref|XP_010659599.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Vitis vinifera]
Length=711

 Score =   211 bits (538),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 102/142 (72%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = +2

Query  284  KCIVYSELQIMWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHG  463
            KC+    + IMWRFKPF  KEQ GLEGR+ID+GN+KV VRN IAEGGFSCVYL RD I+ 
Sbjct  5    KCVFIVPI-IMWRFKPFMPKEQAGLEGRSIDVGNVKVYVRNAIAEGGFSCVYLARDAINS  63

Query  464  SKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYC  643
            SKQYALKHIICNDEES+DLV KEI VMK L+GHPN+VTL AH+I DMGRTKEAL+ ME+C
Sbjct  64   SKQYALKHIICNDEESLDLVKKEILVMKVLRGHPNVVTLHAHTILDMGRTKEALLVMEFC  123

Query  644  EKSLVSVLEGR-IRLF*RKQIL  706
            EKSLV+VLE R    F  KQ+L
Sbjct  124  EKSLVNVLESRGAGYFEEKQVL  145



>ref|XP_008461768.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis melo]
Length=665

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE +GLEGR+ID+GNLK+ VRN+IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPSGLEGRSIDVGNLKIHVRNVIAEGGFSCVYLAKDAVHISKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++LV+KE++VMKSL+GHPN+VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CNDEESLELVMKEVSVMKSLRGHPNVVTLYAHTIIDMGRTKEALLAMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_004149621.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis sativus]
 ref|XP_011651798.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis sativus]
 gb|KGN58620.1| hypothetical protein Csa_3G702580 [Cucumis sativus]
Length=676

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE +GLEGR+ID+GNLK+ VRN+IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPSGLEGRSIDVGNLKIHVRNVIAEGGFSCVYLAKDAVHISKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++LV+KE++VMKSL+GHPN+VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CNDEESLELVMKEVSVMKSLRGHPNVVTLYAHTIIDMGRTKEALLVMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010659601.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Vitis vinifera]
Length=698

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQ GLEGR+ID+GN+KV VRN IAEGGFSCVYL RD I+ SKQYALKHII
Sbjct  1    MWRFKPFMPKEQAGLEGRSIDVGNVKVYVRNAIAEGGFSCVYLARDAINSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+DLV KEI VMK L+GHPN+VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CNDEESLDLVKKEILVMKVLRGHPNVVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>gb|EPS73129.1| hypothetical protein M569_01626, partial [Genlisea aurea]
Length=321

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KEQ GLEGR IDIG+ KVQV+N+IAEGGFSCVY  RDV+H SKQYALKHI+
Sbjct  1    MWKFKPFAQKEQIGLEGRLIDIGSFKVQVKNVIAEGGFSCVYSARDVLHASKQYALKHIV  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES++LV+KEI+VMK L+GHPN+V+L AH+I DMGRTKEAL+ MEYCEKSLV+VL+ 
Sbjct  61   CNDAESLELVMKEISVMKKLRGHPNVVSLQAHTIIDMGRTKEALLLMEYCEKSLVNVLDS  120

Query  674  R  676
            R
Sbjct  121  R  121



>dbj|BAD95980.1| Ser/Thr protein kinase [Lotus japonicus]
Length=307

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+IDIGNLK+ V+  IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKINVQKAIAEGGFSCVYLARDAVHMSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+V+KSL GHPN+VTL AH+IFDMGRTKEA + ME+CEKSLV+VLE 
Sbjct  61   CNDEESLGLVKKEISVIKSLVGHPNVVTLLAHTIFDMGRTKEAFLVMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_004306499.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468798.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=682

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEGR++D+G LK+ VRN+IAEGGFSCVYL RD++H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPAGLEGRSLDVGTLKIHVRNVIAEGGFSCVYLARDLVHTSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE +DLV+KEINVMK L+GHPN+VTL AH+I D+GRTKEAL+ MEYC+KSLV+VL+ 
Sbjct  61   CNDEELLDLVMKEINVMKLLRGHPNVVTLYAHAIMDLGRTKEALLVMEYCDKSLVTVLDS  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFDEKQLL  132



>ref|XP_011468799.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=681

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEGR++D+G LK+ VRN+IAEGGFSCVYL RD++H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPAGLEGRSLDVGTLKIHVRNVIAEGGFSCVYLARDLVHTSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE +DLV+KEINVMK L+GHPN+VTL AH+I D+GRTKEAL+ MEYC+KSLV+VL+ 
Sbjct  61   CNDEELLDLVMKEINVMKLLRGHPNVVTLYAHAIMDLGRTKEALLVMEYCDKSLVTVLDS  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFDEKQLL  132



>ref|XP_006369447.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
 gb|ERP66016.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
Length=666

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK FT KE  GLEGR +D+GNLK+ VRN IAEGGFSCVYL RD +H SKQYALKH+I
Sbjct  1    MWRFKHFTQKEPAGLEGRYVDVGNLKIHVRNAIAEGGFSCVYLARDAVHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
             NDEE  DLV+KEINVMK+LKGHPN+VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   YNDEELSDLVMKEINVMKALKGHPNVVTLYAHTILDMGRTKEALLVMEFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAAYFEEKQVL  132



>ref|XP_002512151.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50185.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=622

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK FT KE  GLEGR ID+GNLK+ VRN IAEGGFSCVYL  D +H SKQYALKH+I
Sbjct  1    MWRFKSFTQKEPVGLEGRYIDVGNLKIHVRNAIAEGGFSCVYLALDAMHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++L LKEINVMKS +GHPNIV LCAH+I D GRTKEAL+ ME+CEKSLVSVL+ 
Sbjct  61   CNDEESLELALKEINVMKSFQGHPNIVALCAHAILDKGRTKEALLVMEFCEKSLVSVLDS  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_010257450.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X3 [Nelumbo nucifera]
Length=707

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  +E TGLEGR ID+GN+KVQ+RN IAEGGFSCVYL RD IH SKQYALKHII
Sbjct  1    MWRFKQFMPREHTGLEGRAIDVGNIKVQIRNAIAEGGFSCVYLARDAIHSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+VMKSL+GHPN+V L AH+I DMGRTKEA + ME+CEKSLV+VLE 
Sbjct  61   CNDDESIELVMKEISVMKSLRGHPNVVALLAHTILDMGRTKEAFLVMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010678702.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Beta vulgaris subsp. vulgaris]
Length=664

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE TGLEGR IDIG++KV ++N+IAEGGFSCVYL RD ++ SKQYALKHII
Sbjct  1    MWKFKPFAQKEPTGLEGRNIDIGDIKVHIKNVIAEGGFSCVYLARDALNASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+DLV+KEI VMKSLKGHPN+VTL +H+I D+GRTKEAL+ ME CEKSLV+VLE 
Sbjct  61   CNDQESLDLVMKEIQVMKSLKGHPNVVTLYSHTILDLGRTKEALLVMECCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGAGYFDEKQIL  132



>ref|XP_010257448.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X1 [Nelumbo nucifera]
Length=709

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  +E TGLEGR ID+GN+KVQ+RN IAEGGFSCVYL RD IH SKQYALKHII
Sbjct  1    MWRFKQFMPREHTGLEGRAIDVGNIKVQIRNAIAEGGFSCVYLARDAIHSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+VMKSL+GHPN+V L AH+I DMGRTKEA + ME+CEKSLV+VLE 
Sbjct  61   CNDDESIELVMKEISVMKSLRGHPNVVALLAHTILDMGRTKEAFLVMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_008808088.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008808089.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=698

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPFTAKE TGLEGRTID+GN+KV VRN +AEGGFSCVYL RD +H SKQYALKH+I
Sbjct  1    MWRFKPFTAKEPTGLEGRTIDVGNVKVHVRNAMAEGGFSCVYLARDALHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DL +KEI+VM+ LKGHPN+V L AH+I DMGR KE LI ME+CEKSLV+VL+ 
Sbjct  61   CNDGESLDLAMKEISVMRLLKGHPNVVALVAHTILDMGRMKEVLIVMEFCEKSLVAVLDN  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010257449.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X2 [Nelumbo nucifera]
Length=708

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  +E TGLEGR ID+GN+KVQ+RN IAEGGFSCVYL RD IH SKQYALKHII
Sbjct  1    MWRFKQFMPREHTGLEGRAIDVGNIKVQIRNAIAEGGFSCVYLARDAIHSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+VMKSL+GHPN+V L AH+I DMGRTKEA + ME+CEKSLV+VLE 
Sbjct  61   CNDDESIELVMKEISVMKSLRGHPNVVALLAHTILDMGRTKEAFLVMEFCEKSLVNVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_007052606.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
 gb|EOX96763.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
Length=679

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEG+++D+ NLK+ VRN IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFMQKEPAGLEGKSLDVSNLKLHVRNAIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+DLV+KEI+VMKSL+GHPN+VTL AH+I DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDQESLDLVMKEISVMKSLQGHPNVVTLYAHTILDMGRTKEALLVMEFCDKSLVNVLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAAYFEEKQVL  132



>ref|XP_007052605.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
 gb|EOX96762.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
Length=678

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEG+++D+ NLK+ VRN IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFMQKEPAGLEGKSLDVSNLKLHVRNAIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+DLV+KEI+VMKSL+GHPN+VTL AH+I DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDQESLDLVMKEISVMKSLQGHPNVVTLYAHTILDMGRTKEALLVMEFCDKSLVNVLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAAYFEEKQVL  132



>ref|XP_007052604.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
 gb|EOX96761.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
Length=688

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEG+++D+ NLK+ VRN IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFMQKEPAGLEGKSLDVSNLKLHVRNAIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+DLV+KEI+VMKSL+GHPN+VTL AH+I DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDQESLDLVMKEISVMKSLQGHPNVVTLYAHTILDMGRTKEALLVMEFCDKSLVNVLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAAYFEEKQVL  132



