BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig520

Length=1423
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    589   0.0      Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    585   0.0      Nicotiana tomentosiformis
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    574   0.0      Solanum lycopersicum
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    573   0.0      Solanum tuberosum [potatoes]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    565   0.0      Solanum tuberosum [potatoes]
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    564   0.0      Solanum lycopersicum
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    536   1e-180   
gb|KJB62955.1|  hypothetical protein B456_009G445400                    536   2e-180   Gossypium raimondii
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    532   1e-178   Vitis vinifera
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             531   3e-178   Citrus clementina [clementine]
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    531   4e-178   Sesamum indicum [beniseed]
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    526   3e-176   Glycine max [soybeans]
ref|XP_009798152.1|  PREDICTED: probable glycerophosphoryl dieste...    511   9e-176   Nicotiana sylvestris
emb|CDP13760.1|  unnamed protein product                                524   9e-176   Coffea canephora [robusta coffee]
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    516   1e-175   
emb|CAN61355.1|  hypothetical protein VITISV_027762                     520   2e-175   Vitis vinifera
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                   515   2e-175   Citrus sinensis [apfelsine]
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    522   7e-175   Glycine soja [wild soybean]
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   519   7e-175   Citrus sinensis [apfelsine]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                520   7e-174   Erythranthe guttata [common monkey flower]
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   518   1e-173   Citrus sinensis [apfelsine]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    519   2e-173   Ricinus communis
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    518   3e-173   
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    518   3e-173   
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    518   4e-173   Gossypium arboreum [tree cotton]
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    516   2e-172   Gossypium arboreum [tree cotton]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   518   2e-172   Citrus sinensis [apfelsine]
gb|KJB13801.1|  hypothetical protein B456_002G094900                    512   9e-172   Gossypium raimondii
gb|KJB13800.1|  hypothetical protein B456_002G094900                    511   2e-171   Gossypium raimondii
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    513   3e-171   Citrus sinensis [apfelsine]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             512   5e-171   Prunus persica
gb|KJB13799.1|  hypothetical protein B456_002G094900                    511   1e-170   Gossypium raimondii
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    511   2e-170   Cucumis melo [Oriental melon]
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    509   9e-170   Sesamum indicum [beniseed]
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...    496   4e-169   Pyrus x bretschneideri [bai li]
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    507   5e-169   Prunus mume [ume]
ref|XP_012070946.1|  PREDICTED: glycerophosphodiester phosphodies...    507   7e-169   Jatropha curcas
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    504   9e-168   Populus euphratica
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    503   2e-167   Nelumbo nucifera [Indian lotus]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    501   9e-167   Populus euphratica
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    494   1e-166   
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    491   3e-166   
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    496   9e-165   Pyrus x bretschneideri [bai li]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    496   1e-164   Pyrus x bretschneideri [bai li]
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    496   1e-164   Populus euphratica
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    493   7e-164   Nelumbo nucifera [Indian lotus]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    493   1e-163   
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    493   2e-163   
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    493   2e-163   Tarenaya hassleriana [spider flower]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    489   3e-162   Tarenaya hassleriana [spider flower]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             490   4e-162   Eutrema salsugineum [saltwater cress]
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             488   1e-161   Populus trichocarpa [western balsam poplar]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    487   3e-161   Pyrus x bretschneideri [bai li]
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    476   4e-161   
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             486   6e-161   Phaseolus vulgaris [French bean]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    486   7e-161   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    486   8e-161   Glycine soja [wild soybean]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    485   1e-160   Glycine max [soybeans]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    484   4e-160   Arabidopsis thaliana [mouse-ear cress]
gb|AAL07129.1|  unknown protein                                         484   4e-160   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       484   5e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    483   2e-159   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    481   3e-159   
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    481   4e-159   Glycine soja [wild soybean]
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    478   8e-159   
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    480   2e-158   
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    480   3e-158   Camelina sativa [gold-of-pleasure]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    479   5e-158   Glycine max [soybeans]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    479   5e-158   Brassica rapa
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    478   1e-157   Arabis alpina [alpine rockcress]
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    478   2e-157   Nelumbo nucifera [Indian lotus]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             478   2e-157   Phaseolus vulgaris [French bean]
emb|CDX94294.1|  BnaC01g18900D                                          477   2e-157   
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    476   6e-157   
ref|XP_002867546.1|  MRH5/SHV3                                          476   6e-157   
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    476   7e-157   Camelina sativa [gold-of-pleasure]
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g            467   1e-156   Phaseolus vulgaris [French bean]
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    474   3e-156   Camelina sativa [gold-of-pleasure]
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    474   4e-156   Camelina sativa [gold-of-pleasure]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             474   5e-156   Capsella rubella
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    473   1e-155   Brassica rapa
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    471   4e-155   Arabis alpina [alpine rockcress]
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             471   4e-155   Eutrema salsugineum [saltwater cress]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    471   5e-155   Fragaria vesca subsp. vesca
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             471   7e-155   Capsella rubella
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    470   1e-154   Brassica rapa
ref|XP_004150252.1|  PREDICTED: glycerophosphodiester phosphodies...    470   1e-154   Cucumis sativus [cucumbers]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             470   1e-154   Phaseolus vulgaris [French bean]
emb|CDY61647.1|  BnaCnng38120D                                          470   1e-154   Brassica napus [oilseed rape]
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    470   1e-154   Brassica rapa
emb|CDX89312.1|  BnaA01g15810D                                          470   2e-154   
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    470   2e-154   Camelina sativa [gold-of-pleasure]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    469   2e-154   Cicer arietinum [garbanzo]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                468   7e-154   Erythranthe guttata [common monkey flower]
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    468   7e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    468   1e-153   Arabidopsis thaliana [mouse-ear cress]
gb|AAP40466.1|  unknown protein                                         468   1e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    465   7e-153   Brachypodium distachyon [annual false brome]
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    466   9e-153   Brassica rapa
emb|CDY17323.1|  BnaA10g09570D                                          465   1e-152   Brassica napus [oilseed rape]
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    462   2e-152   
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    464   3e-152   Glycine max [soybeans]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    463   1e-151   Brassica rapa
emb|CDY14478.1|  BnaC03g21170D                                          476   2e-151   Brassica napus [oilseed rape]
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    462   2e-151   Elaeis guineensis
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    462   3e-151   Camelina sativa [gold-of-pleasure]
emb|CDY36746.1|  BnaA03g11400D                                          462   3e-151   Brassica napus [oilseed rape]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             462   3e-151   Eutrema salsugineum [saltwater cress]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    461   3e-151   Brassica rapa
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    461   4e-151   Oryza brachyantha
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    457   5e-151   Medicago truncatula
emb|CDY11996.1|  BnaC03g14220D                                          461   1e-150   Brassica napus [oilseed rape]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    460   1e-150   Cicer arietinum [garbanzo]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    459   2e-150   Setaria italica
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    458   5e-150   Glycine soja [wild soybean]
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    458   5e-150   Camelina sativa [gold-of-pleasure]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    457   5e-150   Tarenaya hassleriana [spider flower]
ref|NP_001053060.1|  Os04g0472300                                       457   8e-150   
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              457   9e-150   Medicago truncatula
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    457   1e-149   Fragaria vesca subsp. vesca
emb|CAH67272.1|  B0806H07.1                                             456   3e-149   Oryza sativa [red rice]
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    456   3e-149   Triticum urartu
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             456   3e-149   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    459   4e-149   
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          455   8e-149   Sorghum bicolor [broomcorn]
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    455   9e-149   Camelina sativa [gold-of-pleasure]
dbj|BAJ87963.1|  predicted protein                                      454   1e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85772.1|  predicted protein                                      454   1e-148   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    454   3e-148   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   463   4e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             453   5e-148   Phaseolus vulgaris [French bean]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    454   5e-148   Phoenix dactylifera
emb|CDY13237.1|  BnaC09g24190D                                          453   6e-148   Brassica napus [oilseed rape]
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    452   2e-147   Nelumbo nucifera [Indian lotus]
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    452   2e-147   Elaeis guineensis
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     451   2e-147   Zea mays [maize]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    465   7e-147   Brassica rapa
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    449   3e-146   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047275.1|  Os02g0588500                                       448   3e-146   
emb|CDX92782.1|  BnaC07g40400D                                          463   4e-146   
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    449   4e-146   
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    448   6e-146   Camelina sativa [gold-of-pleasure]
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    435   7e-146   
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    447   1e-145   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF98210.1|AC007152_6  Unknown protein                               457   1e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    447   1e-145   Phoenix dactylifera
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    447   2e-145   
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    447   3e-145   Camelina sativa [gold-of-pleasure]
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             444   4e-145   
emb|CDY46667.1|  BnaA03g48410D                                          460   5e-145   Brassica napus [oilseed rape]
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    445   7e-145   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             442   8e-145   
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             443   9e-145   
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    438   1e-144   
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    442   3e-144   Cicer arietinum [garbanzo]
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    443   5e-144   Elaeis guineensis
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             441   1e-143   Phaseolus vulgaris [French bean]
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             441   2e-143   Capsella rubella
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    455   4e-143   
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    437   2e-142   Medicago truncatula
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              437   5e-142   
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    437   5e-142   Triticum urartu
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    440   2e-141   
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    436   3e-141   Phoenix dactylifera
ref|NP_001169682.1|  hypothetical protein precursor                     434   7e-141   Zea mays [maize]
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          434   7e-141   Sorghum bicolor [broomcorn]
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    445   1e-140   
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    432   2e-140   
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    432   3e-140   Glycine soja [wild soybean]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    432   3e-140   
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    432   4e-140   Glycine max [soybeans]
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    432   5e-140   
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    432   6e-140   
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    431   7e-140   
ref|XP_002888566.1|  kinase family protein                              441   1e-139   
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    441   2e-139   
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             427   2e-138   
gb|AAO42211.1|  unknown protein                                         427   3e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    427   3e-138   
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    427   3e-138   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   423   3e-137   Genlisea aurea
emb|CDY46687.1|  BnaA03g48210D                                          423   7e-137   Brassica napus [oilseed rape]
emb|CDY19634.1|  BnaA05g20420D                                          422   2e-136   Brassica napus [oilseed rape]
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    422   2e-136   Brassica rapa
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    420   4e-136   Setaria italica
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    422   4e-136   Oryza brachyantha
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    418   2e-135   Glycine max [soybeans]
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             419   3e-135   Capsella rubella
emb|CDY36036.1|  BnaC03g41620D                                          422   4e-135   Brassica napus [oilseed rape]
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    420   5e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    419   8e-135   Setaria italica
ref|XP_006856834.1|  PREDICTED: glycerophosphodiester phosphodies...    418   2e-134   Amborella trichopoda
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    417   6e-134   Zea mays [maize]
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    415   9e-134   Glycine soja [wild soybean]
emb|CDX92806.1|  BnaC07g40640D                                          412   2e-132   
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             409   5e-132   Phaseolus vulgaris [French bean]
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    407   4e-130   
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    405   1e-129   Vitis vinifera
emb|CBI18678.3|  unnamed protein product                                405   1e-129   Vitis vinifera
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    405   2e-129   
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    404   4e-129   Arabis alpina [alpine rockcress]
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             402   4e-129   
emb|CDY12605.1|  BnaA02g12730D                                          402   7e-129   Brassica napus [oilseed rape]
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    403   1e-128   Morus notabilis
ref|NP_001062173.1|  Os08g0503200                                       401   2e-127   
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    398   7e-127   
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    397   5e-126   
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    405   6e-126   Setaria italica
dbj|BAJ93663.1|  predicted protein                                      396   6e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    391   8e-126   
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    395   1e-125   Phoenix dactylifera
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    393   1e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006829998.1|  PREDICTED: glycerophosphodiester phosphodies...    393   1e-124   Amborella trichopoda
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    385   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    391   8e-124   Phoenix dactylifera
ref|XP_010485211.1|  PREDICTED: glycerophosphodiester phosphodies...    380   1e-123   Camelina sativa [gold-of-pleasure]
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     390   1e-123   Eucalyptus grandis [rose gum]
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    388   9e-123   Arabidopsis lyrata subsp. lyrata
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    387   2e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    387   2e-122   Camelina sativa [gold-of-pleasure]
emb|CDY11831.1|  BnaC03g12570D                                          380   3e-122   Brassica napus [oilseed rape]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             386   4e-122   
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    386   6e-122   Elaeis guineensis
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    384   3e-121   Elaeis guineensis
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    382   9e-121   Brassica rapa
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    395   1e-120   Triticum urartu
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943              378   1e-120   
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    382   2e-120   Nelumbo nucifera [Indian lotus]
emb|CDY43885.1|  BnaC09g33580D                                          381   3e-120   Brassica napus [oilseed rape]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    381   4e-120   Arabidopsis lyrata subsp. lyrata
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             380   6e-120   Capsella rubella
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          383   1e-119   
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        379   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        379   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                    365   3e-119   
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    378   4e-119   Populus euphratica
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             379   4e-119   Prunus persica
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             378   4e-119   Populus trichocarpa [western balsam poplar]
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    378   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    377   7e-119   
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    377   8e-119   Brassica rapa
emb|CDY60415.1|  BnaC02g45340D                                          387   1e-118   Brassica napus [oilseed rape]
emb|CDY02800.1|  BnaC02g10890D                                          377   1e-118   
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    377   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    376   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    377   2e-118   Pyrus x bretschneideri [bai li]
emb|CDX88656.1|  BnaA03g09930D                                          376   3e-118   
emb|CDY71959.1|  BnaCnng75290D                                          362   4e-118   Brassica napus [oilseed rape]
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    376   5e-118   Prunus mume [ume]
ref|NP_001170117.1|  hypothetical protein                               374   5e-118   Zea mays [maize]
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                     370   7e-118   Eucalyptus grandis [rose gum]
emb|CDY02788.1|  BnaC02g11010D                                          374   8e-118   
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    374   2e-117   
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    374   3e-117   
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    373   5e-117   
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     369   5e-117   Eucalyptus grandis [rose gum]
emb|CDY32720.1|  BnaA02g07820D                                          372   5e-117   Brassica napus [oilseed rape]
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    373   1e-116   Zea mays [maize]
emb|CDY32730.1|  BnaA02g07920D                                          371   1e-116   Brassica napus [oilseed rape]
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    370   4e-116   Brassica rapa
ref|XP_007011972.1|  SHV3-like 5                                        369   9e-116   
gb|EAY86479.1|  hypothetical protein OsI_07859                          368   1e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    369   1e-115   Cucumis melo [Oriental melon]
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    369   2e-115   
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    368   2e-115   
ref|NP_001142429.1|  uncharacterized protein LOC100274608               355   3e-115   
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             367   4e-115   
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    367   9e-115   
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    363   3e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...    365   3e-114   Zea mays [maize]
tpg|DAA63616.1|  TPA: hypothetical protein ZEAMMB73_629479              353   4e-114   
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    364   1e-113   Ricinus communis
ref|XP_004143578.1|  PREDICTED: glycerophosphodiester phosphodies...    364   1e-113   Cucumis sativus [cucumbers]
emb|CDY58867.1|  BnaC09g52640D                                          362   3e-113   Brassica napus [oilseed rape]
gb|AAV64200.1|  unknown                                                 350   4e-113   Zea mays [maize]
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    363   4e-113   
gb|AAV64238.1|  unknown                                                 350   1e-112   Zea mays [maize]
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    369   1e-112   
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             358   2e-112   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    369   4e-112   
ref|NP_001046128.1|  Os02g0187400                                       358   4e-112   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    368   6e-112   
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    358   1e-111   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    358   2e-111   
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    357   2e-110   
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    355   7e-110   
gb|EEE56466.1|  hypothetical protein OsJ_05675                          354   1e-108   
gb|KJB62956.1|  hypothetical protein B456_009G445400                    346   2e-108   
gb|EEC72640.1|  hypothetical protein OsI_06154                          356   2e-108   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...    350   3e-108   
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    344   3e-107   
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    346   8e-107   
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    343   1e-106   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...    343   7e-106   
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    344   7e-106   
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...    341   8e-106   
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    343   2e-105   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...    340   1e-104   
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    339   4e-104   
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                    327   5e-104   
dbj|BAK08209.1|  predicted protein                                      338   1e-103   
ref|XP_012071459.1|  PREDICTED: glycerophosphodiester phosphodies...    338   1e-103   
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          337   2e-103   
emb|CDP10204.1|  unnamed protein product                                331   6e-101   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...    330   1e-100   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg                329   2e-100   
ref|NP_001062919.2|  Os09g0339800                                       324   9e-100   
emb|CDY45656.1|  BnaC09g31980D                                          324   2e-99    
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...    328   2e-98    
gb|EEE53168.1|  hypothetical protein OsJ_36008                          332   5e-98    
gb|KJB54927.1|  hypothetical protein B456_009G054700                    322   1e-97    
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    317   1e-96    
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...    327   2e-96    
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...    311   4e-94    
gb|EPS68532.1|  hypothetical protein M569_06231                         309   1e-93    
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...    311   3e-93    
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...    309   2e-92    
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...    306   1e-91    
emb|CDY29432.1|  BnaC05g32380D                                          300   9e-91    
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...    303   2e-90    
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...    305   4e-90    
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                   300   5e-90    
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...    301   6e-90    
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...    298   2e-88    
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...    298   2e-88    
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...    298   2e-88    
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g             298   4e-88    
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    287   1e-85    
ref|XP_003610370.1|  GPI-anchored protein                               290   2e-85    
emb|CDY72472.1|  BnaAnng41260D                                          277   1e-84    
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                    283   7e-84    
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...    285   9e-84    
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...    283   3e-83    
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...    276   1e-81    
gb|AFW66253.1|  hypothetical protein ZEAMMB73_246886                    261   3e-79    
ref|XP_010474166.1|  PREDICTED: glycerophosphodiester phosphodies...    258   8e-79    
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...    264   5e-77    
ref|XP_010488033.1|  PREDICTED: glycerophosphodiester phosphodies...    250   9e-76    
gb|KHM99501.1|  Putative glycerophosphoryl diester phosphodiester...    236   1e-70    
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548             247   5e-70    
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702             243   2e-68    
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350          238   1e-67    
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...    238   6e-67    
emb|CDY12600.1|  BnaA02g12680D                                          235   7e-65    
ref|XP_001756342.1|  predicted protein                                  226   1e-62    
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...    223   2e-62    
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             223   4e-62    
ref|XP_001766682.1|  predicted protein                                  215   1e-58    
gb|EEC69228.1|  hypothetical protein OsI_38235                          215   1e-57    
gb|AAD10252.1|  S222                                                    196   4e-53    
ref|XP_001756508.1|  predicted protein                                  191   1e-49    
gb|AFW58563.1|  hypothetical protein ZEAMMB73_741781                    173   1e-47    
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...    181   5e-47    
ref|XP_010470590.1|  PREDICTED: glycerophosphodiester phosphodies...    149   3e-39    
emb|CDX71386.1|  BnaC04g16210D                                          148   3e-38    
gb|EEE69509.1|  hypothetical protein OsJ_28963                          154   8e-38    
emb|CDY60410.1|  BnaC02g45300D                                          145   1e-37    
emb|CDY12601.1|  BnaA02g12690D                                          143   8e-37    
ref|XP_009127509.1|  PREDICTED: probable glycerophosphoryl dieste...    142   2e-36    
ref|XP_004506009.1|  PREDICTED: uncharacterized protein LOC101491157    147   5e-36    
ref|XP_010422831.1|  PREDICTED: glycerophosphodiester phosphodies...    140   6e-36    
dbj|BAD17454.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    129   4e-32    
ref|XP_010474169.1|  PREDICTED: glycerophosphodiester phosphodies...    129   1e-29    
emb|CDX82243.1|  BnaA03g35780D                                          126   2e-29    
ref|WP_008906374.1|  glycerophosphoryl diester phosphodiesterase        122   2e-27    
ref|WP_026880196.1|  glycerophosphodiester phosphodiesterase            119   2e-26    
gb|EDX77851.1|  Glycerophosphoryl diester phosphodiesterase family      117   6e-26    
ref|WP_044205264.1|  glycerophosphodiester phosphodiesterase            117   6e-26    
ref|WP_044401406.1|  glycerophosphodiester phosphodiesterase            116   2e-25    
dbj|BAJ92515.1|  predicted protein                                      113   2e-25    
emb|CDX86766.1|  BnaA09g21560D                                          117   9e-25    
ref|WP_026436377.1|  glycerophosphodiester phosphodiesterase            114   1e-24    
ref|WP_010463978.1|  glycerophosphoryl diester phosphodiesterase        114   2e-24    
emb|CDX82242.1|  BnaA03g35790D                                          113   5e-24    
emb|CDX86765.1|  BnaA09g21550D                                          107   1e-23    
gb|AGC70933.1|  glycerophosphoryl diester phosphodiesterase             112   1e-23    
ref|WP_015216930.1|  glycerophosphoryl diester phosphodiesterase        115   1e-23    
ref|WP_024814502.1|  glycerophosphodiester phosphodiesterase            111   1e-23    
ref|WP_036838616.1|  glycerophosphodiester phosphodiesterase            110   5e-23    
gb|EJL83967.1|  glycerophosphoryl diester phosphodiesterase             110   5e-23    
ref|WP_011806527.1|  glycerophosphoryl diester phosphodiesterase        109   5e-23    
ref|WP_015200313.1|  glycerophosphoryl diester phosphodiesterase        112   6e-23    
ref|WP_015914076.1|  glycerophosphoryl diester phosphodiesterase        108   1e-22    
ref|WP_015013304.1|  glycerophosphoryl diester phosphodiesterase        108   1e-22    
ref|NP_001066731.1|  Os12g0456700                                       109   1e-22    
ref|WP_036353136.1|  glycerophosphodiester phosphodiesterase            108   2e-22    
gb|AGH96660.1|  hypothetical protein A11Q_2444                          107   2e-22    
ref|WP_006197333.1|  Phytase                                            110   5e-22    
ref|WP_035158284.1|  hypothetical protein                               109   6e-22    
emb|CDY12599.1|  BnaA02g12670D                                          107   6e-22    
ref|WP_041549205.1|  glycerophosphodiester phosphodiesterase            109   7e-22    
gb|AFY93535.1|  glycerophosphoryl diester phosphodiesterase             109   7e-22    
ref|WP_036269981.1|  glycerophosphodiester phosphodiesterase            105   1e-21    
ref|WP_044402318.1|  glycerophosphodiester phosphodiesterase            105   1e-21    
ref|WP_034264366.1|  glycerophosphodiester phosphodiesterase            105   1e-21    
ref|WP_005466927.1|  glycerophosphoryl diester phosphodiesterase        105   2e-21    
ref|WP_008273762.1|  glycerophosphoryl diester phosphodiesterase        104   2e-21    
ref|XP_002978269.1|  hypothetical protein SELMODRAFT_108000             104   3e-21    
ref|WP_040530492.1|  glycerophosphodiester phosphodiesterase            104   3e-21    
ref|WP_014854494.1|  glycerophosphoryl diester phosphodiesterase        104   3e-21    
ref|WP_035225304.1|  glycerophosphodiester phosphodiesterase            104   4e-21    
ref|WP_012703278.1|  glycerophosphoryl diester phosphodiesterase        103   5e-21    
ref|WP_016876731.1|  hypothetical protein                               107   5e-21    
ref|WP_041829004.1|  glycerophosphodiester phosphodiesterase            103   6e-21    
ref|WP_009768887.1|  glycerophosphoryl diester phosphodiesterase ...    106   6e-21    
gb|ADX45239.1|  glycerophosphoryl diester phosphodiesterase             103   6e-21    
ref|WP_024301826.1|  glycerophosphodiester phosphodiesterase            103   7e-21    
ref|WP_041576163.1|  glycerophosphodiester phosphodiesterase            102   8e-21    
ref|WP_033957837.1|  glycerophosphodiester phosphodiesterase            103   8e-21    
ref|WP_033428338.1|  glycerophosphodiester phosphodiesterase            103   9e-21    
ref|WP_033436466.1|  glycerophosphodiester phosphodiesterase            103   9e-21    
ref|WP_003464059.1|  glycerophosphoryl diester phosphodiesterase        103   1e-20    
ref|WP_035207582.1|  glycerophosphodiester phosphodiesterase            103   1e-20    
ref|WP_029554214.1|  glycerophosphodiester phosphodiesterase            103   1e-20    
ref|WP_005460366.1|  glycerophosphoryl diester phosphodiesterase        102   1e-20    
ref|WP_024875672.1|  glycerophosphodiester phosphodiesterase            102   1e-20    
ref|WP_003286770.1|  glycerophosphoryl diester phosphodiesterase        102   1e-20    
ref|WP_012594421.1|  glycerophosphoryl diester phosphodiesterase        103   2e-20    
ref|WP_034054955.1|  glycerophosphodiester phosphodiesterase            102   2e-20    
ref|WP_039801360.1|  glycerophosphodiester phosphodiesterase            102   2e-20    
ref|WP_015783467.1|  PEP-CTERM domain protein                           102   2e-20    
ref|WP_019341873.1|  glycerophosphoryl diester phosphodiesterase        102   2e-20    
ref|WP_015191413.1|  glycerophosphoryl diester phosphodiesterase        101   3e-20    
ref|WP_022977963.1|  glycerophosphoryl diester phosphodiesterase        102   3e-20    
gb|KJK42074.1|  glycerophosphodiester phosphodiesterase                 101   3e-20    
ref|WP_003459225.1|  glycerophosphoryl diester phosphodiesterase,...    101   3e-20    
ref|WP_034010782.1|  glycerophosphodiester phosphodiesterase            101   3e-20    
emb|CBA33326.1|  hypothetical protein Csp_B18490                        102   3e-20    
ref|WP_034012407.1|  glycerophosphodiester phosphodiesterase            101   4e-20    
ref|WP_033963224.1|  glycerophosphodiester phosphodiesterase            101   4e-20    
ref|WP_016252877.1|  glycerophosphoryl diester phosphodiesterase,...    101   4e-20    
gb|KFJ92505.1|  glycerophosphodiester phosphodiesterase                 101   4e-20    
ref|WP_034030599.1|  glycerophosphodiester phosphodiesterase            101   4e-20    
ref|WP_009157090.1|  glycerophosphoryl diester phosphodiesterase        101   4e-20    
ref|WP_031766932.1|  glycerophosphodiester phosphodiesterase            100   5e-20    
ref|WP_041755838.1|  glycerophosphodiester phosphodiesterase            100   5e-20    
gb|ABP81641.1|  glycerophosphoryl diester phosphodiesterase, peri...    100   5e-20    
ref|XP_002966299.1|  hypothetical protein SELMODRAFT_85502              100   6e-20    
ref|WP_038836050.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_043490868.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_034064371.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_015182722.1|  glycerophosphoryl diester phosphodiesterase        100   6e-20    
ref|WP_037247003.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_033938280.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_038404919.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_043088684.1|  glycerophosphodiester phosphodiesterase            100   6e-20    
ref|WP_023120153.1|  glycerophosphoryl diester phosphodiesterase,...    100   7e-20    
ref|WP_034056300.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_034075165.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_034070136.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_003118786.1|  glycerophosphoryl diester phosphodiesterase        100   7e-20    
ref|WP_004373908.1|  glycerophosphoryl diester phosphodiesterase        100   7e-20    
ref|WP_038819922.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_034055661.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_003102904.1|  MULTISPECIES: glycerophosphoryl diester phos...    100   7e-20    
ref|WP_031631683.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_025270826.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_034039869.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_012020010.1|  glycerophosphoryl diester phosphodiesterase        100   7e-20    
ref|WP_023436061.1|  glycerophosphoryl diester phosphodiesterase        100   7e-20    
ref|WP_043105186.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_043509283.1|  glycerophosphodiester phosphodiesterase            100   7e-20    
ref|WP_033980185.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_003110415.1|  glycerophosphoryl diester phosphodiesterase        100   8e-20    
ref|WP_034044126.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_033877017.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_031643147.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_023910573.1|  glycerophosphoryl diester phosphodiesterase        100   8e-20    
ref|WP_043546476.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_033985059.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_003117884.1|  MULTISPECIES: glycerophosphoryl diester phos...    100   8e-20    
ref|WP_003162104.1|  Glycerophosphoryl diester phosphodiesterase        100   8e-20    
ref|WP_033953535.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_033978774.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_033971799.1|  glycerophosphodiester phosphodiesterase            100   8e-20    
ref|WP_043307997.1|  glycerophosphodiester phosphodiesterase            100   9e-20    
ref|WP_033939992.1|  glycerophosphodiester phosphodiesterase            100   9e-20    
ref|WP_023098349.1|  glycerophosphoryl diester phosphodiesterase,...    100   9e-20    
ref|WP_023109563.1|  glycerophosphoryl diester phosphodiesterase,...    100   9e-20    
ref|WP_019681231.1|  glycerophosphoryl diester phosphodiesterase        100   9e-20    
ref|WP_041919228.1|  glycerophosphodiester phosphodiesterase          99.8    9e-20    
ref|WP_015502208.1|  glycerophosphoryl diester phosphodiesterase,...    100   9e-20    
ref|WP_031633692.1|  glycerophosphodiester phosphodiesterase            100   9e-20    
ref|WP_019371365.1|  glycerophosphoryl diester phosphodiesterase        100   9e-20    
ref|WP_039027911.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_024916924.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_024309891.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_033995166.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_043084709.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_023114757.1|  glycerophosphoryl diester phosphodiesterase,...    100   1e-19    
ref|WP_020305624.1|  glycerophosphoryl diester phosphodiesterase,...    100   1e-19    
ref|WP_033952314.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_041827855.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_023112648.1|  glycerophosphoryl diester phosphodiesterase,...    100   1e-19    
ref|WP_003128915.1|  glycerophosphoryl diester phosphodiesterase        100   1e-19    
ref|WP_043103754.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
gb|EER58635.1|  glycerophosphoryl diester phosphodiesterase             100   1e-19    
ref|WP_033939727.1|  glycerophosphodiester phosphodiesterase            100   1e-19    
ref|WP_003084425.1|  glycerophosphoryl diester phosphodiesterase        100   1e-19    
ref|WP_019495104.1|  hypothetical protein                               102   1e-19    