>ref|XP_008392404.1| PREDICTED: AP2-associated protein kinase 1 [Malus domestica]
Length=681

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GN+K+ V+N IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDVGNVKIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
             NDEE ++LV+KEI+VMK L+GHPN+VTLCAH+I DMGRTKEAL+ M++CEKSLV+VLE 
Sbjct  61   INDEELLELVMKEISVMKLLRGHPNVVTLCAHTILDMGRTKEALLVMDFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFEEKQVL  132



>ref|XP_009339572.1| PREDICTED: AP2-associated protein kinase 1 [Pyrus x bretschneideri]
Length=688

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GN+K+ V+N IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDVGNVKIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
             NDEE ++LV+KEI+VMK L+GHPN+VTLCAH+I DMGRTKEAL+ M++CEKSLV+VLE 
Sbjct  61   INDEELLELVMKEISVMKLLRGHPNVVTLCAHTILDMGRTKEALLVMDFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGFFEEKQVL  132



>ref|XP_010265879.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
 ref|XP_010265880.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
Length=701

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  KE  GLEGRTID+GN+KV +RN+IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKQFMPKEHAGLEGRTIDVGNIKVHIRNVIAEGGFSCVYLARDAVHTSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES++LV KEI+VMK L+GHPN+V L AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CNDGESLELVTKEISVMKMLRGHPNVVALLAHTILDMGRTKEALLVMEFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R +  F  KQIL
Sbjct  121  RGVGYFEEKQIL  132



>ref|XP_010265881.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X2 [Nelumbo nucifera]
Length=700

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  KE  GLEGRTID+GN+KV +RN+IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKQFMPKEHAGLEGRTIDVGNIKVHIRNVIAEGGFSCVYLARDAVHTSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES++LV KEI+VMK L+GHPN+V L AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CNDGESLELVTKEISVMKMLRGHPNVVALLAHTILDMGRTKEALLVMEFCEKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R +  F  KQIL
Sbjct  121  RGVGYFEEKQIL  132



>gb|KHG06229.1| putative serine/threonine-protein kinase [Gossypium arboreum]
Length=653

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEGRT+D+ NLK+ VRN+IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKLHVRNVIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+V+KSL+GHPN++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE 
Sbjct  61   CNDQESLELVVKEISVLKSLQGHPNVITLYAHTILDMGRTKEALLVMEFCDKSLVNFLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGTAYFEEKQIL  132



>ref|XP_003531422.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Glycine max]
 gb|KHN29185.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=662

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF+ KEQTGLEGRTID+GNLK+ V   IAEGGFSCVYL RD +H SKQYALKH+I
Sbjct  1    MWRFKPFSHKEQTGLEGRTIDVGNLKIHVIKAIAEGGFSCVYLARDAVHMSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+VMK L GHPN+VTL AH+IFDMGRTKEA + ME+CE+SLV+VLE 
Sbjct  61   CNDEESLGLVKKEISVMKVLAGHPNVVTLHAHAIFDMGRTKEAFLVMEFCERSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFDEKQVL  132



>gb|KDO46086.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=691

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_007149359.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21353.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=673

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGRT+D+GNLK+ +   IAEGGFSCVY+ RD +H SKQYALKH+I
Sbjct  1    MWRFKPFGHKEQTGLEGRTVDVGNLKINIVKAIAEGGFSCVYVARDAVHMSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+VMK L GHPN+VTL AHSIFDMGRTKEA + ME+CE+SLVSVLE 
Sbjct  61   CNDEESLGLVKKEISVMKMLVGHPNVVTLLAHSIFDMGRTKEAFLVMEFCERSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFDEKQVL  132



>ref|XP_006482821.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482822.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X2 [Citrus sinensis]
Length=693

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_007149360.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21354.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=674

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQTGLEGRT+D+GNLK+ +   IAEGGFSCVY+ RD +H SKQYALKH+I
Sbjct  1    MWRFKPFGHKEQTGLEGRTVDVGNLKINIVKAIAEGGFSCVYVARDAVHMSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+VMK L GHPN+VTL AHSIFDMGRTKEA + ME+CE+SLVSVLE 
Sbjct  61   CNDEESLGLVKKEISVMKMLVGHPNVVTLLAHSIFDMGRTKEAFLVMEFCERSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFDEKQVL  132



>ref|XP_006482824.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X4 [Citrus sinensis]
Length=691

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_006439043.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52283.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=693

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_006482823.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X3 [Citrus sinensis]
Length=692

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_006439041.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439042.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52281.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52282.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=692

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>gb|KDO46085.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=690

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_006439040.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439044.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52280.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52284.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=690

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+ID+GNLK+ VRN+IAEGGFSCVY  RD IH SKQYA+KH+I
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLKIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++  +KEI+VMKSLKGHPN+VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE 
Sbjct  61   CNDEESLESAMKEISVMKSLKGHPNVVTLYAHTILDLGRTKEALLVMECCDKSLVNVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>gb|KJB22766.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=658

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEGRT+D+ NLK+ VRN+IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKLHVRNVIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+V+KSL+GHPN++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE 
Sbjct  61   CNDQESLELVVKEISVLKSLQGHPNVITLYAHTILDMGRTKEALLVMEFCDKSLVNCLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGTAYFEEKQIL  132



>ref|XP_008231321.1| PREDICTED: AP2-associated protein kinase 1 isoform X3 [Prunus 
mume]
Length=697

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+IDIGNLK+ V+N IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE ++LV+KEI+VMK L+GHPN+VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDEEMLELVMKEISVMKLLRGHPNVVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ L
Sbjct  121  RGAGFFDEKQAL  132



>ref|XP_008231319.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Prunus 
mume]
Length=699

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+IDIGNLK+ V+N IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE ++LV+KEI+VMK L+GHPN+VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDEEMLELVMKEISVMKLLRGHPNVVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ L
Sbjct  121  RGAGFFDEKQAL  132



>ref|XP_008231320.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Prunus 
mume]
Length=698

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR+IDIGNLK+ V+N IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE ++LV+KEI+VMK L+GHPN+VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDEEMLELVMKEISVMKLLRGHPNVVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ L
Sbjct  121  RGAGFFDEKQAL  132



>gb|KJB22767.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
 gb|KJB22769.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=661

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEGRT+D+ NLK+ VRN+IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKLHVRNVIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+V+KSL+GHPN++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE 
Sbjct  61   CNDQESLELVVKEISVLKSLQGHPNVITLYAHTILDMGRTKEALLVMEFCDKSLVNCLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGTAYFEEKQIL  132



>gb|KJB22768.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=662

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE  GLEGRT+D+ NLK+ VRN+IAEGGFSCVYL +D +H SKQYALKHII
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKLHVRNVIAEGGFSCVYLAKDALHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES++LV+KEI+V+KSL+GHPN++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE 
Sbjct  61   CNDQESLELVVKEISVLKSLQGHPNVITLYAHTILDMGRTKEALLVMEFCDKSLVNCLET  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGTAYFEEKQIL  132



>ref|XP_007220628.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
 gb|EMJ21827.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
Length=687

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KE TGLEGR++DIGNLK+ V+N IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEPTGLEGRSVDIGNLKIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE ++LV+KEI+VMK L+GHPN+VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE 
Sbjct  61   CNDEEMLELVMKEISVMKLLRGHPNVVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ L
Sbjct  121  RGAGFFDEKQAL  132



>ref|XP_004513162.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Cicer arietinum]
 ref|XP_004513163.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Cicer arietinum]
 ref|XP_004513164.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X3 [Cicer arietinum]
 ref|XP_004513165.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X4 [Cicer arietinum]
 ref|XP_004513166.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X5 [Cicer arietinum]
 ref|XP_004513167.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X6 [Cicer arietinum]
 ref|XP_004513168.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X7 [Cicer arietinum]
 ref|XP_004513169.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X8 [Cicer arietinum]
Length=681

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQ+GLEGR+ID+GNLK+ V  +IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWRFKPFMHKEQSGLEGRSIDVGNLKINVHKVIAEGGFSCVYLARDAVHMSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+VMK L GHPN+VTL AH+I+DMGRTKEA + ME+CEKSLVSVLE 
Sbjct  61   CNDEESLGLVKKEISVMKLLVGHPNVVTLHAHAIYDMGRTKEAFLVMEFCEKSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  +Q+L
Sbjct  121  RGAGYFDERQVL  132



>ref|XP_010522378.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522379.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522380.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522382.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
Length=649

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR +D+GNLK+QVRNIIAEGGFS VYL +D  + SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQVRNIIAEGGFSSVYLAQDATNLSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++LV+KEI+VMKSLKGHPNIVTL AH + DMGR KEAL+ ME+C KSLVSVLE 
Sbjct  61   CNDEESLELVMKEISVMKSLKGHPNIVTLYAHGVLDMGRKKEALLVMEFCGKSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    +  KQ+L
Sbjct  121  RGAGYYEEKQVL  132



>ref|XP_010522383.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR +D+GNLK+QVRNIIAEGGFS VYL +D  + SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQVRNIIAEGGFSSVYLAQDATNLSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES++LV+KEI+VMKSLKGHPNIVTL AH + DMGR KEAL+ ME+C KSLVSVLE 
Sbjct  61   CNDEESLELVMKEISVMKSLKGHPNIVTLYAHGVLDMGRKKEALLVMEFCGKSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    +  KQ+L
Sbjct  121  RGAGYYEEKQVL  132



>ref|XP_010943528.1| PREDICTED: AP2-associated protein kinase 1-like [Elaeis guineensis]
Length=698

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRF PF  KE TGLEGRTID+GN+KV VRN +AEGGFSCVYL RD +H SKQYALKH+I
Sbjct  1    MWRFNPFMLKEPTGLEGRTIDVGNVKVHVRNAMAEGGFSCVYLARDAVHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DL  KEI+VM+ LKGHPN+V L AH+I DMGRTKE LI ME+CEKSLV+VL+ 
Sbjct  61   CNDGESLDLATKEISVMRLLKGHPNVVALVAHTILDMGRTKEVLIVMEFCEKSLVAVLDN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>dbj|BAD34081.1| putative AAK1 protein [Oryza sativa Japonica Group]
Length=308