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/391 (72%), Positives = 328/391 (84%), Gaps = 2/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW LRSI  LLLLC +   V+AQ S N+TSKW TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1     MWNLRSISCLLLLCCSAAFVSAQRSNNATSKWFTLSGDAPKVIARGGFSGLMPDSSFNAY  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             + A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+KQ+TYLVNGVP   W
Sbjct  61    TLASTISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVDVLFKNKQNTYLVNGVPQKGW  120

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F +DFNFK L LV L+QGV+SRS RFDGTPQ ILTV+DV  +V+PPGLWLN+QHDSFYSQ
Sbjct  121   FSVDFNFKDLALVTLKQGVFSRSPRFDGTPQSILTVQDVDTQVKPPGLWLNIQHDSFYSQ  180

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR+FV+S+SR V+INYISSPEVNFL+SIA R NPRVTK VFRFL  DE EPSTNQT
Sbjct  181   HNLSMRSFVVSLSRSVIINYISSPEVNFLRSIARRFNPRVTKFVFRFLSEDEFEPSTNQT  240

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             Y SLL+NL  +KTFASGILVPK YIWPVD +S YLQP TS+VLDAHK GLE++A+DFA+D
Sbjct  241   YSSLLKNLTFVKTFASGILVPKHYIWPVD-NSLYLQPHTSVVLDAHKEGLEIFAADFAND  299

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             VP A++YSYDPVAEYLS+IDNGN+SVDGVLSDFP TPS ++DC+SH+ K  K QV +  +
Sbjct  300   VPSAYNYSYDPVAEYLSYIDNGNFSVDGVLSDFPSTPSSSVDCFSHLGKNDKPQV-KLQI  358

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             I+ +GASGDYPGCTD AY+KA SDG D+++C
Sbjct  359   ITSEGASGDYPGCTDLAYTKAASDGADVLNC  389



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/391 (71%), Positives = 330/391 (84%), Gaps = 2/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW LRSI  LLLLC +   V+AQ S N+TSKW TL+GDAP VIARGGFSGL PDSSFNAY
Sbjct  1     MWNLRSISCLLLLCCSAAFVSAQRSDNATSKWLTLTGDAPKVIARGGFSGLMPDSSFNAY  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A   S+ + + WCDVQLTKDGVGIC  DI+LDN+S+V  LFK+KQ+TYLVNGVP   W
Sbjct  61    ILAKAISVADWVAWCDVQLTKDGVGICLSDIRLDNSSDVNVLFKNKQNTYLVNGVPQKGW  120

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F +DFNFK L LV+L+QGV+SRS RFDGTPQQILTV+DV ++V+PPGLWLN+QHDSFYSQ
Sbjct  121   FSVDFNFKDLALVSLKQGVFSRSPRFDGTPQQILTVQDVASQVKPPGLWLNIQHDSFYSQ  180

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
              NLS+R+FV+S+SR V++NYISSPEVNFL+SIA R NPRVTK VFRFLG D  EPSTNQT
Sbjct  181   RNLSIRSFVVSLSRSVIVNYISSPEVNFLRSIARRFNPRVTKFVFRFLGEDGIEPSTNQT  240

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSLL+NL  +KTFASGILVPK YIWPVD +S YLQP TS+VLDAHK GLE++A+DFA+D
Sbjct  241   YGSLLKNLTFVKTFASGILVPKHYIWPVD-NSLYLQPHTSVVLDAHKEGLEIFAADFAND  299

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             VP A++YSYDPVAEYLS+IDNG++SVDGVLSDFP+TPS ++DC+SH+ K  K QV +  +
Sbjct  300   VPSAYNYSYDPVAEYLSYIDNGDFSVDGVLSDFPLTPSSSVDCFSHLGKNDKPQV-KLQI  358

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             I+ +GASGDYPGCTD AY+KA SDG D++ C
Sbjct  359   ITSEGASGDYPGCTDLAYTKAASDGADVLGC  389



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/391 (70%), Positives = 323/391 (83%), Gaps = 2/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             M K+RS+  LL+LC +V  VAAQ S N TSKW+TLSGDAP VIARGGFSGL PDSSFNAY
Sbjct  1     MRKMRSVLCLLVLCCSVAFVAAQRSNNVTSKWKTLSGDAPKVIARGGFSGLLPDSSFNAY  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A   S  + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ ++ + Y VNG+P T W
Sbjct  61    MLAQAISSADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYPNRNNNYSVNGIPQTGW  120

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F IDF+ K L  V+L+QGVYSRS RFDGTPQQILTV+DV  +V+PPGLWLN+QHDSFYSQ
Sbjct  121   FSIDFSIKDLAPVSLKQGVYSRSPRFDGTPQQILTVQDVATQVKPPGLWLNIQHDSFYSQ  180

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR+FV+S+SR V+ NYISSPEVNFL+SIASR+NPRVTK VFRFL  D+ EPST+QT
Sbjct  181   HNLSMRSFVVSLSRSVIANYISSPEVNFLRSIASRLNPRVTKRVFRFLNEDDIEPSTSQT  240

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSL++NL  +KTFA+GILVPK YIWP D SS YLQP TS+V DAHK GLE+YA+DF +D
Sbjct  241   YGSLVKNLTFVKTFAAGILVPKHYIWPTD-SSLYLQPHTSVVSDAHKEGLEIYAADFVND  299

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             VPFA++YSYDPVAEYLSFIDNG +SVDGVLSDFP++PS ++DC+SH+    K QV    +
Sbjct  300   VPFAYNYSYDPVAEYLSFIDNGEFSVDGVLSDFPMSPSASVDCFSHLGANDKPQV-TLQI  358

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             I+  GASGDYPGCTD AY+KA SDG DII C
Sbjct  359   IAPQGASGDYPGCTDLAYTKAASDGADIIGC  389



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 329/391 (84%), Gaps = 3/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW LR +  L +L S  + V  Q   N+T+KW TL GDAPLVIARGGFSGL PDSS++AY
Sbjct  1     MWNLRRLSYLFVLLSCFS-VTTQALNNATTKWLTLHGDAPLVIARGGFSGLLPDSSYDAY  59

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A  TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+K+S YLVNGVPT  W
Sbjct  60    IMALETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKNKKSKYLVNGVPTQGW  119

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F ID+NFK L  V L+QGVYSR+SRFDGT Q ILTV+DV N+V+PPGLWLN+QHD+F+SQ
Sbjct  120   FSIDYNFKDLAPVTLKQGVYSRTSRFDGTQQSILTVQDVVNQVKPPGLWLNIQHDNFFSQ  179

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR++++S+SR V+INYISSPEVNFL+SI +R+N RVTKLVFRFLG ++ EPSTNQT
Sbjct  180   HNLSMRSYIISLSRSVLINYISSPEVNFLRSILARLNSRVTKLVFRFLGQNDVEPSTNQT  239

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSLL+NL  IKTF+SGILVPKSYIWPVD +S YLQP TSLVLDAHK GL+++AS+FA+D
Sbjct  240   YGSLLKNLTFIKTFSSGILVPKSYIWPVD-NSFYLQPYTSLVLDAHKEGLQIFASEFAND  298

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             VPFA++YSYDP +EYLSF+DNGN+SVDGVLSDFP+TPS  IDC++H+ K  K +  + L+
Sbjct  299   VPFAYNYSYDPTSEYLSFVDNGNFSVDGVLSDFPVTPSATIDCFTHLDKNDKPR-EKLLI  357

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             I+ +GASGDYPGCTD AY+KA SDG D++DC
Sbjct  358   ITSEGASGDYPGCTDLAYTKAASDGADVLDC  388


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 141/314 (45%), Gaps = 38/314 (12%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKL-DNASNV  543
             L+I   G SG +P  +  AY+ A   S    ++ C VQ+TKDG+  C   I L D  +  
Sbjct  356   LIITSEGASGDYPGCTDLAYTKAA--SDGADVLDCPVQMTKDGIPFCLGSINLIDKTTVF  413

Query  544   ATLFKDKQSTY----LVNGVPT--TAWFPIDFNFKQLTLVNLQQGVYSR-SSRFDGTPQQ  702
              +LF +  ST     + NG+ T    W  I+    ++T   L+  +Y    +R +G    
Sbjct  414   QSLFTNIASTVPELNITNGIVTFNLTWDEINSLKPEITNPWLEFRLYRNPKARNEG---N  470

Query  703   ILTVEDVF----NKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
              +++ D      N     G+ +++++ ++ +     +   V    R    N  +  +V  
Sbjct  471   FVSLVDFLTYAKNATTVSGVMISIENAAYLANQGFGVTDAVREALRNAGYNNQTVKKVMI  530

Query  871   L---KSIASRINPRVTKLVFRFLGN-DETEPSTNQTYGSLLQNLASIKTFASGILVPKSY  1038
                  S+         +LV+R   +  + E ST          ++ IK+FAS +++ K+ 
Sbjct  531   QSKDSSVLKEFKKTRYELVYRVADDISDIESST----------ISEIKSFASSVILTKNS  580

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLS-FIDNG  1212
             ++P +  S +L   T++V   H   L VY   F ++ V  A+D+  D   E  + FI  G
Sbjct  581   VFPSE--SKFLVGKTNVVEKLHSSNLSVYVQRFNNEFVSQAWDFFSDSSVEINNYFIGAG  638

Query  1213  NYSVDGVLSDFPIT  1254
                +DGV++DFP T
Sbjct  639   ---IDGVITDFPRT  649



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/391 (70%), Positives = 326/391 (83%), Gaps = 2/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             M K+RS+  LLLLC +   VAAQ S+N TSKW+TLSGDAP VIARGGFSGL PDSS+NAY
Sbjct  1     MRKMRSVLCLLLLCCSAAFVAAQRSSNVTSKWKTLSGDAPKVIARGGFSGLLPDSSYNAY  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A   SL + + WCDVQLTKDGVGICFPDIKL+NAS++ TL+ ++ + Y VNG+P T W
Sbjct  61    LLAQAISLADWVAWCDVQLTKDGVGICFPDIKLNNASDIDTLYLNRNNNYSVNGIPQTGW  120

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F IDFN K L  V+L+QGVYSRS RFDGTPQQILTV+DV  +V+PPGLWLN+QHDSFYSQ
Sbjct  121   FSIDFNIKDLAPVSLKQGVYSRSPRFDGTPQQILTVQDVATQVKPPGLWLNIQHDSFYSQ  180

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR+FV+S+SR V+ NYISSPEVNFL+SIASR+NPRVTK VFRFL  D+ EPST+QT
Sbjct  181   HNLSMRSFVISLSRSVIANYISSPEVNFLRSIASRLNPRVTKRVFRFLNEDDIEPSTSQT  240

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSL++NL  IKTFA+GILVPK YIWP+D SS YLQP TS+V DAHK GLE+YA+DF +D
Sbjct  241   YGSLVKNLTFIKTFAAGILVPKHYIWPMD-SSLYLQPHTSVVSDAHKEGLEIYAADFVND  299