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRF PF  K Q GLEGRTID+GN+K+ VRN IA+GGFSCVYL  D +H SKQYA+KHII
Sbjct  1    MWRFNPFGGKVQNGLEGRTIDVGNIKITVRNAIAQGGFSCVYLASDAMHPSKQYAMKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND E +DLV++EI VM  LKGHPN+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSELLDLVMEEIQVMNLLKGHPNVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010542987.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542988.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542989.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=633

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR +D+GNLK+QVRNIIAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQVRNIIAEGGFSSVYLAQDATHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES++LV+KEI+VMKSLKGHPN+VTL +H I DMGR KEAL+ ME+C KSLVSVLE 
Sbjct  61   CNDGESLELVMKEISVMKSLKGHPNVVTLYSHGILDMGRKKEALLVMEFCGKSLVSVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010542991.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=632

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR +D+GNLK+QVRNIIAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQVRNIIAEGGFSSVYLAQDATHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES++LV+KEI+VMKSLKGHPN+VTL +H I DMGR KEAL+ ME+C KSLVSVLE 
Sbjct  61   CNDGESLELVMKEISVMKSLKGHPNVVTLYSHGILDMGRKKEALLVMEFCGKSLVSVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010670934.1| PREDICTED: actin-regulating kinase PRK1-like [Beta vulgaris subsp. 
vulgaris]
Length=656

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPFT KE TGLEGR IDIG++KV V+N+IAEGGFSCVYL +  ++ SKQYALKHII
Sbjct  1    MWKFKPFTHKEPTGLEGRYIDIGDIKVHVKNVIAEGGFSCVYLAKGALNASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+DL++KEI VMK LKGHPN+VTL +H+I DMGRTKEAL+ MEYCEK LV +LEG
Sbjct  61   CNDQESLDLIMKEIQVMKFLKGHPNVVTLHSHTILDMGRTKEALLLMEYCEKCLVHILEG  120

Query  674  RIR-LF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGSGYFDEKQVL  132



>ref|XP_003546865.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Glycine max]
 ref|XP_006598247.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Glycine max]
Length=660

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF+ KEQTGLEGRTID+ NLK+ +   IAEGGFSCVYL RD +H SKQYALKH+I
Sbjct  1    MWRFKPFSHKEQTGLEGRTIDVSNLKINIIKAIAEGGFSCVYLARDAVHMSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+VMK L GHPN+VTL AH+I DMGRTKEA + ME+CE+SLV+VLE 
Sbjct  61   CNDEESLGLVKKEISVMKMLAGHPNVVTLHAHAIVDMGRTKEAFVVMEFCERSLVNVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFDEKQVL  132



>ref|XP_010027725.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54314.1| hypothetical protein EUGRSUZ_I00278 [Eucalyptus grandis]
Length=697

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQ GLEGR IDIGN+KV VRN+IAEGGFSCVYL RD +H S+Q+ALKHII
Sbjct  1    MWRFKPFGQKEQAGLEGRAIDIGNVKVHVRNVIAEGGFSCVYLARDALHVSRQFALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ + +KEI VMKSL GHPN+V L AH++ DMGRTKE L+ M++CEKSLV VLE 
Sbjct  61   CNDEESLGVAMKEIAVMKSLAGHPNVVALQAHTVLDMGRTKEVLLLMDFCEKSLVHVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010027724.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Eucalyptus 
grandis]
Length=703

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFKPF  KEQ GLEGR IDIGN+KV VRN+IAEGGFSCVYL RD +H S+Q+ALKHII
Sbjct  1    MWRFKPFGQKEQAGLEGRAIDIGNVKVHVRNVIAEGGFSCVYLARDALHVSRQFALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ + +KEI VMKSL GHPN+V L AH++ DMGRTKE L+ M++CEKSLV VLE 
Sbjct  61   CNDEESLGVAMKEIAVMKSLAGHPNVVALQAHTVLDMGRTKEVLLLMDFCEKSLVHVLES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_008805476.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008805477.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=702

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  KEQ GLEGRT+D+G+LKV VRN+IAEGGFSCVYL RD ++ SKQYALKH+I
Sbjct  1    MWRFKQFMPKEQAGLEGRTVDVGSLKVHVRNVIAEGGFSCVYLARDAVNSSKQYALKHVI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            C D ES+DLV+KEI+VMK LKGHPN+V L AH+I DMGRT EA++ ME+CEKSLV+VLE 
Sbjct  61   CQDGESLDLVMKEISVMKLLKGHPNVVMLVAHAILDMGRTMEAMLVMEFCEKSLVTVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  K+IL
Sbjct  121  RGAGYFEEKKIL  132



>gb|KEH33173.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=678

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KEQ GLEGR+ID+GNLK+ V  +IAEGGFSCVYL RD +H SKQYALKHII
Sbjct  1    MWKFKPFAHKEQNGLEGRSIDVGNLKLHVHKLIAEGGFSCVYLARDAVHMSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEES+ LV KEI+VMK L GHPN+VTL A++I+DMGRTKEA + ME+CEKSLVSVLE 
Sbjct  61   CNDEESLGLVKKEISVMKLLIGHPNVVTLHANAIYDMGRTKEAFLVMEFCEKSLVSVLES  120

Query  674  R-IRLF*RKQIL  706
            R    F  +Q+L
Sbjct  121  RGAGYFEERQVL  132



>ref|XP_002881248.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57507.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPFT KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +DV H SKQYALKHII
Sbjct  1    MWKFKPFTQKEPAGLEGRFLEIGNLKVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ M++C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>dbj|BAD34080.1| cyclin G-associated kinase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAG93141.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73506.1| hypothetical protein OsI_07872 [Oryza sativa Indica Group]
 gb|EEE57282.1| hypothetical protein OsJ_07336 [Oryza sativa Japonica Group]
Length=667

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRF PF  K Q GLEGRTID+GN+K+ VRN IA+GGFSCVYL  D +H SKQYA+KHII
Sbjct  1    MWRFNPFGGKVQNGLEGRTIDVGNIKITVRNAIAQGGFSCVYLASDAMHPSKQYAMKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND E +DLV++EI VM  LKGHPN+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSELLDLVMEEIQVMNLLKGHPNVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010913910.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Elaeis guineensis]
Length=702

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK F  KEQ GLEGRT+++G+LKV VRN+IAEGGFSCVYL RD ++  KQYALKH+I
Sbjct  1    MWRFKQFMPKEQAGLEGRTVEVGSLKVHVRNVIAEGGFSCVYLARDAVNSFKQYALKHVI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            C D ES+DLV+KEI+VMK LKGHPN+V L AH+I DMGRTKEAL+ ME+CEKSLV+VLE 
Sbjct  61   CQDGESLDLVMKEISVMKLLKGHPNVVILVAHTILDMGRTKEALLVMEFCEKSLVTVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  K+IL
Sbjct  121  RGAGYFEEKKIL  132



>ref|XP_006647439.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
[Oryza brachyantha]
Length=666

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRF PF  K Q GLEGRTID+GN+K+ VRN IA+GGFSCVYL  D +H SKQYA+KHII
Sbjct  1    MWRFNPFGGKVQNGLEGRTIDVGNVKITVRNAIAQGGFSCVYLACDTLHPSKQYAMKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND E +DLV+KEI VM  LKGHPN+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSELLDLVMKEIQVMNLLKGHPNVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>emb|CDY52551.1| BnaA05g35100D [Brassica napus]
Length=241

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IG+LKVQ RN+IAEGGFS VYL +D  H SKQYALKH+I
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGSLKVQARNVIAEGGFSSVYLAQDTTHPSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGR-TKEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME+C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRGKKEALLAMEFCGKSLVEVLE  120

Query  671  GR---IRLF*RKQIL  706
             R      F  KQ+L
Sbjct  121  SRGGGAGYFEEKQVL  135



>ref|XP_006410418.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
 gb|ESQ51871.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
Length=674

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQVRNVIAEGGFSSVYLAQDTNHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME+C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMEFCGKSLVEVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>ref|XP_010469540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Camelina sativa]
Length=550

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQVRNVIAEGGFSSVYLAQDANHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLE  120

Query  671  GR  676
             R
Sbjct  121  NR  122



>ref|NP_850199.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAN64167.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEC08752.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=670

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +DV H SKQYALKH+I
Sbjct  1    MWKFKPFAQKEPAGLEGRFLEIGNLKVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ M++C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>gb|AAL60023.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=650

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +DV H SKQYALKH+I
Sbjct  1    MWKFKPFAQKEPAGLEGRFLEIGNLKVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ M++C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>ref|XP_010413940.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=671

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQVRNVIAEGGFSSVYLAQDANHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>ref|NP_565756.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAB91980.2| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAM14904.1| putative serine threonine protein kinase [Arabidopsis thaliana]
 gb|AAM67308.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN12961.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEC08751.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=650

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +DV H SKQYALKH+I
Sbjct  1    MWKFKPFAQKEPAGLEGRFLEIGNLKVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ M++C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLE  120

Query  671  GR  676
             R
Sbjct  121  NR  122



>ref|XP_006293803.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
 gb|EOA26701.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
Length=672

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQVRNVIAEGGFSSVYLAQDANHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLFAHGILDMGRNKKEALLAMELCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>ref|XP_010469538.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Camelina sativa]
Length=672

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQVRNVIAEGGFSSVYLAQDANHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>ref|XP_010469539.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Camelina sativa]
Length=598

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IGNLKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQVRNVIAEGGFSSVYLAQDANHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLE  120

Query  671  GR  676
             R
Sbjct  121  NR  122



>ref|XP_008677437.1| PREDICTED: uncharacterized protein LOC100304212 isoform X1 [Zea 
mays]
 gb|AFW62790.1| putative protein kinase superfamily protein [Zea mays]
Length=666

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+  PF  K Q+GL+GRTID+GNLK+ V+N IA+GGFSCVYL  D +H SK YALKHII
Sbjct  1    MWKLNPFGGKAQSGLDGRTIDVGNLKITVQNAIAQGGFSCVYLACDTVHPSKMYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGHPN+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSESLDLVMKEIQVMNLLKGHPNVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_004952949.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Setaria 
italica]
Length=609

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWR  PF  K Q+GLEGRT+D+G++K+ VRN IA+GGFSCVYL  D +H SK YALKHII
Sbjct  1    MWRLNPFGGKAQSGLEGRTVDVGSVKITVRNAIAQGGFSCVYLACDTVHPSKLYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGHPN+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSESLDLVMKEIQVMNLLKGHPNVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_009408443.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like, 
partial [Musa acuminata subsp. malaccensis]
Length=632

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW FKPFT KE  GLEGRTID+GN+KV VRN+IA+GGFSCVY+  D    SKQYALKH+I
Sbjct  1    MWMFKPFTGKEPVGLEGRTIDVGNVKVHVRNVIAQGGFSCVYIALDPAQSSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES DLV+KEI+VMK L+GHPN+VTL AH+I DMG  KEAL+ MEYCEKSLV+VL  
Sbjct  61   CNDAESSDLVMKEISVMKLLRGHPNVVTLIAHTILDMGWRKEALLVMEYCEKSLVTVLGN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGAGYFEEKQIL  132



>ref|XP_009143925.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Brassica rapa]
Length=583

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IG+LKVQVRN+IAEGGFS VYL +D  H SKQYALKH+I
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGSLKVQVRNVIAEGGFSSVYLAQDTTHPSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGR-TKEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME+C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRGKKEALLAMEFCGKSLVEVLE  120

Query  671  GR---IRLF*RKQIL  706
             R      F  KQ+L
Sbjct  121  SRGGGAGYFEEKQVL  135



>ref|XP_004952948.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Setaria 
italica]
Length=670

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWR  PF  K Q+GLEGRT+D+G++K+ VRN IA+GGFSCVYL  D +H SK YALKHII
Sbjct  1    MWRLNPFGGKAQSGLEGRTVDVGSVKITVRNAIAQGGFSCVYLACDTVHPSKLYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGHPN+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSESLDLVMKEIQVMNLLKGHPNVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010509956.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
 ref|XP_010509957.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=673

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE  GLEGR ++IG+LKVQVRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGSLKVQVRNVIAEGGFSSVYLAQDANHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            CNDEES++LV+KEI+V+KSLKGHPN+VTL AH I DMGR  KEAL+ ME C KSLV VLE
Sbjct  61   CNDEESLELVMKEISVLKSLKGHPNVVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLE  120

Query  671  GR-IRLF*RKQIL  706
             R    F  KQ L
Sbjct  121  NRGAGYFEEKQAL  133



>ref|XP_006850020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Amborella trichopoda]
 gb|ERN11601.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
Length=706

 Score =   191 bits (485),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWR K F  KE  GLEGR+IDIGNLKVQVRN IAEGGFS VYL RDV    KQ+A+KHI 
Sbjct  1    MWRLKQFMPKEPLGLEGRSIDIGNLKVQVRNTIAEGGFSSVYLVRDVGPSGKQFAMKHIF  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CNDEE++DLV KE +VMKSLKGHPN+V L AH+I DMGRTKEA + ME+CEKSLV+VLE 
Sbjct  61   CNDEETLDLVKKEFSVMKSLKGHPNVVALQAHTILDMGRTKEAFLVMEFCEKSLVTVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQIL
Sbjct  121  RGAAYFEEKQIL  132



>ref|XP_004956476.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Setaria italica]
Length=699

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTG-LEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            MWR K F  KEQ G LEGRT+D+GN+KV VR  IAEGGFSCVY  RD+++ ++QYALKH+
Sbjct  1    MWRLKQFIPKEQPGGLEGRTVDVGNVKVHVREAIAEGGFSCVYAARDMVNPARQYALKHV  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  670
            I  DEES++LV KEI VM+SLKGHPN+VTL AH+I DMGRT+EAL+ ME+CEKSLVSVLE
Sbjct  61   IIQDEESLELVRKEITVMRSLKGHPNVVTLIAHTILDMGRTREALLVMEFCEKSLVSVLE  120

Query  671  GR  676
            GR
Sbjct  121  GR  122



>ref|XP_010095876.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC42162.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=652

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            KE  GLEGR++D+GNLK+ V+N+IAEGGFSCVYL RD +H SKQYALKHIICND+ES++L
Sbjct  3    KESAGLEGRSVDVGNLKLHVKNVIAEGGFSCVYLARDAVHLSKQYALKHIICNDDESLEL  62

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGRIRL-F*RK  697
            V+KEI+VMK+L+GHPN+VTL AH+I DMGRTKEAL+ ME+CE+SLVSVLE R  + F  K
Sbjct  63   VVKEISVMKALRGHPNVVTLHAHTILDMGRTKEALVVMEFCERSLVSVLESRGSVYFDEK  122

Query  698  QIL  706
            Q+L
Sbjct  123  QVL  125



>ref|XP_003575255.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235618.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
Length=672

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            M RF PF  K Q GLEGRTIDIGN+K+ VRN IA+GGFSCVYL  D +H SKQYALKHII
Sbjct  1    MRRFNPFGGKVQNGLEGRTIDIGNVKITVRNAIAQGGFSCVYLACDTLHSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGH N+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDLESLDLVMKEIQVMNVLKGHANVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_010235619.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Brachypodium distachyon]
Length=612

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            M RF PF  K Q GLEGRTIDIGN+K+ VRN IA+GGFSCVYL  D +H SKQYALKHII
Sbjct  1    MRRFNPFGGKVQNGLEGRTIDIGNVKITVRNAIAQGGFSCVYLACDTLHSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGH N+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDLESLDLVMKEIQVMNVLKGHANVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>gb|EMT28285.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=668

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            M RF PF  K QTGLEGRTID+ N+K+ VRN IA+GGFSCVYL  D +H SKQYALKHII
Sbjct  1    MRRFNPFGGKVQTGLEGRTIDVRNVKITVRNAIAQGGFSCVYLACDALHSSKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGH N+VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSESLDLVMKEIQVMNLLKGHANVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>ref|XP_009395097.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395098.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
Length=670

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW FKPF  KE   LEGRTID+GN+KV VRN IAEGGFSC+Y+  DV+  SKQYALKH+I
Sbjct  1    MWMFKPFAGKEPASLEGRTIDVGNVKVHVRNAIAEGGFSCIYVATDVVQPSKQYALKHVI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND++ +DL++KEI+VMK L+GHPN+V L AH+I DMGR KEAL+ ME+CEKSL ++LE 
Sbjct  61   CNDDDLLDLIMKEISVMKLLRGHPNVVALVAHTILDMGRRKEALLVMEFCEKSLATLLEN  120

Query  674  RIR-LF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGSGYFEEKQVL  132



>emb|CDX79504.1| BnaC03g18400D [Brassica napus]
Length=607

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE +GLEGR ++IG+LKV VRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPSGLEGRYLEIGSLKVHVRNLIAEGGFSSVYLAQDTNHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            C+DEES++LV+KEI+V+KSLKGHPN+V L AH I DMGR  KEAL+ MEYC KSLV V+E
Sbjct  61   CHDEESLELVMKEISVLKSLKGHPNVVALYAHGILDMGRNKKEALLAMEYCGKSLVEVIE  120

Query  671  GR  676
             R
Sbjct  121  NR  122



>ref|XP_009394517.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394519.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394520.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
Length=704

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+ K F  KE   LEGR +++GNLK+QVRN+IAEGGFSCVYL RD ++ SKQYALKH+I
Sbjct  1    MWKLKQFMPKEPNSLEGRMVEVGNLKLQVRNVIAEGGFSCVYLARDAVNPSKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            C DEES+ L +KEI+VMK LKGHPN+V L AH+I DMGR KE L+ ME+CEKSLV+VLE 
Sbjct  61   CQDEESLGLAMKEISVMKMLKGHPNVVVLIAHTILDMGRVKEVLLVMEFCEKSLVAVLEN  120

Query  674  R-IRLF*RKQIL  706
            R    F  KQ+L
Sbjct  121  RGAGYFEEKQVL  132



>ref|XP_009132906.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Brassica rapa]
Length=612

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE +GLEGR ++IG+LKV VRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPSGLEGRYLEIGSLKVHVRNLIAEGGFSSVYLAQDTNHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            C+DEES++LV+KEI+V+KSLKGHPN+V L AH I DMGR  KEAL+ MEYC KSLV V+E
Sbjct  61   CHDEESLELVMKEISVLKSLKGHPNVVALHAHGILDMGRNKKEALLAMEYCGKSLVEVIE  120

Query  671  GR  676
             R
Sbjct  121  NR  122



>emb|CDX84704.1| BnaA03g15260D [Brassica napus]
Length=612

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+FKPF  KE +GLEGR ++IG+LKV VRN+IAEGGFS VYL +D  H SKQYALKHII
Sbjct  1    MWKFKPFAQKEPSGLEGRYLEIGSLKVHVRNLIAEGGFSSVYLAQDTSHASKQYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLE  670
            C+D+ES++LV+KEI+V+KSLKGHPN+V L AH I DMGR  KEAL+ MEYC KSLV V+E
Sbjct  61   CHDDESLELVMKEISVLKSLKGHPNVVALHAHGILDMGRNKKEALLAMEYCGKSLVEVIE  120