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             VPFA++YSYDPVAEYLSFIDNG +SVDGVLSDFP++PS ++DC+SH+    K QV +  +
Sbjct  300   VPFAYNYSYDPVAEYLSFIDNGEFSVDGVLSDFPMSPSASVDCFSHLGANDKPQV-KLQI  358

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             I+  GASG+YPGCTD AY+KA SDG DI+ C
Sbjct  359   ITPQGASGEYPGCTDLAYTKAASDGADILGC  389



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 327/391 (84%), Gaps = 5/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW LRS+    +L +  + VAAQG   +  KW TL+G+APLVIARGGFSGL PDSS++AY
Sbjct  1     MWNLRSLSWSFVLLTCFS-VAAQGVNRT--KWLTLNGNAPLVIARGGFSGLLPDSSYDAY  57

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
                  TSL N I+WCDVQLTKDGVGICFPD+KLDNAS++   FK+K+S YLVNGVPT  W
Sbjct  58    IMGLETSLPNAIIWCDVQLTKDGVGICFPDLKLDNASDIDFYFKNKKSKYLVNGVPTQGW  117

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F ID+N K L  V L+QGVYSR+ RFDG+ Q ILTV+DV N+V+PPG WLN+QHD+F+SQ
Sbjct  118   FSIDYNLKDLVHVTLKQGVYSRTQRFDGSQQSILTVQDVVNQVKPPGFWLNIQHDNFFSQ  177

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSM+++++S++R V+INYISSPEVNFL+SI SR+NPRVTKLVFRFLG D+ EPSTNQT
Sbjct  178   HNLSMKSYIISLTRGVLINYISSPEVNFLRSILSRLNPRVTKLVFRFLGQDDVEPSTNQT  237

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSLL+NL  IKTFASGILVPKSYIWPVD +S YLQP TSLVLDAHK GL+++AS+FA+D
Sbjct  238   YGSLLKNLTFIKTFASGILVPKSYIWPVD-NSLYLQPYTSLVLDAHKEGLQIFASEFAND  296

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             VPFA++YSYDP +EYLSF+DNGN+SVDGVLSDFP+TPS  IDC++H+ K  K Q  + LV
Sbjct  297   VPFAYNYSYDPTSEYLSFVDNGNFSVDGVLSDFPVTPSATIDCFTHLDKNDKPQ-EKLLV  355

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             I+ +GASGDYPGCTD AY+KA SDG D++DC
Sbjct  356   ITSEGASGDYPGCTDLAYTKAASDGADVLDC  386



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   536 bits (1382),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 251/357 (70%), Positives = 301/357 (84%), Gaps = 2/357 (1%)
 Frame = +1

Query  349   LSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
              +GDAPLVIARGGFSGLFPDSS++AY  A  TSL NVI WCDVQLTKDGVGIC PD+KLD
Sbjct  23    FAGDAPLVIARGGFSGLFPDSSYDAYMVAMETSLANVIAWCDVQLTKDGVGICLPDLKLD  82

Query  529   NASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQIL  708
             NAS++   FK+K+S Y VNGVP   WF IDFNFK L  V L+QGV SR+ +FDGT Q+IL
Sbjct  83    NASDIDVYFKNKKSKYSVNGVPMQGWFSIDFNFKDLAPVTLRQGVLSRTPKFDGTQQKIL  142

Query  709   TVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIAS  888
             TV DV NKV+PPGLWLN+QHD+F+SQHNLSMR+F++++SR V+INYISSPEVNFL+SI +
Sbjct  143   TVLDVINKVKPPGLWLNIQHDTFFSQHNLSMRSFIITLSRSVIINYISSPEVNFLRSIVA  202

Query  889   RINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSY  1068
             R +P+VTKLVFRFLG D+ EPSTNQTYGSLL+NL  I TFASGILVPKSYIWPVD +S Y
Sbjct  203   RFDPQVTKLVFRFLGQDDVEPSTNQTYGSLLKNLTFINTFASGILVPKSYIWPVD-NSLY  261

Query  1069  LQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFP  1248
             LQP TSLVLDAH+ GL+++A++F +DVPFA++YSYDP  EYLSFIDNGN+SVDGVLSDFP
Sbjct  262   LQPHTSLVLDAHEEGLQIFAAEFVNDVPFAYNYSYDPATEYLSFIDNGNFSVDGVLSDFP  321

Query  1249  ITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             ITPS  IDC++H+ K  K Q  + L+++ +GASGDYPGCTD AY+KA  DG D++ C
Sbjct  322   ITPSATIDCFTHLGKNDKPQA-KLLIMTSEGASGDYPGCTDLAYTKAAMDGADVLGC  377



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   536 bits (1382),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 263/397 (66%), Positives = 318/397 (80%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1     MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
             F AYS A LTSL +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++KD+Q TYLVNGV 
Sbjct  60    FGAYSLALLTSLPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAVVYKDRQKTYLVNGVS  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T  WF IDF  ++L  V L QGVYSR+++FDG    I+TV++ + ++ PP  WLN+QHD+
Sbjct  120   TKGWFSIDFTLRELGNVILNQGVYSRTNKFDGNSYPIMTVQETYAQLNPPRFWLNIQHDA  179

Query  775   FYSQHNLSMRTFVLSVS--RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+QHNLSMR+FVLSV+  R V I+YISSPEV FL++IA       T LVFRFLG ++ E
Sbjct  180   FYTQHNLSMRSFVLSVTRNRNVTIDYISSPEVAFLQNIAPSFQRSATNLVFRFLGQNDVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTYGSLL+N+  IKTFASGI+VPKSYIWPVDK   YL P+TSLVLDAHK GLEV+A
Sbjct  240   PSTNQTYGSLLKNITFIKTFASGIIVPKSYIWPVDK-DLYLLPSTSLVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL FIDNG +SVDG++SDFPITPS AIDC++H+ +    Q
Sbjct  299   SDFYNDVPFSFNYSYDPVAEYLQFIDNGEFSVDGMISDFPITPSAAIDCFAHLGRNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V + LVIS +GASGDYPGCTD AYSKA+ DGVD+IDC
Sbjct  359   V-DLLVISSNGASGDYPGCTDMAYSKAIQDGVDVIDC  394


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 144/318 (45%), Gaps = 45/318 (14%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI+  G SG +P  +  AYS A    +   ++ C VQ+T DG  IC   I L +++ VA
Sbjct  362   LVISSNGASGDYPGCTDMAYSKAIQDGVD--VIDCPVQMTMDGTPICLSSINLIDSTTVA  419

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT----LVNLQQGVYS--RSSRFDG-----T  693
                    +T +   +P +  F  + ++ ++     +++  Q  Y   R+ RF       T
Sbjct  420   QSQFSNLTTTIPQIMPGSGIFSFNLSWSEIKTLTPIISSPQSQYKLFRNPRFKNAGTFLT  479

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVL----------SVSRRVVIN  843
               + LT+    + +Q  G+ +++++  F  +   ++   VL             ++V+I 
Sbjct  480   LSEFLTIASNASSLQ--GVLISIENAPFLLEQGFAVTNAVLDALSKAGYGNKTDQKVMIQ  537

Query  844   YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGIL  1023
               SS   + L    S+ N  +   V   +G            G+    +  IK+FAS ++
Sbjct  538   SSSS---SVLMKFKSQTNYDLVYKVDEDIG------------GAQSSTIDDIKSFASAVV  582

Query  1024  VPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSF  1200
             + K  ++P  ++S+++   T++V       L VY   F+++    A+D+  DP  E  SF
Sbjct  583   ISKDSVFP--ENSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTVEINSF  640

Query  1201  IDNGNYSVDGVLSDFPIT  1254
                G   ++GV++DFP T
Sbjct  641   YLGGG--INGVITDFPKT  656



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   532 bits (1370),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 252/391 (64%), Positives = 315/391 (81%), Gaps = 3/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             M KLR +  LL L  +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AY
Sbjct  1     MSKLRQVI-LLFLLHSVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAY  59

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             S A +TSL+NV++WCDVQLTKDG GICFPD+KL+NAS+++ +FK++ + YLVNGV T  W
Sbjct  60    SLALMTSLSNVVLWCDVQLTKDGAGICFPDMKLENASDISIVFKNRNNVYLVNGVSTPGW  119

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F +DF    L  V L QGVYSRS RFDG    ILTV+++   ++PPGLWLN+QHD FY++
Sbjct  120   FSVDFTLTDLETVALNQGVYSRSGRFDGNLFPILTVQEMVKLIRPPGLWLNLQHDVFYTK  179

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR FVLSVS+ V+++YISSPEV FL+ ++ R     TKL+FRFL  +ET+PSTNQT
Sbjct  180   HNLSMRNFVLSVSKSVIVDYISSPEVAFLRGVSQRFKATKTKLIFRFLEKEETDPSTNQT  239

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSLL NL  IKTFASGILVPK YIWPV+K +SYL+ +T +V +AHK GLEV+ SDF +D
Sbjct  240   YGSLLNNLTFIKTFASGILVPKGYIWPVNK-NSYLESSTLVVQNAHKEGLEVFGSDFIND  298

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             +PF+++YSYDP+AE L+FIDN  +SVDGVLSDFPITPS AIDC++H+ K    Q  + L+
Sbjct  299   IPFSYNYSYDPIAEVLNFIDNDAFSVDGVLSDFPITPSAAIDCFAHIGKNASGQ-EKPLI  357

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             IS++GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  358   ISYNGASGDYPSCTDLAYTKAISDGVDVLDC  388


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 154/339 (45%), Gaps = 37/339 (11%)
 Frame = +1

Query  358   DAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNAS  537
             + PL+I+  G SG +P  +  AY+ A    +   ++ C+VQ+TKDG  IC   I L +++
Sbjct  353   EKPLIISYNGASGDYPSCTDLAYTKAISDGVD--VLDCNVQMTKDGTPICLSSINLMDST  410

Query  538   NVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYS--RSSRFDG--TPQQ  702
              VA       +T +      +  F  +  ++ + +L       YS  R SR     T  +
Sbjct  411   KVAQTPFSTFTTTITELQKGSGIFTFNLTWEDIRSLTPAISNPYSTFRLSRNPAAKTAGK  470

Query  703   ILTVEDVFNKVQPP-----GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             ++++ D  +  +       G+ + ++H +F  +  LS+   VL    +   + +++P V 
Sbjct  471   LVSLSDFLSIAKEANSLSGGVLIGIEHAAFLVKVGLSVTDAVLDALSKAGYDNVTTPRV-  529

Query  868   FLKSIASRI------NPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVP  1029
              ++S  S +        +  +LV+R   ++    +++ T       +  IK FA+ +++ 
Sbjct  530   MIQSTNSSVLKEFKEKKKNYELVYRV--DENIRDASDAT-------IEDIKKFATSVVIS  580

Query  1030  KSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFID  1206
             K  I+P +K  +++   T +V    K  L VY   F ++ +  A+D+  D   E  SF+ 
Sbjct  581   KDSIYPENK--AFITGATDIVSRLKKNNLPVYVQRFDNEFISQAWDFFSDATVEINSFVT  638

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
                  +DGV++ FP T +     Y   R  +    P ++
Sbjct  639   GA--GIDGVITSFPQTAAS----YRKNRCLKYKNAPSYM  671



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   531 bits (1368),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 251/378 (66%), Positives = 305/378 (81%), Gaps = 3/378 (1%)
 Frame = +1

Query  286   CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  465
             C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  20    CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  466   WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  645
             WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  79    WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  138

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QGVYSR+ +FDG   QILTV+ +  +++PPGLWLN+QHD+FY+QHNLSMR+FVLSV 
Sbjct  139   ILNQGVYSRTDKFDGNVLQILTVQGMARQIKPPGLWLNIQHDAFYAQHNLSMRSFVLSVY  198

Query  826   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  1005
             R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+TNQTYGSLL+NL  IKT
Sbjct  199   RSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTTNQTYGSLLKNLTFIKT  258

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             FASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+FA+D+P +F+YSYDP+ 
Sbjct  259   FASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNFANDIPISFNYSYDPLT  317

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  1365
             EYLSFIDN ++SVDGVLSDFP+TPS A+DC++H+ K         LVIS +GASGDYP C
Sbjct  318   EYLSFIDNRDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-NLLVISKNGASGDYPSC  376

Query  1366  TDXAYSKAVSDGVDIIDC  1419
             T+ AY KA+SDGVD IDC
Sbjct  377   TNLAYQKAISDGVDFIDC  394



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   531 bits (1367),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 262/394 (66%), Positives = 313/394 (79%), Gaps = 5/394 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             MWK+RS+  LL L          AAQGS   +SKWQTLSGDAPLVIARGGFSG+FPDSSF
Sbjct  1     MWKVRSVLGLLSLLLLSASVGLAAAQGSRGRSSKWQTLSGDAPLVIARGGFSGIFPDSSF  60

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
              AYS A  TSLTNV +WCDVQLTKDG GICFPDI+L+N+S++  ++K+ ++TY+VNGV T
Sbjct  61    YAYSLAVQTSLTNVHVWCDVQLTKDGAGICFPDIRLENSSDIDNVYKNGRNTYVVNGVST  120

Query  598   TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSF  777
               WF +DF    L  VNL+Q +++R+  FDGTP QILTV+DV ++V+PP LWLN+ HD+F
Sbjct  121   QGWFSVDFTLNDLAPVNLKQRIFTRAPNFDGTPMQILTVDDVVSQVKPPALWLNIPHDAF  180

Query  778   YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  957
             +SQHNLSMR+F+LSVSRRV++NY+SSPEV FL+SI SR     TKLVF+FLG D+ EP+T
Sbjct  181   FSQHNLSMRSFILSVSRRVIVNYVSSPEVGFLRSIVSRFRTGPTKLVFQFLGPDDVEPTT  240

Query  958   NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  1137
             N TYG+LL NL  IKTFASGILVPK YIWPVD +S YL   TSLV+DAH  GLEV+AS+F
Sbjct  241   NSTYGTLLNNLTFIKTFASGILVPKYYIWPVD-NSQYLLNYTSLVVDAHAAGLEVFASNF  299

Query  1138  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  1317
             A+D P A+DYSYDPV EYL+FIDNG +SVDGVLSDFPITPS  IDC+SH+ K    Q   
Sbjct  300   ANDAPLAYDYSYDPVVEYLNFIDNGKFSVDGVLSDFPITPSETIDCFSHIGKNDTVQA-N  358

Query  1318  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
              LVIS +GASGDYPGCTD AY KAVSDGVDI+DC
Sbjct  359   ILVISSEGASGDYPGCTDKAYQKAVSDGVDILDC  392



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   526 bits (1354),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 260/397 (65%), Positives = 316/397 (80%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  411
             MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1     MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  412   SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGV  591
             S  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+++  TY VNGV
Sbjct  59    SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQNRSKTYSVNGV  118

Query  592   PTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQH  768
              T+A+F +DF F++L + V L QG ++RS +FD    QILTV D+     PPGLWLN+QH
Sbjct  119   QTSAYFAVDFTFEELYSKVFLVQGDFTRSDKFDNNLFQILTVNDLVKNEAPPGLWLNIQH  178

Query  769   DSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             D+FY QHNLSM+ FVLSVSR V +NYISSPE  FL++I +RINPR+TKLVFRFL  DE +
Sbjct  179   DAFYEQHNLSMKNFVLSVSRTVNVNYISSPEAGFLRTIRARINPRITKLVFRFLEKDEVD  238

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTYGSLL+NLASIKTFASGILVPK YIWP+D SS YL P TSLV DAHKVGLEV+A
Sbjct  239   PSTNQTYGSLLKNLASIKTFASGILVPKGYIWPIDPSSLYLLPHTSLVSDAHKVGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVP +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+TPS AIDC++H+      +
Sbjct  299   SDFLNDVPISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTPSEAIDCFAHVGLNATKK  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V   LVIS  GASGDYP CTD AY KA+SDGVD++DC
Sbjct  359   V-NTLVISKYGASGDYPPCTDLAYEKAISDGVDVLDC  394


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 142/327 (43%), Gaps = 30/327 (9%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A    N+T K  TL      VI++ G SG +P  +  AY  A    +   ++ C VQ++K
Sbjct  349   AHVGLNATKKVNTL------VISKYGASGDYPPCTDLAYEKAISDGVD--VLDCPVQMSK  400

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  666
              G+  C   I L  ++NVA     K    +         F  D  +  + TL       Y
Sbjct  401   GGIPFCLSSIDLIESTNVAQSNFSKLGKIIPEIKSGNGIFTFDLAWDDIKTLTPSMLNPY  460

Query  667   SRSSRFD----GTPQQILTVEDVFN----KVQPPGLWLNVQHDSFYS-QHNLSMRTFVLS  819
             S +S +           LT+ D  N    +    G+ + +++ ++ + + NLS+   V+ 
Sbjct  461   SINSLYRNPKYNKKGHFLTLSDFLNLPKGQTSLLGVVITIENAAYLARKQNLSVTEAVID  520

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LAS  996
                +   +   +P+V  ++S  S +      L F+     E     ++  G  + + +  
Sbjct  521   TLSKAGYDKPGAPKV-MIQSTNSSV-----LLKFKEKTKYELVYKIDEIVGDAVDSAILD  574

Query  997   IKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSY  1173
             IK FA  ++V K+ ++PV K   ++  +T +V       L VY   F ++ V  A+D+  
Sbjct  575   IKRFAHSVVVKKASVYPVSK--FFVTGSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMS  632

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
             D   E  +F+ +    +DGV++DFP T
Sbjct  633   DATVEINTFVQDA--EIDGVITDFPKT  657



>ref|XP_009798152.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=391

 Score =   511 bits (1316),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 254/355 (72%), Positives = 299/355 (84%), Gaps = 1/355 (0%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW LRS+  LLLLC +VT VAAQ + + T+KW TL+GDAPLVIA GGFSGLFPDSS++AY
Sbjct  14    MWNLRSLSCLLLLCFSVTTVAAQRTNSETTKWLTLNGDAPLVIALGGFSGLFPDSSYDAY  73

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A  TSL NVI WCDVQLTKDGVGIC PD+KLDNAS++   FK+K++ Y VNGVP   W
Sbjct  74    MVAMETSLANVIAWCDVQLTKDGVGICLPDLKLDNASDIDVYFKNKETKYSVNGVPMQGW  133

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F IDFNFK L  V L+QGV+SR+ +FDGT Q+ILTV DV NKV+PPGLWLN+QHD+F+SQ
Sbjct  134   FSIDFNFKDLAPVTLRQGVFSRTPKFDGTQQKILTVLDVVNKVKPPGLWLNIQHDTFFSQ  193

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR+F++S+SR V++NYISSPEVNFLKSI SR NP VTKLVFRFLG  + EPSTNQT
Sbjct  194   HNLSMRSFIISLSRSVIVNYISSPEVNFLKSIVSRFNPLVTKLVFRFLGQGDIEPSTNQT  253

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGSLL+NL  IKTFASGILVPK+YIWPVD +S YLQP TSLVLDAHK GL+++AS+F +D
Sbjct  254   YGSLLKNLTFIKTFASGILVPKTYIWPVD-NSLYLQPHTSLVLDAHKEGLQIFASEFVND  312

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  1311
             VPFA++YSYDP  EYLSFIDNG++SVDGVLSDFPITPS  IDC++H+ K  K QV
Sbjct  313   VPFAYNYSYDPATEYLSFIDNGDFSVDGVLSDFPITPSATIDCFTHLGKNDKPQV  367



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   524 bits (1350),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 258/364 (71%), Positives = 306/364 (84%), Gaps = 2/364 (1%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             ST KWQTLSG APL IARGGFSGLFPDSS+NAY  A  TSL+++++WCDVQLTKD  GIC
Sbjct  26    STRKWQTLSGSAPLAIARGGFSGLFPDSSYNAYVLAVGTSLSDLVLWCDVQLTKDAAGIC  85

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FPD+KLDNAS+V  +F ++ STY+V+GV T  WF ID+N K L LV+L+Q +YSR++RFD
Sbjct  86    FPDLKLDNASDVNVVFNNRASTYIVSGVSTRGWFSIDYNLKDLRLVSLKQRIYSRTNRFD  145

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             GT QQILTV+DV  +VQP  LWLNVQHD+FYSQHNLSMR++V+SVSR VV+NYISSPEVN
Sbjct  146   GT-QQILTVDDVATQVQPSALWLNVQHDAFYSQHNLSMRSYVISVSRSVVVNYISSPEVN  204

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FLKSIA+R  P VTKLVFRFLG  + EPSTNQTY SL +NL  IKTFASGILVPK YIWP
Sbjct  205   FLKSIAARFRPSVTKLVFRFLGPADIEPSTNQTYSSLQKNLTFIKTFASGILVPKYYIWP  264