Query  671  GR  676
             R
Sbjct  121  NR  122



>tpg|DAA39365.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=603

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQ---TGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALK  484
            MWR K F  KEQ   +GLEGRT+D+GN+KV VR  IAEGGFS VY  RD+++ +KQYALK
Sbjct  1    MWRLKQFIPKEQPSPSGLEGRTVDVGNVKVHVREAIAEGGFSSVYAARDLVNPAKQYALK  60

Query  485  HIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSV  664
             +I  DEES++LV KEI VM+SLKGHPN+VTL AH+I DMGR +EAL+ ME+C KSLVSV
Sbjct  61   RVIVQDEESLNLVQKEITVMRSLKGHPNVVTLVAHAILDMGRMREALLLMEFCGKSLVSV  120

Query  665  LEGR  676
            LEGR
Sbjct  121  LEGR  124



>ref|XP_008671591.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Zea mays]
Length=640

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQ---TGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALK  484
            MWR K F  KEQ   +GLEGRT+D+GN+KV VR  IAEGGFS VY  RD+++ +KQYALK
Sbjct  1    MWRLKQFIPKEQPSPSGLEGRTVDVGNVKVHVREAIAEGGFSSVYAARDLVNPAKQYALK  60

Query  485  HIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSV  664
             +I  DEES++LV KEI VM+SLKGHPN+VTL AH+I DMGR +EAL+ ME+C KSLVSV
Sbjct  61   RVIVQDEESLNLVQKEITVMRSLKGHPNVVTLVAHAILDMGRMREALLLMEFCGKSLVSV  120

Query  665  LEGR  676
            LEGR
Sbjct  121  LEGR  124



>ref|XP_011042010.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase DDB_G0276461 [Populus euphratica]
Length=428

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWRFK FT KE  GLEGR++D+G LK+ VRN IAEGGFSCVYL RD +H +KQYALKH+I
Sbjct  1    MWRFKHFTQKEPAGLEGRSLDVGILKIHVRNAIAEGGFSCVYLARDAVHAAKQYALKHMI  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  670
            CNDEES++LV+K+INVMK+LK HPN+VTL AH+I DMGR K      E+CEKSL SVLE
Sbjct  61   CNDEESLELVVKDINVMKALKRHPNVVTLYAHTILDMGRAK-----XEFCEKSLFSVLE  114



>gb|AFW72092.1| putative protein kinase superfamily protein [Zea mays]
Length=516

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MW+  PF  K  +GL+GRTI + +LK+ VRN+IA+GGFSCVYL  D +H SK YALKHII
Sbjct  1    MWKRNPFGGKAHSGLDGRTIVVRSLKISVRNVIAQGGFSCVYLACDTVHPSKMYALKHII  60

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND ES+DLV+KEI VM  LKGHPN+VTL AH + DMGRTKEAL+ ME+CEKSLVS +E 
Sbjct  61   CNDSESLDLVMKEIQVMNLLKGHPNVVTLVAHDVVDMGRTKEALLVMEFCEKSLVSAMES  120

Query  674  R  676
            R
Sbjct  121  R  121



>gb|AFW72091.1| putative protein kinase superfamily protein [Zea mays]
Length=735

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  311  IMWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            IMW+  PF  K  +GL+GRTI + +LK+ VRN+IA+GGFSCVYL  D +H SK YALKHI
Sbjct  219  IMWKRNPFGGKAHSGLDGRTIVVRSLKISVRNVIAQGGFSCVYLACDTVHPSKMYALKHI  278

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  670
            ICND ES+DLV+KEI VM  LKGHPN+VTL AH + DMGRTKEAL+ ME+CEKSLVS +E
Sbjct  279  ICNDSESLDLVMKEIQVMNLLKGHPNVVTLVAHDVVDMGRTKEALLVMEFCEKSLVSAME  338

Query  671  GR  676
             R
Sbjct  339  SR  340



>gb|EAZ08411.1| hypothetical protein OsI_30675 [Oryza sativa Indica Group]
Length=703

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQ-TGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            MWR K F  +EQ +GLEGRT+D+GN++V VR  +AEGGFSCVYL RD  + +KQYALKH+
Sbjct  1    MWRLKQFMPREQPSGLEGRTVDVGNVRVHVREPVAEGGFSCVYLARDAANPAKQYALKHV  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVL  667
            +  DEES+DLV KEI VM+SLKGHPN+V L AH++ D  GR +EAL+ ME+CEKSLV+ L
Sbjct  61   VIQDEESLDLVRKEIMVMRSLKGHPNVVALVAHAVLDTGGRAREALLVMEFCEKSLVAAL  120

Query  668  EGR  676
            E R
Sbjct  121  ESR  123



>dbj|BAD26025.1| putative AAK1 protein [Oryza sativa Japonica Group]
Length=703

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQ-TGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            MWR K F  +EQ +GLEGRT+D+GN++V VR  +AEGGFSCVYL RD  + +KQYALKH+
Sbjct  1    MWRLKQFMPREQPSGLEGRTVDVGNVRVHVREPVAEGGFSCVYLARDAANPAKQYALKHV  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVL  667
            +  DEES+DLV KEI VM+SLKGHPN+V L AH++ D  GR +EAL+ ME+CEKSLV+ L
Sbjct  61   VIQDEESLDLVRKEIMVMRSLKGHPNVVALVAHAVLDTGGRAREALLVMEFCEKSLVAAL  120

Query  668  EGR  676
            E R
Sbjct  121  ESR  123



>ref|XP_010237997.1| PREDICTED: AP2-associated protein kinase 1-like [Brachypodium 
distachyon]
Length=697

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 5/126 (4%)
 Frame = +2

Query  314  MWR-FKPFTAKEQTG----LEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYA  478
            MWR F+    KE +G    LEGRTID+GN+KV VR  IAEGGFS VYL RD+++ ++QYA
Sbjct  1    MWRPFRQLMPKEHSGPSGGLEGRTIDVGNVKVHVREAIAEGGFSFVYLARDLMNPARQYA  60

Query  479  LKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLV  658
            LKH+I  D ES+DLV KEI VM+SLKGHPN+VTL AH+I DMGR +EAL+ ME+CE+SLV
Sbjct  61   LKHVIVQDRESLDLVQKEITVMRSLKGHPNVVTLVAHAILDMGRAREALLLMEFCERSLV  120

Query  659  SVLEGR  676
            S LE R
Sbjct  121  STLESR  126



>dbj|BAJ97005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 5/126 (4%)
 Frame = +2

Query  314  MWR-FKPFTAKEQTG----LEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYA  478
            MWR F+    KE +G    LEGRTID+GN+KV VR  IAEGGFSCVYL RD+ + +K YA
Sbjct  1    MWRPFRQLMPKEHSGPSGGLEGRTIDVGNVKVHVREAIAEGGFSCVYLARDLTNPAKHYA  60

Query  479  LKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLV  658
            LKH+I  D+ES+DLV KEI VM++LKGHPN+VTL AH+I DMGR +EAL+ ME+CE+SLV
Sbjct  61   LKHVIVQDKESLDLVHKEITVMRALKGHPNVVTLVAHTILDMGRGREALLLMEFCERSLV  120

Query  659  SVLEGR  676
            S L+ R
Sbjct  121  SALDAR  126



>gb|EMT09791.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=685

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +2

Query  314  MWR-FKPFTAKEQTG----LEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYA  478
            MWR F+    KE +G    LEGRTID+GN+KV VR  IAEGGFSCVYL RD+ + +KQYA
Sbjct  1    MWRPFRQLMPKEHSGPSGGLEGRTIDVGNVKVHVREAIAEGGFSCVYLARDLTNPAKQYA  60

Query  479  LKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLV  658
            LKH+I  D+E +DLV KEI VM++LKGHPN+VTL AH+I D GR +EAL+ ME+CE+SLV
Sbjct  61   LKHVIVQDKELLDLVQKEITVMRALKGHPNVVTLVAHAILDTGRGREALLLMEFCERSLV  120

Query  659  SVLEGR  676
            S L+ R
Sbjct  121  SALDAR  126



>gb|EEE69334.1| hypothetical protein OsJ_28650 [Oryza sativa Japonica Group]
Length=1010

 Score =   172 bits (435),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 78/123 (63%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQ-TGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            MWR K F  +EQ +GLEGRT+D+GN++V VR  +AEGGFSCVYL RD  + +KQYALKH+
Sbjct  1    MWRLKQFMPREQPSGLEGRTVDVGNVRVHVREPVAEGGFSCVYLARDAANPAKQYALKHV  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVL  667
            +  DEES+DLV KEI VM+SLKGHPN+V L AH++ D  GR +EAL+ ME+CEKSLV+ L
Sbjct  61   VIQDEESLDLVRKEIMVMRSLKGHPNVVALVAHAVLDTGGRAREALLVMEFCEKSLVAAL  120

Query  668  EGR  676
            E R
Sbjct  121  ESR  123



>ref|XP_002993350.1| hypothetical protein SELMODRAFT_187420 [Selaginella moellendorffii]
 gb|EFJ05535.1| hypothetical protein SELMODRAFT_187420 [Selaginella moellendorffii]
Length=319

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWR K    K+Q GLEG+++++G LK+QVR+++AEGGFS VYL RD   G K YALKH+I
Sbjct  1    MWRLKQLMPKDQAGLEGKSVEVGALKLQVRSVVAEGGFSSVYLARDAQSG-KNYALKHLI  59

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+ LV KE+ VMK+L+GHPNIVTL AH++   GRTKE  + M+YCEK+LV+VL+ 
Sbjct  60   CNDDESLHLVRKEVAVMKALRGHPNIVTLHAHAVLANGRTKECFLVMDYCEKTLVAVLDA  119

Query  674  R  676
            R
Sbjct  120  R  120



>ref|XP_002972735.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
 gb|EFJ25956.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
Length=543

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHII  493
            MWR K    K+Q GLEG+++++G LK+QVR+++AEGGFS VYL RD   G K YALKH+I
Sbjct  1    MWRLKQLMPKDQAGLEGKSVEVGTLKLQVRSVVAEGGFSSVYLARDAQSG-KNYALKHLI  59

Query  494  CNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            CND+ES+ LV KE+ VMK+L+GHPNIVTL AH++   GRTKE  + M+YCEK+LV+VL+ 
Sbjct  60   CNDDESLHLVRKEVAVMKALRGHPNIVTLHAHAVLANGRTKECFLVMDYCEKTLVAVLDA  119

Query  674  R-IRLF*RKQIL  706
            R    F  +Q+L
Sbjct  120  RGAGFFEERQLL  131



>ref|XP_006660487.1| PREDICTED: AP2-associated protein kinase 1-like [Oryza brachyantha]
Length=710

 Score =   160 bits (404),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/123 (58%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  314  MWRFKPFTAKEQ-TGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHI  490
            MWR K    +EQ +GLEGRT+D+GN++V VR  IAEGGFSCVYL RD    ++QYALKH+
Sbjct  1    MWRLKQLMPREQPSGLEGRTVDVGNVRVHVREPIAEGGFSCVYLARDAASPARQYALKHV  60

Query  491  ICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVL  667
            +  DE+S+ LV +EI  M+SL+GHPN+V L AH++ D  GR +EAL+ ME+C+KSLV+ L
Sbjct  61   VVQDEDSLGLVRREITAMRSLRGHPNVVALVAHAVLDAGGRAREALLVMEFCDKSLVAAL  120

Query  668  EGR  676
            E R
Sbjct  121  ESR  123



>ref|XP_001769351.1| predicted protein [Physcomitrella patens]
 gb|EDQ65720.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +2

Query  314  MWRFKPFTAKEQTG--LEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKH  487
            MWR K F   ++ G  LEG+ +D+G+LK+QVR++IA+GGFS VYL ++   G K YALKH
Sbjct  1    MWRLKQFMPNKEAGGTLEGKHVDVGDLKLQVRSVIAQGGFSSVYLAKESSTG-KTYALKH  59

Query  488  IICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVL  667
            IICND ES++LV KE+ VMK+L+GHPN+VTL    ++D GRTKE  + MEYC K L  VL
Sbjct  60   IICNDVESVELVKKEVAVMKALRGHPNVVTLHGQVVYDCGRTKECFLVMEYCHKMLAHVL  119

Query  668  EGR-IRLF*RKQIL  706
            E R    +  KQIL
Sbjct  120  ENRGAGYYDEKQIL  133



>emb|CDY12158.1| BnaC04g11880D [Brassica napus]
Length=577

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 30/133 (23%)
 Frame = +2

Query  287  CIVYSELQIMWRFKPFTAKEQT--GLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIH  460
             +V S  + MW+FKPF  KE    GLE +                           D  H
Sbjct  22   VLVTSTDRNMWKFKPFAQKEPAAAGLEAQ---------------------------DTSH  54

Query  461  GSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGR-TKEALICME  637
             SKQYALKH++CND+ES++LV+KEI+V+KSL+GHPN+VTL AH I DMGR  KEAL+ ME
Sbjct  55   PSKQYALKHMVCNDDESLELVMKEISVLKSLRGHPNVVTLYAHGILDMGRGKKEALLAME  114

Query  638  YCEKSLVSVLEGR  676
            +C KSLV VLE R
Sbjct  115  FCGKSLVEVLESR  127



>ref|XP_011087160.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
 ref|XP_011087168.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
Length=626

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  524  LKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQ  700
            +KEI+VMK+LKGHPN+VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE R    F  KQ
Sbjct  1    MKEISVMKTLKGHPNVVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLESRGAGFFDEKQ  60

Query  701  IL  706
            +L
Sbjct  61   VL  62



>gb|ENN75844.1| hypothetical protein YQE_07573, partial [Dendroctonus ponderosae]
Length=1146

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +2

Query  329  PFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEE  508
            P   + +    G+ ++I N+K+++R +IAEGGF+ V++ +D   G K YALK ++  DEE
Sbjct  15   PANGQNENSFVGQIVEISNVKLKIREVIAEGGFAVVFIAQDTATG-KDYALKRLLAADEE  73

Query  509  SMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVLEG  673
            +   +L+EINV+K + GHPNI+   + S  D  +T     E L+  E C   SLV +L+ 
Sbjct  74   AKKNILQEINVLKRISGHPNIIQYLSASFIDKSQTDHGQSEFLLVTELCPGGSLVDLLKS  133

Query  674  RIRLF  688
            R   F
Sbjct  134  RTTAF  138



>gb|ERL88847.1| hypothetical protein D910_06229 [Dendroctonus ponderosae]
Length=1135

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +2

Query  329  PFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEE  508
            P   + +    G+ ++I N+K+++R +IAEGGF+ V++ +D   G K YALK ++  DEE
Sbjct  15   PANGQNENSFVGQIVEISNVKLKIREVIAEGGFAVVFIAQDTATG-KDYALKRLLAADEE  73

Query  509  SMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVLEG  673
            +   +L+EINV+K + GHPNI+   + S  D  +T     E L+  E C   SLV +L+ 
Sbjct  74   AKKNILQEINVLKRISGHPNIIQYLSASFIDKSQTDHGQSEFLLVTELCPGGSLVDLLKS  133

Query  674  RIRLF  688
            R   F
Sbjct  134  RTTAF  138



>ref|XP_967193.1| PREDICTED: cyclin-G-associated kinase [Tribolium castaneum]
 gb|EFA09916.1| hypothetical protein TcasGA2_TC012067 [Tribolium castaneum]
Length=1123

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +2

Query  329  PFTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEE  508
            P   +      G+ I+I N+K++++ +IAEGGF+ V++ +DV  G K YALK ++  DEE
Sbjct  15   PTNGQSDNNFVGQVIEISNVKLRIKKVIAEGGFAVVFVAQDVATG-KDYALKRLLAADEE  73

Query  509  SMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVLEG  673
            + + +++EIN++K L GHPNI+   + S  D  +T     E L+  E C   SL  +L+ 
Sbjct  74   AKNNIMQEINILKKLAGHPNIIQYLSASFIDKSQTTHGKAEFLLVTELCTGGSLAEILQA  133

Query  674  RIRLF  688
            R   F
Sbjct  134  RSAPF  138



>ref|XP_012023085.1| PREDICTED: cyclin-G-associated kinase isoform X6 [Ovis aries 
musimon]
Length=1267

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 74/116 (64%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            A++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   ARDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|XP_012023082.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Ovis aries 
musimon]
Length=1321

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 46/116 (40%), Positives = 74/116 (64%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            A++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   ARDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>pdb|4C59|A Chain A, Structure Of Gak Kinase In Complex With Nanobody (nbgak_4)
 pdb|4C58|A Chain A, Structure Of Gak Kinase In Complex With Nanobody (nbgak_4)
 pdb|4C57|A Chain A, Structure Of Gak Kinase In Complex With A Nanobody
 pdb|4C57|B Chain B, Structure Of Gak Kinase In Complex With A Nanobody
Length=340

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  10   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  68

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  69   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  124



>ref|XP_010804661.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Bos taurus]
Length=1138

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|NP_001039549.1| cyclin-G-associated kinase [Bos taurus]
 gb|AAI05344.1| Cyclin G associated kinase [Bos taurus]
Length=1268

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>tpg|DAA28426.1| TPA: cyclin-G-associated kinase [Bos taurus]
Length=1268

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|XP_004927169.1| PREDICTED: cyclin-G-associated kinase-like [Bombyx mori]
Length=354

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 76/120 (63%), Gaps = 6/120 (5%)
 Frame = +2

Query  362  GRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINV  541
            G+ ++IGN+K++V+ +IAEGGF+ V++ +DV  G+ +YALK ++  DE++   +++EI++
Sbjct  26   GQFVEIGNMKLRVKKVIAEGGFAFVFVAQDVTTGT-EYALKRLMAADEQANKNIIQEISI  84

Query  542  MKSLKGHPNIVTLCAHSIFDMGRTK----EALICMEYCE-KSLVSVLEGRIRLF*RKQIL  706
            +K L GHPNI+   A S  D  +T     E L+  + C   SL+  L+ R + F    IL
Sbjct  85   LKKLSGHPNIIKYIAASFIDKTKTSHGMGEYLLLTDLCSGGSLMEALQNRGQAFPLPTIL  144



>ref|XP_011427792.1| PREDICTED: cyclin-G-associated kinase-like [Crassostrea gigas]
Length=1471

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +2

Query  362  GRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINV  541
            G+ +++G  K++VR +IAEGGF+ VY+ +DV  G K YALK ++ +D+E  ++V+ EI  
Sbjct  25   GQIVELGQQKLRVRRVIAEGGFAFVYVAQDVTTG-KDYALKRLLAHDKEKNEMVMNEIKY  83

Query  542  MKSLKGHPNIVT-LCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            +K L GHPNIV  + A S  D G+  E L+  E C   L+SVL G
Sbjct  84   LKKLSGHPNIVEFIAAASDSDKGQC-EYLLLTELCTGQLISVLNG  127



>dbj|BAK62989.1| cyclin G-associated kinase [Pan troglodytes]
Length=402

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011792184.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Colobus angolensis 
palliatus]
Length=1306

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 75/117 (64%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G+L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGDLRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EKC40964.1| Cyclin G-associated kinase [Crassostrea gigas]
Length=1383

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +2

Query  362  GRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINV  541
            G+ +++G  K++VR +IAEGGF+ VY+ +DV  G K YALK ++ +D+E  ++V+ EI  
Sbjct  25   GQIVELGQQKLRVRRVIAEGGFAFVYVAQDVTTG-KDYALKRLLAHDKEKNEMVMNEIKY  83

Query  542  MKSLKGHPNIVT-LCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  673
            +K L GHPNIV  + A S  D G+  E L+  E C   L+SVL G
Sbjct  84   LKKLSGHPNIVEFIAAASDSDKGQC-EYLLLTELCTGQLISVLNG  127