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             VD SS YL P TS+VLDAH+ GLEVYAS+F+SDV FA+DY+YDPVAEYLS+IDNGN+SVD
Sbjct  265   VDSSSQYLLPHTSIVLDAHEAGLEVYASEFSSDVTFAYDYNYDPVAEYLSYIDNGNFSVD  324

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVLSDFPITPS  IDC+SH+ K + +Q  + L+IS +GASG +PGCTD AY +A++DG D
Sbjct  325   GVLSDFPITPSETIDCFSHIGKNETDQA-KVLIISHEGASGTFPGCTDKAYDQAITDGAD  383

Query  1408  IIDC  1419
              IDC
Sbjct  384   FIDC  387


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 82/343 (24%), Positives = 151/343 (44%), Gaps = 54/343 (16%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             L+I+  G SG FP  +  AY  A +T   + I  C VQ+++DGV  C   I L   +  A
Sbjct  355   LIISHEGASGTFPGCTDKAYDQA-ITDGADFID-CPVQMSQDGVPFCMGSINLIERTTAA  412

Query  547   -TLFKDKQSTY----LVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRF---------  684
              + F+    T     + +G+         FN     +  L+  +Y+ ++ +         
Sbjct  413   QSAFRSFTKTIPDLNIQDGI-------FAFNLTWSQIQTLKPSMYNPNTIYALFRNPKAQ  465

Query  685   -DGTPQQI---LTVEDVFNKVQPPGLWLNVQHDSFYSQHN-LSMRTFVLSVSRRVVIN--  843
              DG   Q+   L +    N     G+ + ++H ++ +Q+  L +   VL+   +   N  
Sbjct  466   NDGNFVQLSDFLAIAS--NATSVSGVLIGIEHAAYLAQNQGLDVVDAVLTTLNKSSYNKK  523

Query  844   -YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
               I S + + L +I  +     +K    +  N+     TN T       +  I  FAS +
Sbjct  524   VLIESNDSSVLVNIGKK-----SKYELVYSINETISDITNST-------ILEIMKFASSV  571

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLS  1197
             LV K  ++P ++  ++L   T +V     +GL VY   F+++ V  A+D+  DP  E  +
Sbjct  572   LVTKGSVYPSEE--AFLTGVTKVVPKVQALGLRVYVQLFSNEFVSQAWDFFSDPYVEINT  629

Query  1198  FIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
             +I   N +++G+++D+P T +     Y   R     Q P +++
Sbjct  630   YI--SNMTINGLVTDYPATAAR----YRKNRCLGYKQAPSYML  666



>ref|XP_007020654.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY12179.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
Length=514

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 312/397 (79%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1     MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
               AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60    PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++PPG WLN+QH++
Sbjct  120   TKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKPPGFWLNIQHNA  179

Query  775   FYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKLVFRFL  D  E
Sbjct  180   FYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI+C++H+ +    Q
Sbjct  299   SDFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAINCFAHLGRNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V + LVIS +GASGDYPGCTD AY+KA+ DGVD+IDC
Sbjct  359   V-DLLVISKNGASGDYPGCTDQAYTKAIQDGVDVIDC  394



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   520 bits (1339),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 243/376 (65%), Positives = 306/376 (81%), Gaps = 2/376 (1%)
 Frame = +1

Query  292   AVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             +V LV+AQGSTN TS WQTL+G+APLVIARGGFSGLFPDSS  AYS A +TSL+NV++WC
Sbjct  15    SVALVSAQGSTNGTSSWQTLNGNAPLVIARGGFSGLFPDSSSAAYSLALMTSLSNVVLWC  74

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             DVQL+KDG GICFPD+KL+NAS+++ +FK++ + YLVNGV T  WF +DF    L  V L
Sbjct  75    DVQLSKDGAGICFPDMKLENASDISIVFKNRNNVYLVNGVSTPGWFSVDFTLTDLETVAL  134

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRR  831
              QGVYSRS +FDG    ILTV+++    +PPGLWLN+QHD FY++HNLSMR FVLSVS+ 
Sbjct  135   NQGVYSRSGKFDGNLFPILTVQEMVKLTRPPGLWLNLQHDVFYTKHNLSMRNFVLSVSKS  194

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFA  1011
             V+++YISSPEV FL+ ++ R     TKL+FRFL  +ET+PSTNQTYGSLL NL  IKTFA
Sbjct  195   VIVDYISSPEVAFLRGVSQRFKATKTKLIFRFLEKEETDPSTNQTYGSLLNNLTFIKTFA  254

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEY  1191
             SGILVPK YIWPV+K +SYL+ +T +V +AHK GLEV+ SDF +D+PF+++YSYDP+AE 
Sbjct  255   SGILVPKGYIWPVNK-NSYLESSTLVVQNAHKEGLEVFGSDFINDIPFSYNYSYDPIAEV  313

Query  1192  LSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTD  1371
             L+FIDN  +SVDGVLSDFPITPS AIDC++H+ K    Q  + L+IS++GASGDYP CTD
Sbjct  314   LNFIDNDAFSVDGVLSDFPITPSAAIDCFAHIGKNASGQ-EKPLIISYNGASGDYPSCTD  372

Query  1372  XAYSKAVSDGVDIIDC  1419
              AY+KA+SDGVD++DC
Sbjct  373   LAYTKAISDGVDVLDC  388


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 138/299 (46%), Gaps = 31/299 (10%)
 Frame = +1

Query  358   DAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNAS  537
             + PL+I+  G SG +P  +  AY+ A    +   ++ C+VQ+TKDG  IC   I L +++
Sbjct  353   EKPLIISYNGASGDYPSCTDLAYTKAISDGVD--VLDCNVQMTKDGTPICLSSINLMDST  410

Query  538   NVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYS--RSSRFDG--TPQQ  702
              VA       +T +      +  F  +  ++ + +L       YS  R SR     T  +
Sbjct  411   KVAQTPFSTFTTTITELQKGSGIFTFNLTWEDIRSLTPAISNPYSTFRLSRNPAAKTAGK  470

Query  703   ILTVEDVFNKVQPP-----GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             ++++ D  +  +       G+ + ++H +F  +  LS+   VL    +   + +++P V 
Sbjct  471   LVSLSDFLSIAKEANSLSGGVLIGIEHAAFLVKVGLSVTDAVLDALSKAGYDNVTTPRV-  529

Query  868   FLKSIASRI------NPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVP  1029
              ++S  S +        +  +LV+R   ++    +++ T       +  IK FA+ +++ 
Sbjct  530   MIQSTNSSVLKEFKEKKKNYELVYRV--DENIRDASDAT-------IEDIKKFATSVVIS  580

Query  1030  KSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
             K  I+P +K  +++   T +V    K  L VY   F ++ +  A+D+  D   E  SF+
Sbjct  581   KDSIYPENK--AFITGATDIVSRLKKNNLPVYVQRFDNEFISQAWDFFSDATVEINSFV  637



>gb|KDO62177.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
 gb|KDO62178.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=504

 Score =   515 bits (1326),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 308/378 (81%), Gaps = 3/378 (1%)
 Frame = +1

Query  286   CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  465
             C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67    CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  466   WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  645
             WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QGVYSR+ +FDG   QILTV+D+  +++PPGLWLN+QHD+FY+QHNLSMR+FVLSVS
Sbjct  186   ILNQGVYSRTDKFDGNGFQILTVQDMARQIKPPGLWLNIQHDAFYAQHNLSMRSFVLSVS  245

Query  826   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  1005
             R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+TNQTYGSLL+NL  IKT
Sbjct  246   RSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTTNQTYGSLLKNLTFIKT  305

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             FASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+FA+D+P +F+YSYDP+ 
Sbjct  306   FASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNFANDIPISFNYSYDPLT  364

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  1365
             EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K         LVIS +GASGDYP C
Sbjct  365   EYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-NLLVISKNGASGDYPSC  423

Query  1366  TDXAYSKAVSDGVDIIDC  1419
             T+ AY KA+SDGVD IDC
Sbjct  424   TNLAYQKAISDGVDFIDC  441



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   522 bits (1345),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 258/397 (65%), Positives = 315/397 (79%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLRSI---FNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDS  411
             MWK R++   F+LL  L  S + LV+AQGS  +T  W TL+G  PLVIARGGFSG+FPDS
Sbjct  1     MWKPRAVPRAFSLLHLLFHSVLVLVSAQGSNRTT--WNTLTGSPPLVIARGGFSGIFPDS  58

Query  412   SFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGV  591
             S  AY+ A +TSL N+I+WCDVQLTKDG GIC P+IKL+NA+N+  +F+++  TY VNGV
Sbjct  59    SEFAYNLAAVTSLKNLIVWCDVQLTKDGEGICIPNIKLENATNIDNVFQNRSKTYSVNGV  118

Query  592   PTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQH  768
              T+A+F +DF F++L + V L QG ++RS +FD    QILTV D+     PPGLWLN+QH
Sbjct  119   QTSAYFAVDFTFEELYSKVFLVQGDFTRSDKFDNNLFQILTVNDLVKNESPPGLWLNIQH  178

Query  769   DSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             D+FY QHNLSM+ FVLSVSR V +NYISSPE  FL++I + INPR+TKLVFRFL  DE +
Sbjct  179   DAFYEQHNLSMKNFVLSVSRTVNVNYISSPEAGFLRTIRAHINPRITKLVFRFLKKDEVD  238

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTYGSLL+NLASIKTF+SGILVPK YIWP+D SS YL P TSLV DAHKVGLEV+A
Sbjct  239   PSTNQTYGSLLKNLASIKTFSSGILVPKGYIWPIDPSSLYLLPHTSLVSDAHKVGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVP +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+TPS AIDC++H+      +
Sbjct  299   SDFLNDVPISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTPSEAIDCFAHVGLNATKK  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V   LVIS  GASGDYP CTD AY KA+SDGVD++DC
Sbjct  359   V-NTLVISKYGASGDYPPCTDLAYEKAISDGVDVLDC  394


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 78/327 (24%), Positives = 141/327 (43%), Gaps = 30/327 (9%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A    N+T K  TL      VI++ G SG +P  +  AY  A    +   ++ C VQ++K
Sbjct  349   AHVGLNATKKVNTL------VISKYGASGDYPPCTDLAYEKAISDGVD--VLDCPVQMSK  400

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  666
              G+  C   I L  ++NVA     K    +         F  D  +  + TL       Y
Sbjct  401   GGIPFCLSSIDLIESTNVAQSNFSKLGKIIPEIKSGNGIFTFDLAWDDIKTLTPSMLNPY  460

Query  667   SRSSRFD----GTPQQILTVEDVFN----KVQPPGLWLNVQHDSFYS-QHNLSMRTFVLS  819
             S +S +           LT+ D  N    +    G+ + +++ ++ + + NLS+   V+ 
Sbjct  461   SINSLYRNPKYNKKGHFLTLSDFLNLPKGQTSLLGVVITIENAAYLARKQNLSVTEAVID  520

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LAS  996
                +   +   +P+V    + +S +      L F+     E     ++  G  + + +  
Sbjct  521   TLSKAGYDKPGAPKVMIQSTNSSVL------LKFKEKTKYELVYKIDEIVGDAVDSAILD  574

Query  997   IKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSY  1173
             IK FA  ++V K+ ++PV K   ++  +T +V       L VY   F ++ V  A+D+  
Sbjct  575   IKRFAHSVVVKKASVYPVSK--FFVTGSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMS  632

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
             D   E  +F+ +    +DGV++DFP T
Sbjct  633   DATVEINTFVQDA--EIDGVITDFPKT  657



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   519 bits (1337),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 310/378 (82%), Gaps = 3/378 (1%)
 Frame = +1

Query  286   CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  465
             C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67    CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  466   WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  645
             WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QGVYSR+ +FDG   QILTV+D+  +++PPGLWLN+QHD+FY+QHNLSMR+FVLSVS
Sbjct  186   ILNQGVYSRTDKFDGNGFQILTVQDMARQIKPPGLWLNIQHDAFYAQHNLSMRSFVLSVS  245

Query  826   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  1005
             R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+TNQTYGSLL+NL  IKT
Sbjct  246   RSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTTNQTYGSLLKNLTFIKT  305

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             FASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+FA+D+P +F+YSYDP+ 
Sbjct  306   FASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNFANDIPISFNYSYDPLT  364

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  1365
             EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K   ++    LVIS +GASGDYP C
Sbjct  365   EYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGKN-ASKSANLLVISKNGASGDYPSC  423

Query  1366  TDXAYSKAVSDGVDIIDC  1419
             T+ AY KA+SDGVD IDC
Sbjct  424   TNLAYQKAISDGVDFIDC  441



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   520 bits (1338),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 255/394 (65%), Positives = 308/394 (78%), Gaps = 5/394 (1%)
 Frame = +1

Query  247   MWKLRSIFNL---LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             M K R +F L   LLLCS+  LV+AQ S    S WQTLSG+APLVIARGGFSG+FPDSS 
Sbjct  1     MLKFRPVFCLFSFLLLCSSSVLVSAQRSRTRGSPWQTLSGNAPLVIARGGFSGIFPDSSL  60

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
              AYS A  T L N+  WCDVQLTKDG GICFPD++L+NAS++  ++K++Q TY VNGV T
Sbjct  61    YAYSLAVQTGLPNLHAWCDVQLTKDGAGICFPDLRLENASDIDNIYKNRQKTYDVNGVST  120

Query  598   TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSF  777
               WF +DF  ++L  VN++Q ++SR+  FDGT  QILTV+DV ++ +P GLWLN+ HD+F
Sbjct  121   QGWFSVDFTLEELAPVNMKQRIFSRAPNFDGTLMQILTVDDVVSQTKPFGLWLNIPHDAF  180

Query  778   YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  957
             + QHNLSMR FVL+VSRRV+++YISSPEV FL+SIA+R     TKLVF+F+  D+ EP+T
Sbjct  181   FGQHNLSMRGFVLAVSRRVIVDYISSPEVGFLRSIAARFRTGRTKLVFQFMQPDDVEPTT  240

Query  958   NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  1137
             NQTYGSLL NL  I+TFASGI+VPKSYI PV K   YLQ +TSLV+DAHK GLEV+AS F
Sbjct  241   NQTYGSLLNNLTLIRTFASGIIVPKSYILPVGK-DQYLQNSTSLVVDAHKAGLEVFASTF  299

Query  1138  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  1317
             A+D  FA+DYSYDPV EYLSFIDNG +SVDGVLSDFPITPS  IDC++H+ K    Q   
Sbjct  300   ANDAAFAYDYSYDPVNEYLSFIDNGKFSVDGVLSDFPITPSETIDCFAHLGKNDTVQ-SN  358

Query  1318  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
              LVIS +GASGDYPGCTD AY KAVSDGVDI+DC
Sbjct  359   ILVISNEGASGDYPGCTDKAYEKAVSDGVDILDC  392



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   518 bits (1335),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 310/378 (82%), Gaps = 3/378 (1%)
 Frame = +1

Query  286   CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  465
             C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67    CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  466   WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  645
             WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QGVYSR+ +FDG   QILTV+D+  +++PPGLWLN+QHD+FY+QHNLSMR+FVLSVS
Sbjct  186   ILNQGVYSRTDKFDGNGFQILTVQDMARQIKPPGLWLNIQHDAFYAQHNLSMRSFVLSVS  245

Query  826   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  1005
             R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+TNQTYGSLL+NL  IKT
Sbjct  246   RSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTTNQTYGSLLKNLTFIKT  305

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             FASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+FA+D+P +F+YSYDP+ 
Sbjct  306   FASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNFANDIPISFNYSYDPLT  364

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  1365
             EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K   ++    LVIS +GASGDYP C
Sbjct  365   EYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGK-NASKSANLLVISKNGASGDYPSC  423

Query  1366  TDXAYSKAVSDGVDIIDC  1419
             T+ AY KA+SDGVD IDC
Sbjct  424   TNLAYQKAISDGVDFIDC  441



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   519 bits (1336),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/395 (64%), Positives = 315/395 (80%), Gaps = 10/395 (3%)
 Frame = +1

Query  247   MWKLRSI----FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             MW  RS+       +LL S  +LV+AQGS  S   W+TLSG+ PLVIARGGFSG+FPDSS
Sbjct  11    MWSRRSVSCVVAAFVLLNSLASLVSAQGSGTS---WKTLSGNPPLVIARGGFSGIFPDSS  67

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
               AY  A +T + ++I+WCDVQLTKDGVGIC PD++LDN+++++ +FK+K   YLVNG P
Sbjct  68    SAAYQLALITGVPDLILWCDVQLTKDGVGICAPDLRLDNSTDISLVFKNKDKNYLVNGAP  127

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T  WF +DF F  L+ V L QGVYSRS++FDG    I TVE+V   ++PP +WLN+QHD+
Sbjct  128   TQGWFSVDFTFNDLSSVVLTQGVYSRSNKFDGNLFPIQTVENV-TGLKPPSIWLNIQHDA  186

Query  775   FYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  954
             F++QHNLSMR++VLS+S++VVINYISSPE+ FL+ IASR NP+VTKLVFRFLG +E EPS
Sbjct  187   FFTQHNLSMRSYVLSLSKKVVINYISSPEMAFLRGIASRFNPKVTKLVFRFLGPNEIEPS  246

Query  955   TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  1134
             TNQTY +L +NL  IKTFASGIL+PK YIWPVD +S YLQP TS+V DAHK GLEV+AS+
Sbjct  247   TNQTYSALSKNLTFIKTFASGILIPKGYIWPVD-ASLYLQPHTSVVSDAHKAGLEVFASE  305

Query  1135  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  1314
             F +DVPF+F+YSYDP++EYLSF+DNG++S+DGVLSDFPITPSGA DC+S + +    Q  
Sbjct  306   FYNDVPFSFNYSYDPISEYLSFVDNGDFSIDGVLSDFPITPSGAFDCFSQIGQNATKQ-S  364

Query  1315  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
               LVIS +GASGDYPGCTD AY KA+SDG D+IDC
Sbjct  365   NVLVISKNGASGDYPGCTDMAYQKAISDGADVIDC  399



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   518 bits (1334),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 312/397 (79%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1     MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
               AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60    PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++PPG WLN+QH++
Sbjct  120   TKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKPPGFWLNIQHNA  179

Query  775   FYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKLVFRFL  D  E
Sbjct  180   FYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI+C++H+ +    Q
Sbjct  299   SDFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAINCFAHLGRNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V + LVIS +GASGDYPGCTD AY+KA+ DGVD+IDC
Sbjct  359   V-DLLVISKNGASGDYPGCTDQAYTKAIQDGVDVIDC  394


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 70/309 (23%), Positives = 142/309 (46%), Gaps = 27/309 (9%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI++ G SG +P  +  AY+ A    +   ++ C VQ+TKDG  IC   I L ++++VA
Sbjct  362   LVISKNGASGDYPGCTDQAYTKAIQDGVD--VIDCPVQMTKDGTPICLGSINLIDSTDVA  419

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQL----TLVNLQQGVYS--RSSRFDG-----T  693
                    S  +   +  +  F  D +++ +    T ++  Q  Y   R+ +F       T
Sbjct  420   QSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAISSPQSEYKLFRNPKFKNVGKFLT  479

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
               + L +    + +Q  G+ + +++ ++ ++    +   V         +  ++ +V   
Sbjct  480   LSEFLAMAKSASSLQ--GVLIAIENAAYLAEQGFGVTDAVFDALSEAGYDKQTAQKVMIQ  537

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ-NLASIKTFASGILVPKSYIWPV  1050
              S +S +      + F+   N +     ++  G   Q ++  IK+FAS +++ K  ++P 
Sbjct  538   SSNSSVL------MKFKGKSNYKLVYKVDEDIGGAQQASIDDIKSFASAVVISKDSVFP-  590

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
              +++++L   T +V       L VY   F+++    A+D+  D   E  SF   G   ++
Sbjct  591   -ENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATVEVNSFHVGG--LIN  647

Query  1228  GVLSDFPIT  1254
             GV++DFP T
Sbjct  648   GVITDFPET  656



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   518 bits (1333),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 312/397 (79%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLL----LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR I   +L    L ++V LV+AQGS+N  S+WQTL+GD P VIARGGFSG+F DSS
Sbjct  1     MGSLRGITVAVLVVQALLASVALVSAQGSSNR-SRWQTLNGDVPFVIARGGFSGMFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
               AY  A LT  TNVI+WCDVQL+KD  GICFPD+KLDN S++ T+F +KQ TYLVNGV 
Sbjct  60    PAAYRLALLTGPTNVILWCDVQLSKDAAGICFPDLKLDNNSDITTVFPNKQKTYLVNGVA  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T  WF +D+  K +  V L QGV+SRS++FDG    I+TV D +  ++PPG WLN+QH++
Sbjct  120   TKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGNNYPIMTVADTYTLLKPPGFWLNIQHNA  179