>ref|XP_003934667.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Saimiri boliviensis 
boliviensis]
Length=1311

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++ +   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDHSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C+  LV  L+
Sbjct  80   RAIIQEVCFMKRLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCKGQLVEFLK  135



>ref|XP_011598855.1| PREDICTED: cyclin-G-associated kinase-like [Aquila chrysaetos 
canadensis]
Length=255

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_010992167.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-G-associated kinase-like 
[Camelus dromedarius]
Length=1233

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 74/116 (64%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ ++EE   
Sbjct  22   GRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSDEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C+  LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCKGQLVEFLK  135



>ref|XP_009445459.1| PREDICTED: cyclin-G-associated kinase isoform X10 [Pan troglodytes]
Length=1197

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961966.1| PREDICTED: cyclin-G-associated kinase isoform X9 [Pan paniscus]
Length=1197

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008016367.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Chlorocebus 
sabaeus]
Length=1236

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005272327.1| PREDICTED: cyclin-G-associated kinase isoform X10 [Homo sapiens]
Length=1236

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011743105.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Macaca nemestrina]
Length=1262

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008016366.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Chlorocebus 
sabaeus]
Length=1262

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005554310.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Macaca fascicularis]
Length=1262

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011511733.1| PREDICTED: cyclin-G-associated kinase isoform X8 [Homo sapiens]
Length=1272

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445456.1| PREDICTED: cyclin-G-associated kinase isoform X7 [Pan troglodytes]
Length=1272

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961964.1| PREDICTED: cyclin-G-associated kinase isoform X6 [Pan paniscus]
Length=1272

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445453.1| PREDICTED: cyclin-G-associated kinase isoform X5 [Pan troglodytes]
Length=1300

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961962.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Pan paniscus]
Length=1300

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005272325.1| PREDICTED: cyclin-G-associated kinase isoform X5 [Homo sapiens]
Length=1300

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011511730.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Homo sapiens]
Length=1306

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445452.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Pan troglodytes]
Length=1306

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011743104.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Macaca nemestrina]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011914720.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Cercocebus 
atys]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011826281.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Mandrillus 
leucophaeus]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_010373626.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Rhinopithecus 
roxellana]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008016365.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Chlorocebus 
sabaeus]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|NP_005246.2| cyclin-G-associated kinase isoform 1 [Homo sapiens]
 sp|O14976.2|GAK_HUMAN RecName: Full=Cyclin-G-associated kinase [Homo sapiens]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>dbj|BAA22623.1| HsGAK [Homo sapiens]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005554309.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Macaca fascicularis]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004038357.1| PREDICTED: cyclin-G-associated kinase isoform 1 [Gorilla gorilla 
gorilla]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_003811350.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Pan paniscus]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EHH14197.1| Cyclin-G-associated kinase [Macaca mulatta]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_001140835.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Pan troglodytes]
Length=1311

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011914718.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Cercocebus 
atys]
Length=1314

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011511729.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Homo sapiens]
Length=1325

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_010992219.1| PREDICTED: cyclin-G-associated kinase, partial [Camelus dromedarius]
Length=516

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
              ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ ++EE  
Sbjct  21   AGRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSDEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+ ME C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLMELCKGQLVEFLK  135



>ref|XP_011511728.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Homo sapiens]
Length=1344

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445451.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Pan troglodytes]
Length=1344

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961961.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Pan paniscus]
Length=1344

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_011511727.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Homo sapiens]
Length=1355

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445450.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Pan troglodytes]
Length=1355

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961960.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Pan paniscus]
Length=1355

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_003801191.1| PREDICTED: cyclin-G-associated kinase [Otolemur garnettii]
Length=1341

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 74/116 (64%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            A++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   ARDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_006747975.1| PREDICTED: cyclin-G-associated kinase-like [Leptonychotes weddellii]
Length=1151

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EAW82645.1| cyclin G associated kinase, isoform CRA_b [Homo sapiens]
Length=747

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004396292.1| PREDICTED: cyclin-G-associated kinase [Odobenus rosmarus divergens]
Length=1309

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    
Sbjct  23   RDQTDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  82   IIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EDL20101.1| cyclin G associated kinase, isoform CRA_c [Mus musculus]
Length=135

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 71/114 (62%), Gaps = 7/114 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
              ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE  
Sbjct  21   AGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVS  661
              +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+   VS
Sbjct  80   RAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKAGGVS  132



>ref|XP_003280582.1| PREDICTED: cyclin-G-associated kinase [Nomascus leucogenys]
Length=1466

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 75/117 (64%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G+L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGDLRLRVRRVLAEGGFAFVYEAQDMGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>pdb|4O38|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase 
(gak)
 pdb|4O38|B Chain B, Crystal Structure Of The Human Cyclin G Associated Kinase 
(gak)
Length=338

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  12   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  70

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+   K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  71   RAIIQEVCFXKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  126



>ref|XP_536279.4| PREDICTED: cyclin-G-associated kinase isoform X7 [Canis lupus 
familiaris]
Length=1304

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLASG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFLK  135



>ref|XP_004432258.1| PREDICTED: cyclin-G-associated kinase [Ceratotherium simum simum]
Length=1301

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 71/115 (62%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLESG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C   LV  L
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFL  134



>ref|XP_005504640.1| PREDICTED: cyclin-G-associated kinase [Columba livia]
Length=1316

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            T+++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   TSRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCRGQLVEFLK  134



>gb|KDR23238.1| Cyclin G-associated kinase [Zootermopsis nevadensis]
Length=1311

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 6/116 (5%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            T+  +  L G+T+++GN+K++V+ +IAEGGF+ V++ +D   G K YALK +I  DE++ 
Sbjct  17   TSGAENELIGQTVEVGNVKLRVKKVIAEGGFAFVFMAQDPNTG-KDYALKRLIAADEDAN  75

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVL  667
            +++ +EIN+++ L GHPNI+   A +  D  ++     E L+  E C   SLV VL
Sbjct  76   NIIKQEINILRKLSGHPNIIQYLAAAYIDRSKSGHGCGEYLLVTELCTGGSLVDVL  131



>gb|EMC87866.1| Cyclin G-associated kinase [Columba livia]
Length=1289

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            T+++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   TSRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCRGQLVEFLK  134



>ref|NP_001125100.1| cyclin-G-associated kinase [Pongo abelii]
 emb|CAH90237.1| hypothetical protein [Pongo abelii]
Length=1311

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++ +   G+T+++G+L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDHSDFVGQTVELGDLRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005001604.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Cavia porcellus]
Length=1308

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            T ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE  
Sbjct  21   TGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  80   RAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_003465097.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Cavia porcellus]
Length=1310

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            T ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE  
Sbjct  21   TGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  80   RAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_424873.4| PREDICTED: cyclin-G-associated kinase [Gallus gallus]
Length=1318

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 72/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G +K+++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGEMKLRIRRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_010227060.1| PREDICTED: cyclin-G-associated kinase [Tinamus guttatus]
Length=1321

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++V+ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRVKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_004319454.1| PREDICTED: cyclin-G-associated kinase-like, partial [Tursiops 
truncatus]
Length=1052

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GH NIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHANIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|XP_008062193.1| PREDICTED: cyclin-G-associated kinase [Tarsius syrichta]
Length=1310

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004265273.1| PREDICTED: cyclin-G-associated kinase [Orcinus orca]
Length=1278

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++QT   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GH NIV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  81   AIIQEVCFMKKLSGHANIVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|XP_010787144.1| PREDICTED: cyclin-G-associated kinase-like, partial [Notothenia 
coriiceps]
Length=264

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 71/118 (60%), Gaps = 7/118 (6%)
 Frame = +2

Query  332  FTAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEES  511
               ++Q    G+ +++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE 
Sbjct  19   LAGRDQNDFVGQVVELGDMKLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEK  77

Query  512  MDLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
               +++E+  MK L GHPN+V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  78   NKEIIQEVCFMKKLSGHPNMVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_006874199.1| PREDICTED: cyclin-G-associated kinase [Chrysochloris asiatica]
Length=1362

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q    G+T+++G L+++VR ++AEGGF+ VY  +D+  G K+YALK ++ N+EE   
Sbjct  22   GRDQNDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-KEYALKRLLSNEEEKSR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             V++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  81   AVIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFVK  135



>gb|EDL20100.1| cyclin G associated kinase, isoform CRA_b [Mus musculus]
Length=129

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
              ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE  
Sbjct  21   AGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCE  646
              +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+
Sbjct  80   RAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCK  127



>ref|XP_006259318.1| PREDICTED: cyclin-G-associated kinase [Alligator mississippiensis]
Length=1325

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVELGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPN+V  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNVVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFLK  134



>ref|XP_002187781.1| PREDICTED: cyclin-G-associated kinase [Taeniopygia guttata]
Length=1259

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_004383590.1| PREDICTED: cyclin-G-associated kinase [Trichechus manatus latirostris]
Length=1324

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q    G+T+++G L+++VR ++AEGGF+ VY  +D+  G K+YALK ++ N+EE   
Sbjct  22   GRDQNDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-KEYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFIK  135



>ref|XP_005486323.1| PREDICTED: cyclin-G-associated kinase [Zonotrichia albicollis]
Length=1318

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_005530967.1| PREDICTED: cyclin-G-associated kinase [Pseudopodoces humilis]
Length=1318

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVGFLK  134



>ref|XP_005154929.1| PREDICTED: cyclin-G-associated kinase [Melopsittacus undulatus]
Length=1317

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_004617496.1| PREDICTED: cyclin-G-associated kinase [Sorex araneus]
Length=1283

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++ T   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    
Sbjct  23   RDHTDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  82   IIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005061068.1| PREDICTED: cyclin-G-associated kinase [Ficedula albicollis]
Length=1316

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q    G+T+++G++K++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  20   ASRDQNDFVGQTVEMGDMKLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCKGQLVEFLK  134