Query  775   FYSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+QHNLSMR FV+S++R   V ++YISSPEV FL+SIA+R     TKLVFRFL  D  E
Sbjct  180   FYAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI+C++H+ +    Q
Sbjct  299   SDFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAINCFAHLGRNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V + LVIS +GASGDYPGCTD AY+KA+ DGVD+IDC
Sbjct  359   V-DLLVISKNGASGDYPGCTDQAYTKAIQDGVDVIDC  394


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 70/309 (23%), Positives = 142/309 (46%), Gaps = 27/309 (9%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI++ G SG +P  +  AY+ A    +   ++ C VQ+TKDG  IC   I L ++++VA
Sbjct  362   LVISKNGASGDYPGCTDQAYTKAIQDGVD--VIDCPVQMTKDGTPICLGSINLIDSTDVA  419

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQL----TLVNLQQGVYS--RSSRFDG-----T  693
                    S  +   +  +  F  D +++ +    T ++  Q  Y   R+ +F       T
Sbjct  420   QSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAISSPQSEYKLFRNPKFKNVGKFLT  479

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
               + L +    + +Q  G+ + +++ ++ ++    +   V         +  ++ +V   
Sbjct  480   LSEFLAMAKSASSLQ--GVLIAIENAAYLAEQGFGVTDAVFDALSEAGYDKQTAQKVMIQ  537

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ-NLASIKTFASGILVPKSYIWPV  1050
              S +S +      + F+   N +     ++  G   Q ++  IK+FAS +++ K  ++P 
Sbjct  538   SSNSSVL------MKFKGKSNYKLVYKVDEDIGGAQQASIDDIKSFASAVVISKDSVFP-  590

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
              +++++L   T +V       L VY   F+++    A+D+  D   E  SF   G   ++
Sbjct  591   -ENNAFLTGVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATVEVNSFHVGG--LIN  647

Query  1228  GVLSDFPIT  1254
             GV++DFP T
Sbjct  648   GVITDFPET  656



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   518 bits (1334),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 258/411 (63%), Positives = 314/411 (76%), Gaps = 22/411 (5%)
 Frame = +1

Query  247   MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR    +IF +  L ++VTLV+AQGSTN  S+WQTLSG AP VIA GGFSG+F DSS
Sbjct  1     MGSLRGISVAIFVVQALLASVTLVSAQGSTNG-SRWQTLSGKAPSVIAHGGFSGIFADSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
             F AYS A LTS  +VI+WCDVQLT+DG GICFPD+KLDN S+VA ++K++Q TYLVNGV 
Sbjct  60    FGAYSLALLTSPPDVILWCDVQLTRDGAGICFPDLKLDNNSDVAIVYKNRQKTYLVNGVS  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T  WF IDF  ++L  V L QGVYSR+++FDG    I+TV+D + ++ PP  WLN+QHD+
Sbjct  120   TKGWFSIDFTLRELGNVILSQGVYSRTNKFDGNNYPIMTVQDTYAQLNPPRFWLNIQHDA  179

Query  775   FYSQHNLSMRTFVLSVS--RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+QHNLSMR+FVLS++  R V I+YISSPEV FL++IA       T LVFRFLG ++ E
Sbjct  180   FYTQHNLSMRSFVLSITRNRNVTIDYISSPEVAFLQNIAPSFRRSATNLVFRFLGQNDVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTYGSLL+N+  IKTFA GI+VPKSYIWPVDK   YL P+TSLVLDAHK GLEV+A
Sbjct  240   PSTNQTYGSLLKNITFIKTFAFGIIVPKSYIWPVDK-DLYLLPSTSLVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL FIDNG +SVDG++SDFPITPS AIDC++H+ +    Q
Sbjct  299   SDFYNDVPFSFNYSYDPVAEYLQFIDNGEFSVDGMISDFPITPSAAIDCFAHLGRNASKQ  358

Query  1309  --------------VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
                             + LVIS +GASGDYPGCTD AYS A+ DGVD+IDC
Sbjct  359   GTNIAKLFFFCCNVTVDLLVISSNGASGDYPGCTDVAYSTAIQDGVDVIDC  409


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 84/342 (25%), Positives = 153/342 (45%), Gaps = 50/342 (15%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI+  G SG +P  +  AYS A    +   ++ C VQ+T DG  IC   I L +++ VA
Sbjct  377   LVISSNGASGDYPGCTDVAYSTAIQDGVD--VIDCPVQMTMDGTPICLSSINLIDSTTVA  434

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNF---KQLT-LVNLQQGVYS--RSSRFDG-----T  693
                 +  +T +   +  +  F  + ++   K LT ++   Q  Y   R+ RF       T
Sbjct  435   QSEFNNLTTTIPQIMSGSGIFTFNLSWSGIKTLTPIIASPQSQYKLFRNPRFKNAGKFLT  494

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVL----------SVSRRVVIN  843
               + LT+    + +Q  G+ +++++  F  +   ++   VL             ++V+I 
Sbjct  495   LSEFLTMASNASSLQ--GVLISIENAPFLLEQGFAITDAVLDALSKAGYGNKTDQKVMIQ  552

Query  844   YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGIL  1023
               SS   + L    S+ N  +   V   +G            G+    +  IK FAS ++
Sbjct  553   SSSS---SVLMKFKSQTNYDLVYKVDEDIG------------GAQSSTIDDIKRFASAVV  597

Query  1024  VPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSF  1200
             + K  ++P  ++S+++   T++V       L VY   F+++    A+D+  DP  E  SF
Sbjct  598   ISKDSVFP--ETSAFITSATNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTVEINSF  655

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMR-KGQKNQVPEFL  1323
                G   ++GV++DFP T     + Y   R   + NQ+P ++
Sbjct  656   YLGG--GINGVITDFPKTS----NRYRRNRCLNRGNQIPGYM  691



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   516 bits (1329),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 313/397 (79%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1     MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
             F AYS A  T  ++VI+WCDVQLTKDG GICFPD+KLDN SN+AT+F DK  TYLVNGV 
Sbjct  60    FGAYSLALETGPSDVILWCDVQLTKDGAGICFPDLKLDNNSNIATIFSDKPVTYLVNGVS  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T   F ID+  K L  V L QG+YSR+++FDG   QI+TV+D + +++P G WLN+QHD+
Sbjct  120   TKGLFSIDYTLKDLGSVYLSQGIYSRTNKFDGNNYQIMTVQDTYTQLKPLGFWLNIQHDA  179

Query  775   FYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+ HNLSMR+FVLSV+R  +V ++YISSPEV FL++IA       TK+VFRFLG  + E
Sbjct  180   FYAAHNLSMRSFVLSVTRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGRKDVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTY SLL NL  IKTFA+GI+VPK YIWPVD  + YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNQTYDSLLTNLTFIKTFAAGIIVPKCYIWPVD-GALYLQPSTSIVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q
Sbjct  299   SDFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
               + LVIS +GASGDYPGCT+ AYSKA+ DGVD++DC
Sbjct  359   A-DLLVISNNGASGDYPGCTNMAYSKAIQDGVDVLDC  394



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   518 bits (1333),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 254/378 (67%), Positives = 308/378 (81%), Gaps = 3/378 (1%)
 Frame = +1

Query  286   CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  465
             C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  67    CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  125

Query  466   WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  645
             WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  126   WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  185

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QGVYSR+ +FDG   QILTV+D+  +++PPGLWLN+QHD+FY+QHNLSMR+FVLSVS
Sbjct  186   ILNQGVYSRTDKFDGNGFQILTVQDMARQIKPPGLWLNIQHDAFYAQHNLSMRSFVLSVS  245

Query  826   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  1005
             R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+TNQTYGSLL+NL  IKT
Sbjct  246   RSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTTNQTYGSLLKNLTFIKT  305

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             FASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+FA+D+P +F+YSYDP+ 
Sbjct  306   FASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNFANDIPISFNYSYDPLT  364

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  1365
             EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K         LVIS +GASGDYP C
Sbjct  365   EYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-NLLVISKNGASGDYPSC  423

Query  1366  TDXAYSKAVSDGVDIIDC  1419
             T+ AY KA+SDGVD IDC
Sbjct  424   TNLAYQKAISDGVDFIDC  441



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   512 bits (1318),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 251/397 (63%), Positives = 310/397 (78%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1     MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
             F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60    FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T   F ID+    L  V L QG+YSR+++ DG    I+TV+D + ++QP G WLN+QHD+
Sbjct  120   TKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDGNNYPIMTVQDTYTQLQPRGFWLNIQHDA  179

Query  775   FYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+VFRFLG  + E
Sbjct  180   FYAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGPKDVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q
Sbjct  299   SDFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
               + LVIS +GASGDYPGCTD AY+KA+ DGVD++DC
Sbjct  359   A-DLLVISNNGASGDYPGCTDMAYTKAIQDGVDVLDC  394



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   511 bits (1316),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/397 (63%), Positives = 310/397 (78%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1     MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
             F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60    FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T   F ID+    L  V L QG+YSR+++ DG    I+TV+D + ++QP G WLN+QHD+
Sbjct  120   TKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDGNNYPIMTVQDTYTQLQPRGFWLNIQHDA  179

Query  775   FYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+VFRFLG  + E
Sbjct  180   FYAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGPKDVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q
Sbjct  299   SDFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
               + LVIS +GASGDYPGCTD AY+KA+ DGVD++DC
Sbjct  359   A-DLLVISNNGASGDYPGCTDMAYTKAIQDGVDVLDC  394



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   513 bits (1321),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 307/378 (81%), Gaps = 3/378 (1%)
 Frame = +1

Query  286   CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIM  465
             C  +  V+AQGS N+TS+WQTL+GD P V+ARGGFSG+FPDSS  AYS   +TS  +VI+
Sbjct  20    CGVIAQVSAQGS-NATSRWQTLTGDPPFVVARGGFSGIFPDSSSIAYSLTLITSAPSVIL  78

Query  466   WCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLV  645
             WCDVQLTKD  GICFPD+KLDNASN+A +FK +Q  YLVNGVPT  WF ID+    L+ +
Sbjct  79    WCDVQLTKDEAGICFPDLKLDNASNIAQIFKTQQKNYLVNGVPTPGWFSIDYTLNDLSNI  138

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QGVYSR+ +FDG   QILTV+D+  +++PPGLWLN+QHD+FY+QHNLSMR+FVLSVS
Sbjct  139   ILNQGVYSRTDKFDGNVFQILTVQDMARQIKPPGLWLNIQHDAFYAQHNLSMRSFVLSVS  198

Query  826   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  1005
             R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+TNQTYGSLL+NL  IKT
Sbjct  199   RSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTTNQTYGSLLKNLTFIKT  258

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             FASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+FA+D+P +F+YS+DP+ 
Sbjct  259   FASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNFANDIPISFNYSHDPLT  317

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  1365
             EYLSFIDN ++SVDGVLSDFP+TPS A+DC++H+ K         LVIS +GASGDYP C
Sbjct  318   EYLSFIDNRDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-NLLVISKNGASGDYPSC  376

Query  1366  TDXAYSKAVSDGVDIIDC  1419
             T+ AY KA+SDGVD IDC
Sbjct  377   TNLAYQKAISDGVDFIDC  394



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   512 bits (1319),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 248/377 (66%), Positives = 303/377 (80%), Gaps = 3/377 (1%)
 Frame = +1

Query  289   SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  468
             S V LV+A+GS NSTS+W+TLSGDAPLVIARGGFSGLFP  S  A+S A +TS+ +V++W
Sbjct  16    SVVALVSAKGS-NSTSQWKTLSGDAPLVIARGGFSGLFPGFSSAAFSLALITSVPDVVLW  74

Query  469   CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  648
             CDVQLTKD  GICFPDI L+N S+V  +F  K  TYLVNG  T  WF +D+    L  V 
Sbjct  75    CDVQLTKDEAGICFPDILLNNNSDVQDVFAKKDKTYLVNGASTHGWFSVDYTLNDLANVF  134

Query  649   LQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSR  828
             + QG+YSR+++FDG    ILTVEDV  +++PPGLWLNVQHD F+SQHNLSMR +VLSVSR
Sbjct  135   VTQGIYSRTNKFDGNLYPILTVEDVATQLKPPGLWLNVQHDIFFSQHNLSMRNYVLSVSR  194

Query  829   RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTF  1008
             +VV+NYISSPEV FL SI +R++P  TKLVFRFLG D+TEPST Q YGSLL+NL  IKTF
Sbjct  195   KVVVNYISSPEVAFLNSIKARVSPSATKLVFRFLGQDDTEPSTKQNYGSLLKNLTYIKTF  254

Query  1009  ASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAE  1188
             ASGIL+PK+YIWPV  +  YL+P TS+VLDAHK GL V+ASDF +DVP A++YSYDPV+E
Sbjct  255   ASGILIPKTYIWPV-TTDLYLEPHTSIVLDAHKAGLTVFASDFVNDVPLAYNYSYDPVSE  313

Query  1189  YLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCT  1368
             YL+F+DNG++SVDGVLSDFPITPS AIDC++H+      Q  + LVIS  GASGD+P CT
Sbjct  314   YLNFVDNGDFSVDGVLSDFPITPSEAIDCFAHLGNNASGQA-KPLVISKYGASGDFPSCT  372

Query  1369  DXAYSKAVSDGVDIIDC  1419
             D AYSKA++DGVD++DC
Sbjct  373   DLAYSKAIADGVDVLDC  389


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 150/315 (48%), Gaps = 27/315 (9%)
 Frame = +1

Query  352   SGDA-PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
             SG A PLVI++ G SG FP  +  AYS A    +   ++ C VQ+++DG+  C   I L 
Sbjct  351   SGQAKPLVISKYGASGDFPSCTDLAYSKAIADGVD--VLDCPVQISRDGIPFCSSSINLI  408

Query  529   NASNVATLFKDKQSTYLVNGVPTTAWFPIDF---NFKQLT-LVNLQQGVYS--RSSRFDG  690
             +++ VA       +T +      +  +       + K LT +++     Y+  RS R   
Sbjct  409   DSTTVAQSRFSNLTTVIPKIKAGSGIYTFSLTWEDIKSLTPIISNPWSTYTLYRSPRTKN  468

Query  691   TPQQILTVEDVFNKVQP----PGLWLNVQHDSFYSQHN-LSMRTFVLSVSRRVVINYISS  855
                + LT+ D     Q      G+ + ++H ++ ++   LS+   V++  R+  ++  ++
Sbjct  469   A-GKYLTLSDFLTLAQKSSSLSGVLIGIEHATYLAEEQGLSVTDKVIAALRKAGLDNWTA  527

Query  856   PEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYG-SLLQNLASIKTFASGILVPK  1032
             P+V    + +S +      + F+   N        +  G +L  ++  IK FA  +++ K
Sbjct  528   PDVKIQSTNSSVL------MKFKEKTNYGRVYKIEENIGDALSSSIEDIKKFADSVVINK  581

Query  1033  SYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDN  1209
             + I+P  ++ +++   T +V       L VY   F+++ V  A+D+  DP  E  SF+  
Sbjct  582   ASIFP--ETQAFITRVTDVVPKLKAAKLPVYVELFSNEFVSQAWDFFSDPTVEINSFVLA  639

Query  1210  GNYSVDGVLSDFPIT  1254
              N  +DGV++DFP T
Sbjct  640   VN--IDGVITDFPKT  652



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   511 bits (1316),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 251/397 (63%), Positives = 310/397 (78%), Gaps = 9/397 (2%)
 Frame = +1

Query  247   MWKLR----SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSS  414
             M  LR    +IF +  L ++V LV+AQGS  + S+WQTLSG+AP+VIARGGFSG+F DSS
Sbjct  1     MGSLRGISIAIFVVQALLASVALVSAQGSA-TPSRWQTLSGEAPVVIARGGFSGIFSDSS  59

Query  415   FNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVP  594
             F AYS A  T  ++VI+WCDVQLT DG GICFPD+KLDN S +AT+F DK +TYLVNGV 
Sbjct  60    FGAYSLALETGPSDVILWCDVQLTNDGAGICFPDLKLDNNSKIATVFTDKPTTYLVNGVS  119

Query  595   TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDS  774
             T   F ID+    L  V L QG+YSR+++ DG    I+TV+D + ++QP G WLN+QHD+
Sbjct  120   TKGLFSIDYTLNDLGSVYLSQGIYSRTNKLDGNNYPIMTVQDTYTQLQPRGFWLNIQHDA  179

Query  775   FYSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             FY+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+VFRFLG  + E
Sbjct  180   FYAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGPKDVE  239

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+VLDAHK GLEV+A
Sbjct  240   PSTNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIVLDAHKEGLEVFA  298

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             SDF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q
Sbjct  299   SDFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQ  358

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
               + LVIS +GASGDYPGCTD AY+KA+ DGVD++DC
Sbjct  359   A-DLLVISNNGASGDYPGCTDMAYTKAIQDGVDVLDC  394



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   511 bits (1315),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 252/386 (65%), Positives = 312/386 (81%), Gaps = 5/386 (1%)
 Frame = +1

Query  265   IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             IF  L L S + LV+AQGS NST+ WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA + 
Sbjct  10    IFFSLFLHSFLALVSAQGS-NSTALWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAVMV  68

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV-ATLFKDKQSTYLVNGVPTTAWFPIDF  621
             S+ +VI+WCDVQLTKDGVGIC PD++LDNA++   TL K++ S+YLVNGV T+  F +DF
Sbjct  69    SVPDVILWCDVQLTKDGVGICLPDLRLDNATDAPTTLGKNRTSSYLVNGVRTSGLFTVDF  128

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
             +FK+L  V+L QG+YSRS++FDG    ILT EDV N+ +PPG WLN+QHD F++QHN SM
Sbjct  129   DFKELENVSLVQGIYSRSTKFDGNQFVILTAEDVANQFKPPGFWLNIQHDVFFTQHNASM  188

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
             R FVLSV+RR+V+NYISSPEV FL+SIA+R+ PR TKL+ RFLG  +TE +TNQTYGSLL
Sbjct  189   RNFVLSVTRRIVVNYISSPEVGFLRSIAARV-PRTTKLILRFLGPTDTEITTNQTYGSLL  247

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
             +NL  IKTFASGILVPK+YIWP+  +  Y+Q  T LV DAHK  LEV+AS+F SD+P  +
Sbjct  248   RNLTFIKTFASGILVPKTYIWPMG-TDGYVQAQTPLVSDAHKAQLEVFASEFFSDLPLGY  306

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             +YSYDPV EYLS+ DNG +SVDGVLSDFPITPS AIDC++H+ K  K+Q  + LVIS  G
Sbjct  307   NYSYDPVTEYLSYFDNGKFSVDGVLSDFPITPSSAIDCFAHLDKNAKSQA-KPLVISKFG  365

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             ASGDYPGCTD AY+ A+SDGV+++DC
Sbjct  366   ASGDYPGCTDLAYTNAMSDGVEVLDC  391



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   509 bits (1312),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 243/391 (62%), Positives = 299/391 (76%), Gaps = 2/391 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW+ R +F L++LC     VAAQG+     +WQTLSG+APLVIARGGFSG+FP SS  AY
Sbjct  1     MWRFRDVFLLIMLCLLAVSVAAQGTRRGGRQWQTLSGNAPLVIARGGFSGVFPYSSGYAY  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A LT L N+ +WCDVQLTKDG GICFPDI+L NAS++  ++ +K +TY ++G     W
Sbjct  61    ELALLTGLPNLHIWCDVQLTKDGAGICFPDIRLQNASDIKYVYGNKSNTYTIDGKQEQGW  120

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F +DF  K L LVN+ QG+++R   FDG    ILTV+DV    +PPGLWLN+ HD+F+SQ
Sbjct  121   FSVDFTLKDLKLVNMNQGIHNRVPHFDGNNLPILTVDDVVRLTKPPGLWLNIPHDAFFSQ  180

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR+F++S SRR+++NYISSPEV FL+SI SR     TKLVF+FLG D+ EP TNQT
Sbjct  181   HNLSMRSFIISASRRMIVNYISSPEVGFLRSIVSRFRTGPTKLVFQFLGPDDVEPLTNQT  240

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             Y  L++NL  IKTFA+GI+VPKSYIWPVD +S YL   TSLVLD+H+ GLEV+ASDFA+D
Sbjct  241   YRLLMKNLTFIKTFATGIIVPKSYIWPVD-NSLYLHNYTSLVLDSHEAGLEVFASDFAND  299

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
                 ++YSYDPV EYLSFIDNG +SVDGVLSDFPIT S  IDC+SHM K    Q  + L+
Sbjct  300   ASLPYNYSYDPVVEYLSFIDNGQFSVDGVLSDFPITASATIDCFSHMGKNDTVQA-KLLI  358

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             IS +GASGDYPGCTD AY+KAVSDGVDI+DC
Sbjct  359   ISSEGASGDYPGCTDEAYAKAVSDGVDILDC  389



>ref|XP_009364631.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
 ref|XP_009364652.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
Length=447

 Score =   496 bits (1278),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 249/392 (64%), Positives = 307/392 (78%), Gaps = 7/392 (2%)
 Frame = +1

Query  247   MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M  LR+ +   LLL S V LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1     MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
             +  A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57    FDLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINDVLPQKEKTYLVNGVSTKG  116

Query  604   WFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             WF +D+ +  L  +++ QG+YSRS+RFDG P  IL VEDV  + +PPGLWLN+QHD F++
Sbjct  117   WFTVDYTWDGLVNISVTQGIYSRSNRFDGNPYPILLVEDVATQFKPPGLWLNIQHDIFFA  176

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVFRFL  DETEPSTNQ
Sbjct  177   QHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVFRFLAQDETEPSTNQ  236

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ASDF +
Sbjct  237   TYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFASDFVN  295

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AI+C++H+      Q    L
Sbjct  296   DVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIECFAHLASNASGQAKP-L  354

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             VIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  355   VISKYGASGDFPSCTDLAYTKAIADGVDVLDC  386



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   507 bits (1306),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 248/377 (66%), Positives = 303/377 (80%), Gaps = 4/377 (1%)
 Frame = +1

Query  289   SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  468
             S V LV+A+GS NSTS+WQTLSGDAPLVIARGGFSGLFP  S  A++ A +TS+ +V++W
Sbjct  16    SVVALVSAKGS-NSTSQWQTLSGDAPLVIARGGFSGLFPGFSTAAFNLALVTSVPDVVLW  74

Query  469   CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  648
             CDVQLT+DG GICFPD+ L+N S++  +F  K  TYLVNGV T  WF +D+ F  L  V 
Sbjct  75    CDVQLTRDGAGICFPDLLLNNNSDIEAVFPKKDKTYLVNGVSTRGWFTVDYTFNDLASVF  134

Query  649   LQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSR  828
             + QGVYSR+++FDG    I TVEDV   ++PPGLWLNVQHD F+SQHNLSMR +VLSVSR
Sbjct  135   VTQGVYSRTNKFDGNSYPISTVEDV-AMLKPPGLWLNVQHDIFFSQHNLSMRNYVLSVSR  193

Query  829   RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTF  1008
             +VV+NYISSPEV FL SI +R++P  TKLVF+FLG D+TEPST QTYGSLL+NL  IKTF
Sbjct  194   KVVVNYISSPEVAFLNSIKARVSPSTTKLVFQFLGQDDTEPSTKQTYGSLLKNLTYIKTF  253

Query  1009  ASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAE  1188
             ASGIL+PK YIWPV K   YL+P TS+VLDAHK GL V+ASDF +DVP A++YSYDPV+E
Sbjct  254   ASGILIPKIYIWPVTK-DLYLEPHTSIVLDAHKAGLTVFASDFVNDVPLAYNYSYDPVSE  312

Query  1189  YLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCT  1368
             YL+F+DN ++SVDGVLSDFPITPS AIDC++H+ K    Q  + LVIS  GASGD+P CT
Sbjct  313   YLNFVDNDDFSVDGVLSDFPITPSEAIDCFAHLGKNTSGQA-KPLVISKYGASGDFPSCT  371

Query  1369  DXAYSKAVSDGVDIIDC  1419
             D AY KA++DGVD++DC
Sbjct  372   DLAYLKAIADGVDVLDC  388


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 158/338 (47%), Gaps = 31/338 (9%)
 Frame = +1

Query  352   SGDA-PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
             SG A PLVI++ G SG FP  +  AY  A    +   ++ C VQ++KDG+  C  +I L 
Sbjct  350   SGQAKPLVISKYGASGDFPSCTDLAYLKAIADGVD--VLDCPVQISKDGIPFCSSNINLI  407

Query  529   NASNVATLFKDKQSTYLVNGVPTTAWFPIDF---NFKQLT-LVNLQQGVYS--RSSRFDG  690
             +++ VA       +T +      +  +       N K LT +++     Y+  RS R + 
Sbjct  408   DSTTVAQSSFSNLTTVIPEIKAGSGIYTFSLTWENIKSLTPIISNPWSSYTLFRSPR-NK  466

Query  691   TPQQILTVEDVFNKVQP----PGLWLNVQHDSFYSQHN-LSMRTFVLSVSRRVVINYISS  855
                + LT+ D     Q      G+ + ++H  + ++   LS+   V++  R+   +  ++
Sbjct  467   NAGKYLTLSDFLTLAQKSSSLSGVLIGIEHAPYLAEEQGLSVTDTVIAALRKAGFDNRTA  526

Query  856   PEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LASIKTFASGILVPK  1032
             P+V    + +S +      + F+   N E      +  G  L + +  IK FA  +++ K
Sbjct  527   PDVKIQSTNSSVL------MKFKEKTNYELVYKIEEDIGDALSSTIEDIKKFADSVVINK  580

Query  1033  SYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDN  1209
             + I+P  ++ +++   T +V +     L+VY   F+++ V  A+D+  DP  E  SF   
Sbjct  581   ASIFP--QTQAFVARVTHVVPELQAAKLQVYVELFSNEFVSQAWDFFSDPTVEINSFATG  638

Query  1210  GNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
              N  +DGV++DFP T +     Y   R   +  +P ++
Sbjct  639   VN--IDGVITDFPKTAAR----YKRNRCLSEKVLPNYM  670



>ref|XP_012070946.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Jatropha 
curcas]
 gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   507 bits (1306),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 248/397 (62%), Positives = 316/397 (80%), Gaps = 12/397 (3%)
 Frame = +1

Query  247   MWKLRSIFNLL---LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             M + R+  +LL   +L   ++ V+A+GSTN   +WQTLSG+ PLV+ARGGFSG+FPDSS 
Sbjct  1     MCRPRAFASLLAGFILLHLLSFVSAKGSTN---RWQTLSGNPPLVVARGGFSGIFPDSSS  57

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
              AY  A  TS+ +V++WCDVQLTKDGVGIC PD++L+N+++++  FK+++STY+VNGV T
Sbjct  58    YAYQLALATSVPDVVLWCDVQLTKDGVGICAPDVRLENSTDISLFFKNRESTYIVNGVST  117

Query  598   TAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGL--WLNVQH  768
               WF +DF F +L + + L QGVYSRS+ FD     I TVE+V   ++PPG   WLNVQH
Sbjct  118   KGWFSVDFTFSELISNIGLTQGVYSRSNMFDSNLFPIQTVENV-TALKPPGTGTWLNVQH  176

Query  769   DSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETE  948
             D+F++QHNLSMR +VL++SR+ VINYISSPEV FL+SIA RINP +TKLVFRFLG  + E
Sbjct  177   DAFFTQHNLSMRNYVLAISRKAVINYISSPEVGFLRSIAPRINPNITKLVFRFLGPSDIE  236

Query  949   PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  1128
             PSTNQTY + L+NL SIKTFASGIL+PK+YIWPVD ++ YLQP TS+V DAHK GLEV+A
Sbjct  237   PSTNQTYSAFLKNLTSIKTFASGILIPKNYIWPVD-ATLYLQPHTSVVSDAHKAGLEVFA  295

Query  1129  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  1308
             S+F +DVPF+F+YSYDPV EYL F+DNG++SVDGVLSDFPIT S A+DC+SH+ K    Q
Sbjct  296   SEFYNDVPFSFNYSYDPVTEYLYFVDNGDFSVDGVLSDFPITASEALDCFSHLGKNASTQ  355

Query  1309  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             V + LVIS +GASGDYPGCTD AY  A+SDG D+IDC
Sbjct  356   V-DVLVISKNGASGDYPGCTDKAYQAAISDGTDVIDC  391



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   504 bits (1297),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 299/371 (81%), Gaps = 7/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25    SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF +DF   +L+LV L QG+Y
Sbjct  82    KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWFTVDFTLNELSLVFLTQGIY  141

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS RFD +   I TVEDV N ++PPGLWLN+QHD+F+ QHNLSMR+++LS+SRRVVIN+
Sbjct  142   SRSERFDNS-YPIQTVEDVAN-LKPPGLWLNIQHDAFFKQHNLSMRSYILSLSRRVVINH  199

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             +SSPE  FL+SI  R N  +TKLVFRFL  +  EPSTN+TYGSL +N   IKTFASGIL+
Sbjct  200   LSSPEAGFLRSIVKRFNLNITKLVFRFLEPNVIEPSTNETYGSLSRNFTFIKTFASGILI  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PKSYIWP+D +S+YL P TS+VLDAHK GLEV+ SDF +DVP +++YSYDPV EYLSF+D
Sbjct  260   PKSYIWPLD-ASNYLLPHTSIVLDAHKAGLEVFVSDFYNDVPLSYNYSYDPVTEYLSFVD  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NG++SVDGVLSDFP+TPS  IDC+S + K    QV E LVIS +GASGDYPGCTD AY K
Sbjct  319   NGDFSVDGVLSDFPVTPSATIDCFSGLGKNATPQV-ELLVISKNGASGDYPGCTDLAYQK  377

Query  1387  AVSDGVDIIDC  1419
             A+ DG D+IDC
Sbjct  378   AILDGADVIDC  388



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   503 bits (1295),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 249/389 (64%), Positives = 305/389 (78%), Gaps = 5/389 (1%)
 Frame = +1

Query  259   RSIFNLLLLCSAVTLVAAQGSTN-STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFA  435
             R +F LL+L SAV + + + STN STS W TL+G APLVIA+GGFSGLFPDSS+ AYS A
Sbjct  5     RPLFLLLVLHSAVLITSQRSSTNNSTSPWLTLNGKAPLVIAKGGFSGLFPDSSYAAYSLA  64

Query  436   GLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPI  615
              +TSL+NVI+WCDVQLTKD VGICFPD+KLDN+S++A +FK+  + YLVNG     +FP+
Sbjct  65    NMTSLSNVILWCDVQLTKDAVGICFPDLKLDNSSDIANVFKN-STVYLVNGQLMKGYFPV  123

Query  616   DFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNL  795
             D+    L  V L QG+YSR+ +FDG    IL VE++   ++PPGLWLN+QHD+FY+QHNL
Sbjct  124   DYTLNDLANVYLTQGIYSRTDKFDGNLFSILRVEEL-ASLRPPGLWLNIQHDAFYTQHNL  182

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGS  975
             SMR+FVLSVSRRV++NYISSPEV FL SIA+R     TKLVFRFLG D+ EPSTNQTYGS
Sbjct  183   SMRSFVLSVSRRVIVNYISSPEVAFLSSIAARFRRSTTKLVFRFLGADDIEPSTNQTYGS  242

Query  976   LLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPF  1155
             LLQNL  +K FASGILVPK+ IWPV  SS YLQP TS+V +AHK GLEV+ASDF +DVP 
Sbjct  243   LLQNLTFVKAFASGILVPKTSIWPV-TSSLYLQPPTSVVSNAHKEGLEVFASDFTNDVPL  301

Query  1156  AFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISF  1335
             +++YSYDP+ EYL+FIDNG +SVDGVLSDFPITPS AIDC++H       +    L+IS 
Sbjct  302   SYNYSYDPIKEYLNFIDNGVFSVDGVLSDFPITPSEAIDCFAHANMNSSGKANP-LIISH  360

Query  1336  DGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +GASGDYPG TD AY +A   G D+IDC+
Sbjct  361   NGASGDYPGSTDLAYMEARDAGADVIDCS  389


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 152/358 (42%), Gaps = 52/358 (15%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A  + NS+ K        PL+I+  G SG +P S+  AY  A        ++ C VQ+T+
Sbjct  343   AHANMNSSGKAN------PLIISHNGASGDYPGSTDLAYMEARDAGAD--VIDCSVQMTQ  394

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN-------  648
             DG+ IC   I L + +NVA    + ++T +     T   F  +  ++++  +        
Sbjct  395   DGIPICSGSINLIDTTNVAQSKFNTRTTNIPQIQSTPGIFTFNLTWEEIKKLKPVISNPF  454

Query  649   LQQGVYSRS-SRFDGTPQQILTVED--VFNKVQPPGLWLNVQHDSFYSQHNLSMRTF---  810
             L  G++     + DG   Q  +++D   F K     + ++++H + Y   NL        
Sbjct  455   LDYGLFRNPVHKNDG---QFFSLDDFMAFAKGNSLPVLISIEHAA-YLVENLGFNVIDAV  510

Query  811   VLSVSRRVVIN-----YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGS  975
             V+++++    N      I S   + L     + N ++   V  F+ + +           
Sbjct  511   VVALNKSGYNNENQKVMIQSTNSSVLMKFMEKTNYKLVYSVDEFISDIDDSA--------  562

Query  976   LLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VP  1152
                 +  IK FA  + + KS ++PV++  +++   T +V       L  Y   F ++ V 
Sbjct  563   ----IKDIKRFAHSVAITKSNVFPVNQ--AFITGMTKVVSKLQAFNLTAYVYLFRNEFVS  616

Query  1153  FAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMR-KGQKNQVPEFL  1323
              A+D   DP  E  +F+  G   +DG++SDFP    G    Y   R  G    +P ++
Sbjct  617   QAWDVFSDPTVEINTFVTLG--KIDGIISDFP----GTAAAYRKNRCLGMGKNIPIYM  668



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   501 bits (1290),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 242/371 (65%), Positives = 299/371 (81%), Gaps = 7/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25    SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSAAFQFAPLTSLPDVVLWCDVQLT  81

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF +DF   +L+LV+L QG+Y
Sbjct  82    KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWFTVDFTLNELSLVSLTQGIY  141

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS RFD +   I TVEDV N ++PPGLWLN+QHD+F+ QHNLSMR+++LS+SRRVVIN+
Sbjct  142   SRSERFDNS-YPIQTVEDVAN-LKPPGLWLNIQHDAFFKQHNLSMRSYILSLSRRVVINH  199

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             +SSPE  FL+SI  R N  +TKLVFRFL  +  EPSTN+TYGSL +N   IKTFASGIL+
Sbjct  200   LSSPEAGFLRSIVKRFNLNITKLVFRFLEPNVIEPSTNETYGSLSRNFTFIKTFASGILI  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PKSYIWP+D +S+YL P TS+VLDAHK GLEV+ SDF +DVP +++YSYDPV EYLSF+D
Sbjct  260   PKSYIWPLD-ASNYLLPHTSIVLDAHKAGLEVFVSDFYNDVPLSYNYSYDPVTEYLSFVD  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NG++SVDGVLSDFP+TPS  I C+S + K    QV + LVIS +GASGDYPGCTD AY K
Sbjct  319   NGDFSVDGVLSDFPVTPSATIGCFSGLGKNATPQV-KILVISKNGASGDYPGCTDLAYQK  377

Query  1387  AVSDGVDIIDC  1419
             A+ DG D+IDC
Sbjct  378   AILDGADVIDC  388



>ref|XP_008364336.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=549

 Score =   494 bits (1271),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 239/372 (64%), Positives = 292/372 (78%), Gaps = 6/372 (2%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             V+AQGS    SKW+TLSGD P VIARGGFSGLFP  S  A+S A +TS+ + ++WCDVQL
Sbjct  21    VSAQGS----SKWKTLSGDPPKVIARGGFSGLFPGYSSAAFSLALITSVQDAVLWCDVQL  76

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  663
             TKD  GICFPD+ L+N SN+  +   K  +YLVNGVPT  WF +D+    L  + + QG+
Sbjct  77    TKDXAGICFPDLLLNNNSNIDMVLPKKDKSYLVNGVPTKGWFTVDYTLDDLASIYVTQGI  136

Query  664   YSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVIN  843
             YSR++RFDG    IL +EDV  +++PP LWLN+QHD F+SQHNLSMR +VLSVS++VVIN
Sbjct  137   YSRTNRFDGNLYPILLIEDVATQIKPPSLWLNIQHDIFFSQHNLSMRNYVLSVSKQVVIN  196

Query  844   YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGIL  1023
             YISSPEV FL SI +R++P  TKLVFRFLG DETEPSTNQTYGSLL+NL  IKTFASGIL
Sbjct  197   YISSPEVAFLNSIKARVSPSATKLVFRFLGQDETEPSTNQTYGSLLKNLTFIKTFASGIL  256

Query  1024  VPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFI  1203
             +PK+YIWPV K  +YL+P TS+V DAHK GL V+ASDF +DVP A++YSYDPV+EYL FI
Sbjct  257   IPKTYIWPVTK-DNYLEPHTSVVTDAHKEGLTVFASDFVNDVPLAYNYSYDPVSEYLQFI  315

Query  1204  DNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYS  1383
             DNG++SVDGVLSDFPITPS AIDC++H+      Q    LVIS  GASGD P CTDXAY 
Sbjct  316   DNGDFSVDGVLSDFPITPSEAIDCFAHLGSNASGQAKP-LVISKHGASGDLPSCTDXAYE  374

Query  1384  KAVSDGVDIIDC  1419
             KA+++GVD++DC
Sbjct  375   KAIANGVDVLDC  386



>ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
 gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
Length=495

 Score =   491 bits (1263),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 238/371 (64%), Positives = 293/371 (79%), Gaps = 7/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25    SAQGSA---STWQTLTGNRPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDGVGIC PD++LDN++++A + K+K   YLVNG+PT  WF +DF   +L+LV L QG+Y
Sbjct  82    KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGIPTRGWFTVDFTLNELSLVFLAQGIY  141

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS RFD T   I TVEDV N ++PPGLWLN+QHD+F++QHNLSMR +VLS+SRRVVIN+
Sbjct  142   SRSERFDNT-YPIQTVEDVAN-LKPPGLWLNIQHDAFFTQHNLSMRIYVLSLSRRVVINH  199

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             +SSPE  FL+SI  R N  +TKLVFRFL  +  EPSTN+TYGSL +N   IKTFASGIL+
Sbjct  200   LSSPEAGFLRSIVKRFNLNITKLVFRFLEPNVIEPSTNETYGSLSKNFTFIKTFASGILI  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PKSYIWP+D +S+YLQP TS+V DAHK GLEV+ S+F +DVP +++YSYDPV EYL F+D
Sbjct  260   PKSYIWPLD-ASNYLQPQTSIVSDAHKAGLEVFVSEFYNDVPLSYNYSYDPVTEYLRFVD  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NG +SVDG+LSDFP+TPS  I C+  + K    QV    VIS +GASGDYPGCTD AY K
Sbjct  319   NGEFSVDGMLSDFPVTPSATIACFHGLGKNDTPQV-NLSVISKNGASGDYPGCTDLAYQK  377

Query  1387  AVSDGVDIIDC  1419
             A+ DG D+IDC
Sbjct  378   AILDGADVIDC  388



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   496 bits (1277),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 240/381 (63%), Positives = 294/381 (77%), Gaps = 6/381 (2%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  456
             LLL S V LV+AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A++ A LTSL +
Sbjct  12    LLLHSVVALVSAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFNLALLTSLQD  67

Query  457   VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  636
              ++WCDVQLTKDG GICFPD+ L+N SN+  +   +  +YLVNGVPT  WF +DF    L
Sbjct  68    AVLWCDVQLTKDGAGICFPDLLLNNNSNIDMVLPKRDKSYLVNGVPTKGWFTVDFTLDDL  127

Query  637   TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVL  816
               V++ QG+YSR++RFDG    IL +EDV  + +PPGLWLN+QHD F+SQHNLSMR +VL
Sbjct  128   ASVSVTQGIYSRTNRFDGNQYPILLIEDVATQFKPPGLWLNIQHDIFFSQHNLSMRKYVL  187

Query  817   SVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLAS  996
             SVS++VVINYISSPEV FL SI +R++P  TKLVFRFLG DETEPSTNQTYGSLL+NL  
Sbjct  188   SVSKQVVINYISSPEVAFLNSIKARVSPSATKLVFRFLGQDETEPSTNQTYGSLLKNLTF  247

Query  997   IKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYD  1176
             IKTFASGIL+PK YIWP  K  +YL+P T +V DAHK GL V+ASDF +D P A++YSYD
Sbjct  248   IKTFASGILIPKIYIWPFTK-DNYLEPHTPVVTDAHKEGLTVFASDFVNDYPLAYNYSYD  306