>ref|XP_007671015.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Ornithorhynchus 
anatinus]
Length=1333

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++ T   G+T+++G+L+++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    
Sbjct  23   RDHTDFVGQTVELGDLRLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  82   IIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|NP_001016350.2| cyclin-G-associated kinase [Xenopus (Silurana) tropicalis]
 gb|AAI55676.1| gak protein [Xenopus (Silurana) tropicalis]
Length=1322

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
              ++Q    G+T+++G++K++V+ +IAEGGF+ VY  +DV  G K YALK ++ N+EE  
Sbjct  20   AGRDQHDFVGQTVEMGDMKMRVKRVIAEGGFAFVYEAQDVGSG-KDYALKRLLSNEEEKN  78

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
              +++EI  MK L GHPNIV  C+ +       D G+  E L+  E C   LV  L
Sbjct  79   KSIIQEICFMKKLSGHPNIVQFCSAASIGKEESDTGQG-EFLLLTELCRGQLVEFL  133



>ref|XP_007953955.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Orycteropus 
afer afer]
Length=1321

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q    G+T+++G+L+++VR ++AEGGF+ VY  +D+  G K YALK ++ N+EE   
Sbjct  22   GRDQNDFVGQTVELGDLRLRVRRVLAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFIK  135



>ref|XP_007671016.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Ornithorhynchus 
anatinus]
Length=1331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++ T   G+T+++G+L+++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    
Sbjct  23   RDHTDFVGQTVELGDLRLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  82   IIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_003341497.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-G-associated kinase [Monodelphis 
domestica]
Length=1339

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 72/117 (62%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++ T   G+T+++G+L+++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE  
Sbjct  21   ASRDHTDFVGQTVELGDLRLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
              +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  80   KAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_007671018.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Ornithorhynchus 
anatinus]
Length=1276

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++ T   G+T+++G+L+++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    
Sbjct  23   RDHTDFVGQTVELGDLRLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  82   IIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_007671017.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Ornithorhynchus 
anatinus]
Length=1280

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++ T   G+T+++G+L+++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    
Sbjct  23   RDHTDFVGQTVELGDLRLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  82   IIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005359727.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Microtus ochrogaster]
Length=1280

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR I+AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRILAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_005359726.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Microtus ochrogaster]
Length=1302

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR I+AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRILAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_005359725.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Microtus ochrogaster]
Length=1304

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR I+AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRILAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_008840008.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Nannospalax 
galili]
Length=1251

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   SRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_008840007.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Nannospalax 
galili]
Length=1258

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   SRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_008840006.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Nannospalax 
galili]
Length=1292

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   SRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_008840005.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Nannospalax 
galili]
Length=1300

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   SRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_006985869.1| PREDICTED: cyclin-G-associated kinase [Peromyscus maniculatus 
bairdii]
Length=1278

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
             +++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE  
Sbjct  21   ASRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
              +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  80   RAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_006534969.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Mus musculus]
Length=1221

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_006534968.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Mus musculus]
Length=1256

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EDL20099.1| cyclin G associated kinase, isoform CRA_a [Mus musculus]
Length=1297

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>dbj|BAE27365.1| unnamed protein product [Mus musculus]
Length=1305

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|NP_705797.1| cyclin-G-associated kinase isoform 1 [Mus musculus]
 gb|AAH65052.1| Cyclin G associated kinase [Mus musculus]
 dbj|BAE38941.1| unnamed protein product [Mus musculus]
Length=1305

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>sp|Q99KY4.2|GAK_MOUSE RecName: Full=Cyclin-G-associated kinase [Mus musculus]
 gb|AAH60622.1| Cyclin G associated kinase [Mus musculus]
Length=1305

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004656112.1| PREDICTED: cyclin-G-associated kinase [Jaculus jaculus]
Length=1311

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EDL20105.1| cyclin G associated kinase, isoform CRA_g, partial [Mus musculus]
Length=1323

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  40   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  98

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  99   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  153



>ref|XP_004847543.1| PREDICTED: cyclin-G-associated kinase isoform X8 [Heterocephalus 
glaber]
Length=1089

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_006250646.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Rattus norvegicus]
Length=1256

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_006250645.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Rattus norvegicus]
Length=1278

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_005077467.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Mesocricetus 
auratus]
Length=1299

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_005077466.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Mesocricetus 
auratus]
Length=1301

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|NP_112292.1| cyclin-G-associated kinase [Rattus norvegicus]
 sp|P97874.1|GAK_RAT RecName: Full=Cyclin-G-associated kinase [Rattus norvegicus]
 dbj|BAA18911.1| cyclinG-associated kinase [Rattus norvegicus]
Length=1305

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  667
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_004847542.1| PREDICTED: cyclin-G-associated kinase isoform X7 [Heterocephalus 
glaber]
Length=1225

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_004847541.1| PREDICTED: cyclin-G-associated kinase isoform X6 [Heterocephalus 
glaber]
Length=1250

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_005408741.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Chinchilla 
lanigera]
Length=1260

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_004847540.1| PREDICTED: cyclin-G-associated kinase isoform X5 [Heterocephalus 
glaber]
Length=1262

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_005319114.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Ictidomys tridecemlineatus]
Length=1294

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_005319113.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Ictidomys tridecemlineatus]
Length=1295

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_004847539.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Heterocephalus 
glaber]
Length=1297

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_004847536.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Heterocephalus 
glaber]
 ref|XP_004847537.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Heterocephalus 
glaber]
 ref|XP_004847538.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Heterocephalus 
glaber]
Length=1299

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_005408740.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Chinchilla 
lanigera]
Length=1307

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_005408739.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Chinchilla 
lanigera]
Length=1309

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  81   AIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_004579463.1| PREDICTED: cyclin-G-associated kinase [Ochotona princeps]
Length=1210

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ ++EE   
Sbjct  22   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSDEEEKNR  80

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  81   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008250941.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-G-associated kinase [Oryctolagus 
cuniculus]
Length=1272

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
             ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ ++EE   
Sbjct  20   GRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSDEEEKNR  78

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  79   AIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  133



>ref|XP_004624694.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Octodon degus]
Length=1309

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    
Sbjct  23   RDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  82   IIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_004624693.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Octodon degus]
Length=1311

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 42/115 (37%), Positives = 72/115 (63%), Gaps = 7/115 (6%)
 Frame = +2

Query  341  KEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDL  520
            ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    
Sbjct  23   RDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRA  81

Query  521  VLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
            +++E+  +K L GHPNIV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  82   IIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_007557930.1| PREDICTED: cyclin-G-associated kinase [Poecilia formosa]
Length=1308

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q    G+ +++G++K++++ +IAEGGF+ VY  +D + G K YALK ++ N+EE   
Sbjct  21   SRDQNDFVGQVVELGDMKLRIKRVIAEGGFAFVYEAQD-MSGGKDYALKRLLSNEEEKNK  79

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPN+V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  80   EIIQEVCFMKKLSGHPNMVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_008416260.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Poecilia reticulata]
Length=1309

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q    G+ +++G++K++++ +IAEGGF+ VY  +D + G K YALK ++ N+EE   
Sbjct  21   SRDQNDFVGQVVELGDMKLRIKRVIAEGGFAFVYEAQD-MSGGKDYALKRLLSNEEEKNK  79

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPN+V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  80   EIIQEVCFMKKLSGHPNMVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_008416258.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Poecilia reticulata]
Length=1312

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q    G+ +++G++K++++ +IAEGGF+ VY  +D + G K YALK ++ N+EE   
Sbjct  21   SRDQNDFVGQVVELGDMKLRIKRVIAEGGFAFVYEAQD-MSGGKDYALKRLLSNEEEKNK  79

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPN+V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  80   EIIQEVCFMKKLSGHPNMVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>gb|AAH63606.1| GAK protein [Homo sapiens]
Length=587

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = +2

Query  335  TAKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESM  514
            + ++Q+   G+T+++G L+++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE  
Sbjct  21   SGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKN  79

Query  515  DLVLKEINVMKSLKGHPNIVTLCAHS  592
              +++E+  MK L GHPNIV  C+ +
Sbjct  80   RAIIQEVCFMKKLSGHPNIVQFCSAA  105



>ref|XP_011551363.1| PREDICTED: cyclin-G-associated kinase [Plutella xylostella]
Length=1174

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 44/120 (37%), Positives = 76/120 (63%), Gaps = 6/120 (5%)
 Frame = +2

Query  362  GRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINV  541
            G+ ++IGN+K++V+ +IAEGGF+ V++ +DV  G+ +YALK ++  DE++   +++EI++
Sbjct  26   GQFVEIGNMKLRVKKVIAEGGFAFVFVAQDVSSGT-EYALKRLMAADEQANKNIIQEISI  84

Query  542  MKSLKGHPNIVTLCAHSIFDMGRTK----EALICMEYCE-KSLVSVLEGRIRLF*RKQIL  706
            +K L GHPN++   A S  D  +T     E L+  + C   SL+  L+ R   F  + IL
Sbjct  85   LKKLSGHPNVIKYIAASFIDKSKTSHGMGEYLLLTDLCNGGSLMEALQHRGTAFPLQTIL  144



>ref|XP_006790164.1| PREDICTED: cyclin-G-associated kinase-like [Neolamprologus brichardi]
Length=1235

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q    G+ +++G++K+++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE   
Sbjct  21   SRDQNDFVGQVVELGDMKLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNK  79

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPN V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  80   EIIQEVCFMKKLSGHPNTVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_004546976.1| PREDICTED: cyclin-G-associated kinase-like isoform X3 [Maylandia 
zebra]
Length=1313

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = +2

Query  338  AKEQTGLEGRTIDIGNLKVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMD  517
            +++Q    G+ +++G++K+++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE   
Sbjct  21   SRDQNDFVGQVVELGDMKLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNK  79

Query  518  LVLKEINVMKSLKGHPNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  670
             +++E+  MK L GHPN V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  80   EIIQEVCFMKKLSGHPNTVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140