Query  1177  PVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDY  1356
             PV+EYL FIDN ++SVDGVLSDFP+T S AIDC++H+      Q  + LVIS  GASGD 
Sbjct  307   PVSEYLQFIDNVDFSVDGVLSDFPMTASEAIDCFAHLGSNASRQA-KPLVISKYGASGDL  365

Query  1357  PGCTDXAYSKAVSDGVDIIDC  1419
             P CTD AY +A+++GVD++DC
Sbjct  366   PSCTDLAYERAIANGVDVLDC  386



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   496 bits (1277),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 247/392 (63%), Positives = 308/392 (79%), Gaps = 7/392 (2%)
 Frame = +1

Query  247   MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M  LR+ +   LLL S V LV+AQ S    S+W+TLSGD P V+ARGGFSGLFP  +  A
Sbjct  1     MCNLRALVVAALLLHSVVALVSAQRS----SQWKTLSGDPPKVVARGGFSGLFPGFTSAA  56

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
             ++FA +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57    FNFALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  604   WFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             WF +D+ +  L  +++ QG+YSR++RFDG    IL VEDV  + +PPGLWLN+QHD F+S
Sbjct  117   WFTVDYTWDGLVNISVTQGIYSRANRFDGNMYPILLVEDVATQFKPPGLWLNIQHDIFFS  176

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSMR++VLSVSR+VV++YISSPEV FL SI SR++P VTKLVFRFL  DETEPSTNQ
Sbjct  177   QHNLSMRSYVLSVSRQVVVSYISSPEVAFLNSIKSRVSPSVTKLVFRFLAQDETEPSTNQ  236

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ASDF +
Sbjct  237   TYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFASDFVN  295

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AIDC++H+      Q    L
Sbjct  296   DVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIDCFAHLASNASGQAKP-L  354

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             VIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  355   VISKYGASGDFPSCTDLAYTKAIADGVDVLDC  386


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 82/339 (24%), Positives = 155/339 (46%), Gaps = 33/339 (10%)
 Frame = +1

Query  352   SGDA-PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
             SG A PLVI++ G SG FP  +  AY+ A    +   ++ C VQ++KDG+  C   I L 
Sbjct  348   SGQAKPLVISKYGASGDFPSCTDLAYTKAIADGVD--VLDCPVQISKDGIPFCASSINLI  405

Query  529   NASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-----TLVNLQQG-VYSRSSRFDG  690
             +++ VA       +T++      +  +     +K +     T+ N        R+ RF  
Sbjct  406   DSTTVAQSGFSNLTTFVPEIKAGSGIYTFSLAWKDIEGLTPTISNPSSNYALFRNPRFK-  464

Query  691   TPQQILTVEDVFNKVQP----PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSP  858
             T  + LT+ D     +      G+ + +++ ++ ++         LSV+   V+N +S  
Sbjct  465   TGGKYLTLSDFLALAKKSSSLSGVLIGIEYAAYLAEEQR------LSVT-DAVMNTLSKA  517

Query  859   EVNFLKSIASRINPRVTKLVFRFLGNDETEP--STNQTYGSLLQN-LASIKTFASGILVP  1029
               +   ++  +I    + ++ +F      E      +  G  L + +  IK FA  ++V 
Sbjct  518   GFDNKTALNVKIQSTNSSVLMKFKEKTSYELVYKIEENIGDTLSSTVEDIKKFADSVVVN  577

Query  1030  KSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFID  1206
             K+ I+P  +S +++   T +V       L VY   F+++ V  A+D+  DP  E  SF+ 
Sbjct  578   KASIFP--ESEAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTVEINSFVS  635

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
               N  +DGV++DFP T +     Y      ++ ++P ++
Sbjct  636   GAN--IDGVITDFPKTAAR----YKKNLCLRQKEIPSYM  668



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   496 bits (1276),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/371 (65%), Positives = 295/371 (80%), Gaps = 7/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS    S WQTL+G+ PLVIARGGFSGLFPDSS  A+ FA LTSL +V++WCDVQLT
Sbjct  25    SAQGSA---STWQTLTGNPPLVIARGGFSGLFPDSSSVAFQFATLTSLPDVVLWCDVQLT  81

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDGVGIC PD++LDN++++A + K+K   YLVNGVPT  WF +DF   +L+LV L QG+Y
Sbjct  82    KDGVGICAPDLRLDNSTSIAQVMKNKDKLYLVNGVPTRGWFTVDFTLNELSLVFLTQGIY  141

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS RFD +   I TVEDV N ++PPGLWLN+QHD+F+ QHNLSMR+++LS+S+RVVIN+
Sbjct  142   SRSERFDNS-YPIQTVEDVAN-LKPPGLWLNIQHDAFFKQHNLSMRSYILSLSKRVVINH  199

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             +SSPE  FL+ I  R N  VTKLVFRFL  +  EPSTN+TYGSL  N   IKTFASGIL+
Sbjct  200   LSSPEAGFLRGIVKRFNLNVTKLVFRFLEPNVIEPSTNETYGSLSTNFTFIKTFASGILI  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
              KSYIWP+D +S+YLQP TS+V DAHK GLEV+ SDF +DVP +++YSYDPV EYL F+D
Sbjct  260   QKSYIWPLD-ASNYLQPHTSIVSDAHKAGLEVFVSDFYNDVPLSYNYSYDPVTEYLGFVD  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NG++SVDGVLSDFP+TPS  IDC+S + K    QV E LVIS +GASGDYPGCTD AY K
Sbjct  319   NGDFSVDGVLSDFPVTPSATIDCFSGLGKNATPQV-ELLVISKNGASGDYPGCTDLAYQK  377

Query  1387  AVSDGVDIIDC  1419
             A+ DG D+IDC
Sbjct  378   AILDGADVIDC  388



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   493 bits (1269),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 243/384 (63%), Positives = 305/384 (79%), Gaps = 8/384 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             LL +  +V LV A  S NS+S W TL+G+APLVIARGGF G+FPDSSF +Y  A  TSL+
Sbjct  9     LLFVLHSVGLVVA--SRNSSS-WLTLTGNAPLVIARGGFPGIFPDSSFASYQLALNTSLS  65

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NVI+WCDVQLTKDG GICFP+IKL+N+S+++++F++ +  YLVNG  T  WF +D+    
Sbjct  66    NVILWCDVQLTKDGAGICFPNIKLENSSDISSVFRNSR-IYLVNGQSTRGWFSVDYTLDD  124

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
             L  V L QG+Y R+++FDG    ILTVEDV  K++PPGLWLN+Q+D+FY QH LSMR+++
Sbjct  125   LKSVYLMQGIYYRTNKFDGNRYNILTVEDVAIKLKPPGLWLNIQYDAFYRQHKLSMRSYI  184

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
             LS SRR VINYISSPEV FL +IA R     TKL+FRFLG+DE EPSTNQTYGSLL+NL 
Sbjct  185   LSASRRFVINYISSPEVAFLSTIAERFKGSKTKLIFRFLGSDEIEPSTNQTYGSLLKNLK  244

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              IK FASGILVPK+YIWPV+ ++ YLQ  TS+V DAH+ GLEV+ASDFA+DV F+++YSY
Sbjct  245   FIKKFASGILVPKNYIWPVN-TALYLQHHTSIVSDAHREGLEVFASDFANDVVFSYNYSY  303

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-RKGQKNQVPEFLVISFDGASG  1350
             +P+AEYLSFIDNG++SVDGVLSDFP+TPS AIDC+SH+  K     +P  +VIS +GASG
Sbjct  304   NPLAEYLSFIDNGDFSVDGVLSDFPVTPSAAIDCFSHISNKSSGKAMP--IVISHNGASG  361

Query  1351  DYPGCTDXAYSKAVSDGVDIIDCT  1422
              YPGCTD AY +AV DG D+IDC+
Sbjct  362   VYPGCTDLAYKQAVEDGADVIDCS  385


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 149/326 (46%), Gaps = 50/326 (15%)
 Frame = +1

Query  352   SGDA-PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
             SG A P+VI+  G SG++P  +  AY  A +    +VI  C VQ+TKDG+ IC   I L 
Sbjct  346   SGKAMPIVISHNGASGVYPGCTDLAYKQA-VEDGADVID-CSVQMTKDGIPICLGSIDLL  403

Query  529   NASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN------------LQQGVYSR  672
               + VA    + +S+ +     T   F     +K++  +              +   Y  
Sbjct  404   YGTTVAQSQFNSRSSNIPEIQETPGIFTFSLTWKEIQSLKPAIRNPFMDYNLFRNPAYKN  463

Query  673   SSRFDGTPQQILTVED--VFNKVQP-PGLWLNVQHDSFYSQH-NLSMRTFVLSVSRRVVI  840
             +  F       L+++D   F K +   G+ +++++ ++  ++  LS+   V+   ++   
Sbjct  464   AGSF-------LSLDDFLAFAKSKSLSGVLISIENAAYIVENLGLSVIDAVVDALKKSGH  516

Query  841   N-------YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             N        I S   + L     + N    +LV++    DE     ++       ++  I
Sbjct  517   NNQTNQKIMIQSTNSSVLIKFKEKTN---YQLVYKI---DEVIRDADKA------SIMDI  564

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYD  1176
             K FA  +++ KS I+P++  S++L   T +V   H   L VY S F ++ V  A+D+  D
Sbjct  565   KQFAHSLVIRKSSIFPLN--SAFLTGVTKIVSKLHSFNLTVYTSVFRNEFVSSAWDFYSD  622

Query  1177  PVAEYLSFIDNGNYSVDGVLSDFPIT  1254
             PV E  SF+      +DGV++DFP T
Sbjct  623   PVVEINSFVMGAG--IDGVITDFPGT  646



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   493 bits (1270),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 246/392 (63%), Positives = 306/392 (78%), Gaps = 7/392 (2%)
 Frame = +1

Query  247   MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1     MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
             ++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57    FNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  604   WFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             WF +D+ +  L  +++ QG+YSR++RFDG    IL VEDV  + +PPGLWLN+QHD F+S
Sbjct  117   WFTVDYTWDGLVNISVTQGIYSRTNRFDGNLYPILLVEDVVTQFKPPGLWLNIQHDIFFS  176

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVFRFLG D TEPSTNQ
Sbjct  177   QHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVFRFLGQDXTEPSTNQ  236

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ SDF +
Sbjct  237   TYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFGSDFVN  295

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AI+C++H+      Q  + L
Sbjct  296   DVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIECFAHLASNASGQA-KPL  354

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             VIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  355   VISKYGASGDFPSCTDLAYTKAIADGVDVLDC  386


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 85/346 (25%), Positives = 159/346 (46%), Gaps = 47/346 (14%)
 Frame = +1

Query  352   SGDA-PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
             SG A PLVI++ G SG FP  +  AY+ A    +   ++ C VQ++KDG+  C   I L 
Sbjct  348   SGQAKPLVISKYGASGDFPSCTDLAYTKAIADGVD--VLDCPVQISKDGIPFCASSINLI  405

Query  529   NASNVATLFKDKQSTY--LVNGVP-----------TTAWFPIDFNFKQLTLVNLQQGVYS  669
             +++ VA      QS +  L   VP           + AW  I+     ++  + +  ++ 
Sbjct  406   DSTTVA------QSXFSNLTTVVPEIKAGSGIYTFSLAWKDIEGLTXTISNPSSKYALF-  458

Query  670   RSSRFDGTPQQILTVEDVFNKVQP----PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVV  837
             R+ RF  T  + LT+ D     +      G+ + +++ ++ ++         LSV+   V
Sbjct  459   RNPRFK-TGGKYLTLSDFLALAKKSSSLSGVLIGIEYAAYLAEEQR------LSVT-DAV  510

Query  838   INYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP--STNQTYGSLLQN-LASIKTF  1008
             +N +S    +   ++  +I    + ++ +F      E      +  G  L + +  IK F
Sbjct  511   MNTLSKAGFDNKTALNVKIQSTNSSVLMKFKEKTSYELVYKIEENIGDTLSSTIEDIKKF  570

Query  1009  ASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVA  1185
             A  +++ K+ I+P  +S +++   T +V       L VY   F+++ V  A+D+  DP  
Sbjct  571   ADSVVINKASIFP--ESEAFITGVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTV  628

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             E   F+   N  VDGV++DFP T +     Y      ++ ++P ++
Sbjct  629   EINLFVSGAN--VDGVITDFPKTAAR----YKKNPCLRQKEIPSYM  668



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   493 bits (1268),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/371 (65%), Positives = 291/371 (78%), Gaps = 16/371 (4%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS  S + WQTLSG APL IARGGFSGLFPDSS+ AYSFA +TSL  V++WCDVQLT
Sbjct  21    SAQGS-GSKTPWQTLSGGAPLAIARGGFSGLFPDSSYAAYSFAIMTSLPEVVLWCDVQLT  79

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KD  GIC PDIKLDN++++A +F ++   Y++NGV T  WF +DF   +L+ V + QG+Y
Sbjct  80    KDSKGICLPDIKLDNSTDIADVFNNRDKEYVINGVATKGWFSLDFTSSELSNVIVSQGIY  139

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS++FDG    ILT EDV  +++P GLWLNVQHD+F++QH L+MR++VL++S+ +++NY
Sbjct  140   SRSNKFDGNLFPILTAEDVSKQLKPAGLWLNVQHDAFFTQHKLNMRSYVLNISKHIIVNY  199

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPEV FL  I SR N + TKLVFRFLG DET+PSTNQTYGSLL+NL  IKTFASGILV
Sbjct  200   ISSPEVAFLNGIKSRFNQKTTKLVFRFLGKDETDPSTNQTYGSLLKNLTYIKTFASGILV  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK YIWPVD   SYLQP TSLV DAHK GLEV+ASDF +D P +F+YSYDPVAEYL+FID
Sbjct  260   PKIYIWPVDP-KSYLQPHTSLVSDAHKEGLEVFASDFVNDFPLSFNYSYDPVAEYLNFID  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NGN+SVDGVLSDFPITPS AI               + LVIS  GASGDY GCTD AY+K
Sbjct  319   NGNFSVDGVLSDFPITPSAAI--------------VKTLVISKYGASGDYTGCTDKAYTK  364

Query  1387  AVSDGVDIIDC  1419
             A+ DGVD++DC
Sbjct  365   AIEDGVDVLDC  375



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   493 bits (1270),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 245/386 (63%), Positives = 295/386 (76%), Gaps = 8/386 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ--GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             LLLC  V   L+AAQ     +  S WQTL+GDAPLVIARGGFSGL PDSS +AY  A  T
Sbjct  18    LLLCGVVLMQLLAAQVDAQRSGRSPWQTLTGDAPLVIARGGFSGLLPDSSIDAYGLALQT  77

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             S+++V++WCDVQLTKDGVGICFPD+ L NASN+  ++   QS+Y+VNGVPT  WF IDF 
Sbjct  78    SVSDVVLWCDVQLTKDGVGICFPDVNLRNASNIDVVYPKGQSSYIVNGVPTQGWFSIDFT  137

Query  625   FKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
              K L  V L +G+ SR + FD +   + TVEDV   V+PPG WLN+QH +FY+QHNLSMR
Sbjct  138   LKDLGDVALIRGILSRPNAFD-SKYSVQTVEDVAKTVKPPGFWLNIQHGAFYAQHNLSMR  196

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +FVLS+S+ VVI++ISSPEVNFL+SIA R   +  + VF+FLG ++ EPSTNQTYGSLL 
Sbjct  197   SFVLSISKSVVIDFISSPEVNFLRSIAGRFGRKGPRFVFQFLGQEDVEPSTNQTYGSLLH  256

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  IKTFASGI+VPK YIWPV  SS YL P TSLV DAHK GLEVYAS FA+D   A++
Sbjct  257   NLTFIKTFASGIIVPKIYIWPV--SSLYLLPPTSLVQDAHKAGLEVYASGFANDFDMAYN  314

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DPVAEYLSF+DNGN SVDGVLSDFPIT S A+DC+SH+ +    Q  +FLVIS DGA
Sbjct  315   YSFDPVAEYLSFMDNGNLSVDGVLSDFPITASEAVDCFSHLDRNAPKQA-DFLVISKDGA  373

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SGD P CT+ AY KA+ DG D+IDC+
Sbjct  374   SGDLPSCTNVAYDKAIKDGADVIDCS  399



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   489 bits (1260),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 247/385 (64%), Positives = 293/385 (76%), Gaps = 7/385 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+AAQ  +  S S WQTL+GDAPLVIARGGFSG+ PDSS +AY  A   S
Sbjct  9     LLLCGVVLIQLLAAQVDAQRSRSPWQTLAGDAPLVIARGGFSGVLPDSSVDAYGLAVQVS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +T+V++WCDVQLTKDG+GICFPD+ L NASN+  ++  +Q++YLVNGVPT  WF IDF  
Sbjct  69    VTDVVLWCDVQLTKDGIGICFPDVNLGNASNIGDVYPKQQNSYLVNGVPTQGWFSIDFTL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  V L +G+ SR   FD     I TVE++   V+PP  WLN+QHD+FY QHNLSMR+
Sbjct  129   KDLAKVALIRGILSRPEAFD-YKYSIQTVENIATTVKPPLFWLNIQHDAFYGQHNLSMRS  187

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             FVLSVSR V+I+YISSPEV+FL+SIA        K VFRFLG DE EPSTNQTYGSLL+N
Sbjct  188   FVLSVSRNVIIDYISSPEVSFLRSIAGSFRRNGPKFVFRFLGQDEVEPSTNQTYGSLLRN  247

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  IKTFASGILVPK+YI PV+  + YL   TSLV DAHK GLE+YAS FA+D   A++Y
Sbjct  248   LTFIKTFASGILVPKNYILPVN--NLYLLQPTSLVQDAHKAGLEIYASGFANDFDMAYNY  305

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPVAEYLSF+DNGN+SVDGVLSDFPIT S AI C+SH+ K    QV +FLVIS +GAS
Sbjct  306   SFDPVAEYLSFVDNGNFSVDGVLSDFPITASEAIGCFSHLGKNATKQV-DFLVISKNGAS  364

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPG TD AY KA+ DG DIIDC+
Sbjct  365   GDYPGSTDLAYDKAIKDGADIIDCS  389



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   490 bits (1261),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 234/375 (62%), Positives = 291/375 (78%), Gaps = 6/375 (2%)
 Frame = +1

Query  298   TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDV  477
             T +AAQ    S S WQTLSGDAPL+IARGGFSGL PDSS +AYSF  +TS+ + ++WCDV
Sbjct  31    TQLAAQ---RSKSPWQTLSGDAPLIIARGGFSGLLPDSSLDAYSFVSMTSVPDAVLWCDV  87

Query  478   QLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQ  657
             QLTKDGVGICFPD+K+ NASN+   + D++++YL+NGVPT  WF IDF FK L  V L +
Sbjct  88    QLTKDGVGICFPDVKMMNASNIQVAYPDRKNSYLLNGVPTQDWFTIDFTFKDLKTVFLMR  147

Query  658   GVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVV  837
             G+ SRS  FD     I TV+++  +++P G WLNVQHD+FY+QHNLSM +F+L+VS+ V 
Sbjct  148   GILSRSDAFDNNQYAISTVQNIATRLKPAGFWLNVQHDAFYAQHNLSMSSFLLTVSKTVF  207

Query  838   INYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASG  1017
             I+Y+SSPEVNF ++I  R      K VFRFL  D+ E STNQTYGSL+ NL  IKTFASG
Sbjct  208   IDYLSSPEVNFFRNIGGRFGKNGPKFVFRFLEKDDIEVSTNQTYGSLIGNLTFIKTFASG  267

Query  1018  ILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLS  1197
             +LVPKSYIWP++  S YL+P TS V DAHK GLEVYAS FA+D   A++YS+DP+AEYLS
Sbjct  268   VLVPKSYIWPLE--SKYLRPHTSFVQDAHKAGLEVYASGFANDFDLAYNYSFDPLAEYLS  325

Query  1198  FIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXA  1377
             F+DNG++SVDGVLSDFP+T S A+DC+SH+      QV +FLVIS +GASGDYPGCTD A
Sbjct  326   FMDNGDFSVDGVLSDFPLTASSAVDCFSHLGTNASTQV-DFLVISKNGASGDYPGCTDLA  384

Query  1378  YSKAVSDGVDIIDCT  1422
             YSKA+ DG DIIDC+
Sbjct  385   YSKAIKDGADIIDCS  399



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   488 bits (1256),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 294/371 (79%), Gaps = 7/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS  +   WQTL+G+ PLVIARGGFSGLFPDSS +A+ FA LTSL  V++WCDVQLT
Sbjct  25    SAQGSATT---WQTLTGNPPLVIARGGFSGLFPDSSSDAFQFATLTSLPGVVLWCDVQLT  81

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KD VGIC PD++LDN++++A + ++K   YLVNG+PT  WF +DF   +L+LV+L QG++
Sbjct  82    KDSVGICAPDLRLDNSTSIAQVMQNKDKLYLVNGIPTRGWFTVDFTLNELSLVSLNQGIF  141

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS RFD     I TVEDV   ++PPGLWLN+QHD+F++QHNLSMR++VLS+ RRVVIN+
Sbjct  142   SRSERFDYI-YPIQTVEDV-ATLKPPGLWLNIQHDAFFTQHNLSMRSYVLSLYRRVVINH  199

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             +SSPE  FL+SI  R N  +TKLVFRFL ++  EPSTN+TYGSL +N   IKTFASGIL+
Sbjct  200   LSSPEAGFLRSIVKRFNLNITKLVFRFLESNVIEPSTNETYGSLSKNFTFIKTFASGILI  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PKSYIWP+D +S+YLQP TS+V DAHK GLEV+ S+F +DVP +++YSYDPV EYL F+D
Sbjct  260   PKSYIWPLD-ASNYLQPHTSIVSDAHKAGLEVFVSEFYNDVPLSYNYSYDPVTEYLRFVD  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NG +SVDGVLSDFP+TPS  IDC+S + K    QV    VIS +GASGDYPGCTD AY K
Sbjct  319   NGEFSVDGVLSDFPVTPSATIDCFSGLGKNATPQV-NLSVISKNGASGDYPGCTDLAYQK  377

Query  1387  AVSDGVDIIDC  1419
             A+ DG D+IDC
Sbjct  378   AILDGADVIDC  388



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   487 bits (1253),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 287/371 (77%), Gaps = 6/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             +AQGS    SKW+TLSGD P V+ARGGFSGLFP  S  A+S A LTSL + ++WCDVQLT
Sbjct  22    SAQGS----SKWKTLSGDPPKVVARGGFSGLFPGYSSAAFSLALLTSLQDAVLWCDVQLT  77

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDG GICFPD+ L+N SN+  +   +  +YLVNGVPT  WF +DF    L  V++ QG+Y
Sbjct  78    KDGAGICFPDLLLNNNSNIDMVLPKRDKSYLVNGVPTKGWFTVDFTLDDLASVSVTQGIY  137

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SR++RFDG    IL +EDV  + +PPGLWLN+QHD F+SQHNLSMR +VLSVS++VVINY
Sbjct  138   SRTNRFDGNQYPILLIEDVATQFKPPGLWLNIQHDIFFSQHNLSMRKYVLSVSKQVVINY  197

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPEV FL SI +R++P  TKLVFRFLG DETEPSTNQTYGSLL+NL  IKTFASGIL+
Sbjct  198   ISSPEVAFLNSIKARVSPSATKLVFRFLGQDETEPSTNQTYGSLLKNLTFIKTFASGILI  257

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK YIWP  K  +YL+P T +V DAHK GL V+ASDF +D P A++YSYDPV+EYL FID
Sbjct  258   PKIYIWPFTK-DNYLEPHTPVVTDAHKEGLTVFASDFVNDYPLAYNYSYDPVSEYLQFID  316

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             N ++SVDGVLSDFP+T S AIDC++H+      Q  + LVIS  GASGD P CTD AY +
Sbjct  317   NVDFSVDGVLSDFPMTASEAIDCFAHLGSNASRQA-KPLVISKYGASGDLPSCTDLAYER  375

Query  1387  AVSDGVDIIDC  1419
             A+++GVD++DC
Sbjct  376   AIANGVDVLDC  386



>ref|XP_008349893.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3 [Malus domestica]
Length=448

 Score =   476 bits (1225),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 301/393 (77%), Gaps = 8/393 (2%)
 Frame = +1

Query  247   MWKLRS-IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M  LR+ +   LLL S   LV+AQ S    S+W+TLSGDAP V+ARGGFSGLFP  S  A
Sbjct  1     MCNLRALVVAALLLHSVXALVSAQRS----SQWKTLSGDAPKVVARGGFSGLFPGFSSAA  56

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
             ++ A +TS+ +VI+WCDVQLTKDG GICFPD+ L+N SN+  +   K+ TYLVNGV T  
Sbjct  57    FNLALITSVPDVILWCDVQLTKDGAGICFPDLLLNNNSNINEVLPQKEKTYLVNGVSTKG  116

Query  604   WFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             WF +D+ +  L  +++ QG+YSR++RFDG    IL VED F + +PPGLWLN+QHD F+S
Sbjct  117   WFTVDYTWDGLVNISVTQGIYSRTNRFDGNLYPILLVEDXFTQFKPPGLWLNIQHDIFFS  176

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVFRFLG D TEPST  
Sbjct  177   QHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVFRFLGQDXTEPSTXX  236

Query  964   TY-GSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
                GSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ SDF 
Sbjct  237   NXNGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFGSDFV  295

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AI+C++H+      Q    
Sbjct  296   NDVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIECFAHLASNASGQAKP-  354

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             LVIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  355   LVISKYGASGDFPSCTDLAYTKAIADGVDVLDC  387



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   486 bits (1252),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 238/392 (61%), Positives = 302/392 (77%), Gaps = 8/392 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW  R++  +LLL S + +V+AQ      S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1     MWNPRALSAVLLLHSLIAIVSAQ-----ISAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  55

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             S A +T+  +V + CDVQLTKD VGIC PDI L N++ +A+ + ++ ++YLVNGVP   +
Sbjct  56    SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIASRYPNETTSYLVNGVPIRGY  115

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYS  783
             F +D+  KQL  V L QGVYSR++RFDG   QILTV+ +    Q P G+WLN+QHD+FY+
Sbjct  116   FSLDYTMKQLNSVFLTQGVYSRTNRFDGVGFQILTVDGLVTLNQKPKGIWLNIQHDTFYA  175

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSMR+FV+S S+R++ +YISSPEVNFL+ I+SR+N + TKLVFRF+  DE EPS NQ
Sbjct  176   QHNLSMRSFVISASKRIIFSYISSPEVNFLRGISSRLNLKTTKLVFRFMDKDELEPSINQ  235

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYGSLL+NL  IKTFASGILVPK YIWPVD  S YLQP TSLV DAHKVGLEV+ SDF +
Sbjct  236   TYGSLLKNLTFIKTFASGILVPKGYIWPVD-GSLYLQPHTSLVSDAHKVGLEVFGSDFVN  294

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             DVP +F+YSYDP+ EYL FIDNG++SVDGVLSDFP+TP  AI C+SH+      Q  + L
Sbjct  295   DVPSSFNYSYDPLTEYLQFIDNGDFSVDGVLSDFPVTPFEAIGCFSHLGTNATKQ-DKTL  353

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             +IS  GASGDYP CT+ AY KA++DGVD++DC
Sbjct  354   IISKYGASGDYPACTNLAYDKAIADGVDVLDC  385



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   486 bits (1252),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 295/384 (77%), Gaps = 4/384 (1%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             L L    + L++ Q  +  S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   TS+
Sbjct  19    LFLALILIQLLSTQLFAQRSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQTSV  78

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
                ++WCDVQLTKD +G+CFPD+K+ NASN+  ++  ++++YL+NGVPT  WF IDFNFK
Sbjct  79    PGAVLWCDVQLTKDAIGLCFPDVKMMNASNIQDVYPKRKTSYLLNGVPTQDWFTIDFNFK  138

Query  631   QLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTF  810
              LT V L+QG+ SRS+ FDG    I TV+D+  +++P G WLNVQHD+FY+QHNLSM +F
Sbjct  139   DLTKVILKQGILSRSAAFDGNSYGISTVKDISTQLKPEGFWLNVQHDAFYAQHNLSMSSF  198

Query  811   VLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNL  990
             +LS+S+ V+I+Y+SSPEVNF ++I  R      K VFRFL  D+ E STNQTYGSL  NL
Sbjct  199   LLSISKTVIIDYLSSPEVNFFRNIGRRFGRNGPKFVFRFLEKDDVEVSTNQTYGSLAGNL  258

Query  991   ASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYS  1170
               +KTFASG+LVPKSYIWP++  S YL P TS V DAHK GLEVYAS F +D   A++YS
Sbjct  259   TFLKTFASGVLVPKSYIWPIE--SQYLLPRTSFVQDAHKAGLEVYASGFGNDFDLAYNYS  316

Query  1171  YDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASG  1350
             +DP+AEYLSF+DNG++SVDG+LSDFP+T S A+DC+SH+     +QV +FLVIS +GASG
Sbjct  317   FDPLAEYLSFMDNGDFSVDGLLSDFPLTASSAVDCFSHLGSNASSQV-DFLVISKNGASG  375

Query  1351  DYPGCTDXAYSKAVSDGVDIIDCT  1422
             DYPGCTD AY+KA+ DG D+IDC+
Sbjct  376   DYPGCTDLAYTKAIKDGADVIDCS  399



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   486 bits (1251),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 297/373 (80%), Gaps = 8/373 (2%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A +TS  +V +WCDVQL
Sbjct  23    ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  663
             TKDG+GIC PDI L N++ +A+ + +K ++YLVNGVPT  +FP+D+  K L+ V L QGV
Sbjct  78    TKDGLGICQPDINLANSTYIASAYPNKTTSYLVNGVPTRGYFPLDYTLKDLSSVVLTQGV  137

Query  664   YSRSSRFDGTPQQILTVEDVFN-KVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             YSRS+ FDG    ILTVED+   + +P G WLN+QHD+FY+QHNLSMR+FVLSVSR+VV 
Sbjct  138   YSRSNLFDGNNFGILTVEDLAKLRQKPKGKWLNIQHDAFYAQHNLSMRSFVLSVSRKVVF  197

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPEV FL+SIASR NP+ TKLVFRF+G  + +PSTN+TYGSLLQNL  IKTFASGI
Sbjct  198   SYISSPEVGFLRSIASRFNPKTTKLVFRFMGLSDVDPSTNRTYGSLLQNLTFIKTFASGI  257

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPVD ++ YLQ  TSLV DAHK GLEV+ASDF +DVPF+F+YSYDP+AEYL F
Sbjct  258   LVPKGYIWPVD-ATLYLQSHTSLVSDAHKAGLEVFASDFVNDVPFSFNYSYDPLAEYLQF  316

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             +DNG++SVDGVLSDFPITP  AI C++H+      +  + LVIS  GASGDYP CTD AY
Sbjct  317   VDNGDFSVDGVLSDFPITPFEAIGCFAHLATNATKK-DKTLVISKYGASGDYPACTDLAY  375

Query  1381  SKAVSDGVDIIDC  1419
             +KA+SDGVD++DC
Sbjct  376   NKAISDGVDVLDC  388



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   485 bits (1249),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 297/373 (80%), Gaps = 8/373 (2%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             ++AQ ST     W TLSG APLV+ARGGFSG+ PDSS  +Y+ A +TS  +V +WCDVQL
Sbjct  23    ISAQRST-----WNTLSGGAPLVVARGGFSGMLPDSSDASYNLAVITSGPDVYIWCDVQL  77

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  663
             TKDG+GIC PDI L N++ +A+ + +K ++YLVNGVPT  +FP+D+  K L+ V L QGV
Sbjct  78    TKDGLGICQPDINLANSTYIASAYPNKTTSYLVNGVPTRGYFPLDYTLKDLSSVVLTQGV  137

Query  664   YSRSSRFDGTPQQILTVEDVFN-KVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             YSRS+ FDG    ILTVED+   + +P G WLN+QHD+FY+QHNLSMR+FVLSVSR+VV 
Sbjct  138   YSRSNLFDGNNFGILTVEDLAKLRQKPKGKWLNIQHDAFYAQHNLSMRSFVLSVSRKVVF  197

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPEV FL+SIASR NP+ TKLVFRF+G  + +PSTN+TYGSLLQNL  IKTFASGI
Sbjct  198   SYISSPEVGFLRSIASRFNPKTTKLVFRFMGLSDVDPSTNRTYGSLLQNLTFIKTFASGI  257

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPVD ++ YLQ  TSLV DAHK GLEV+ASDF +DVPF+F+YSYDP+AEYL F
Sbjct  258   LVPKGYIWPVD-ATLYLQSHTSLVSDAHKAGLEVFASDFVNDVPFSFNYSYDPLAEYLQF  316

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             +DNG++SVDGVLSDFPITP  AI C++H+      +  + LVIS  GASGDYP CTD AY
Sbjct  317   VDNGDFSVDGVLSDFPITPFEAIGCFAHLGTNATKK-DKTLVISKYGASGDYPACTDLAY  375

Query  1381  SKAVSDGVDIIDC  1419
             +KA+SDGVD++DC
Sbjct  376   NKAISDGVDVLDC  388



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   484 bits (1247),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 233/387 (60%), Positives = 295/387 (76%), Gaps = 7/387 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  441
             LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  10    LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  442   TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  621
             TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF IDF
Sbjct  70    TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDF  129

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
             + K L  VNL +G+ SRS +FDG    I+TV+ V  +++P   WLNVQHD+FY+QHNLSM
Sbjct  130   SLKDLKDVNLIRGILSRSEKFDGNSNPIMTVQSVSTQMKPSFFWLNVQHDAFYAQHNLSM  189

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
              +F+++ S+ V+I++ISSPEVNF K IA R       LVFRFLG DE EP+TN+TYGS+L
Sbjct  190   SSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVFRFLGQDEFEPTTNRTYGSIL  249

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S FA+D+  A 
Sbjct  250   SNLTFVKTFASGILVPKSYILPLD-DQQYLLPHTSLVQDAHKAGLEVFVSGFANDIDIAH  308

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SH+ +    QV +FLVI+ DG
Sbjct  309   DYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASLDCFSHVGRNATKQV-DFLVITKDG  367

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  368   ASGDYPGCTDLAYKKAIKDGADVIDCS  394



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   484 bits (1247),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 233/387 (60%), Positives = 295/387 (76%), Gaps = 7/387 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  441
             LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  10    LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  69

Query  442   TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  621
             TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF IDF
Sbjct  70    TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDF  129

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
             + K L  VNL +G+ SRS +FDG    I+TV+ V  +++P   WLNVQHD+FY+QHNLSM
Sbjct  130   SLKDLKDVNLIRGILSRSKKFDGNSNPIMTVQSVSTQMKPSFFWLNVQHDAFYAQHNLSM  189

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
              +F+++ S+ V+I++ISSPEVNF K IA R       LVFRFLG DE EP+TN+TYGS+L
Sbjct  190   SSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVFRFLGQDEFEPTTNRTYGSIL  249

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S FA+D+  A 
Sbjct  250   SNLTFVKTFASGILVPKSYILPLD-DQQYLLPHTSLVQDAHKAGLEVFVSGFANDIDIAH  308

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SH+ +    QV +FLVI+ DG
Sbjct  309   DYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASLDCFSHVGRNATKQV-DFLVITKDG  367

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  368   ASGDYPGCTDLAYKKAIKDGADVIDCS  394



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   484 bits (1247),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 233/387 (60%), Positives = 295/387 (76%), Gaps = 7/387 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  441
             LLLC  +   L+AAQ    S    S W TL+GD PLVIARGGFSGLFPDSS++AY+FA L
Sbjct  21    LLLCGVILIQLLAAQIHAQSKKPKSPWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAIL  80

Query  442   TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  621
             TS+ + ++WCDVQLTKD +GICFPD+ + N+S++  ++  +Q +Y VNGVPT+ WF IDF
Sbjct  81    TSVPDAVLWCDVQLTKDALGICFPDLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDF  140

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
             + K L  VNL +G+ SRS +FDG    I+TV+ V  +++P   WLNVQHD+FY+QHNLSM
Sbjct  141   SLKDLKDVNLIRGILSRSEKFDGNSNPIMTVQSVSTQMKPSFFWLNVQHDAFYAQHNLSM  200

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
              +F+++ S+ V+I++ISSPEVNF K IA R       LVFRFLG DE EP+TN+TYGS+L
Sbjct  201   SSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVFRFLGQDEFEPTTNRTYGSIL  260

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S FA+D+  A 
Sbjct  261   SNLTFVKTFASGILVPKSYILPLD-DQQYLLPHTSLVQDAHKAGLEVFVSGFANDIDIAH  319

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SH+ +    QV +FLVI+ DG
Sbjct  320   DYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASLDCFSHVGRNATKQV-DFLVITKDG  378

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  379   ASGDYPGCTDLAYKKAIKDGADVIDCS  405



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   483 bits (1243),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 300/386 (78%), Gaps = 4/386 (1%)
 Frame = +1

Query  262   SIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL  441
             S+  +++        +AQ +T S S W TL+G  PLVIA+GGFSGLFPDSS NAY FA +
Sbjct  20    SLIVIIVFLQFFAFASAQQAT-SNSPWLTLNGSPPLVIAKGGFSGLFPDSSANAYQFATM  78

Query  442   TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  621
              S+ +V++WCDVQLT+DGVGICFP++KLDN+S +  +F +  ++Y VNGVPT  +FPIDF
Sbjct  79    VSVPDVVLWCDVQLTRDGVGICFPNLKLDNSSGIEHVFPNGSNSYDVNGVPTDGFFPIDF  138

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
              F++L+ V L QG+++R+  FDG    I +VEDVF + +P G WLNVQH+SFYSQHNLSM
Sbjct  139   TFEELSTVPLIQGIFTRNPFFDGM-FPIQSVEDVFMQNEPAGFWLNVQHNSFYSQHNLSM  197

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
             R+F+L+ +  + I++ISSPEVNFL+ +A+      TKLVFRFL  DETEPSTNQ+YGSLL
Sbjct  198   RSFILNAAESMNISHISSPEVNFLRGLATPFASTSTKLVFRFLDQDETEPSTNQSYGSLL  257

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NL  I TFASGILVPK+YIWPVD ++SYL P TSLV DAH+VGLEVYA+ FA+DV FA+
Sbjct  258   TNLTMISTFASGILVPKNYIWPVD-ATSYLLPHTSLVADAHRVGLEVYAAGFANDVSFAY  316

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             ++SY+PV EYLSFIDNGN+SVDGVLSDFPITPS A DC++H+      Q    LVIS++G
Sbjct  317   NFSYNPVDEYLSFIDNGNFSVDGVLSDFPITPSEARDCFAHLGVNASAQATP-LVISYNG  375

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             ASGDYPGCTD AY++A+ DG D IDC
Sbjct  376   ASGDYPGCTDIAYTQAIRDGADFIDC  401



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
Length=708

 Score =   481 bits (1237),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 233/385 (61%), Positives = 290/385 (75%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVTL---VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V +   VA   +  STS+WQTL+GDAPLVIARGGFSGLFPDSS  AY FA   S
Sbjct  18    LLFCGVVLIQLFVAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLFPDSSLAAYQFAMQAS  77

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             L +VI+WCDVQLTKD VGICFPD+ L NASN+  ++  ++ +Y VNGV T  WFPIDF+ 
Sbjct  78    LADVILWCDVQLTKDEVGICFPDLNLANASNIQDVYSTRRKSYRVNGVTTQGWFPIDFSL  137

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
              +L  V+L +G++SRS RFDG+   ILT++DV  ++ P G WLNVQHD+FY Q NLSM +
Sbjct  138   TELQNVSLIRGIFSRSERFDGSGFAILTIQDVNTQLLPKGFWLNVQHDAFYEQQNLSMSS  197

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+LSVSR V I++ISSPEVNF + IA R        VF+FL  ++ EP+ N+TYGS+L N
Sbjct  198   FLLSVSRTVSIDFISSPEVNFFRKIAGRFGRNGPSFVFQFLRKEDFEPTMNRTYGSILSN  257

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D+   YL P TSLV DAHK GL+VY S FA+DV  A++Y
Sbjct  258   LTFVKTFASGILVPKSYILPIDE-EQYLVPHTSLVQDAHKAGLQVYVSGFANDVDIAYNY  316

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNG++SVDGVLSDFPIT S  +DC+SH+ +    QV +FLVIS +GAS
Sbjct  317   SWDPVSEYLSFVDNGDFSVDGVLSDFPITASATVDCFSHIGRNATKQV-DFLVISKNGAS  375

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY  A+ DG D+IDC+
Sbjct  376   GDYPGCTDVAYENAIKDGADVIDCS  400



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   481 bits (1239),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 234/363 (64%), Positives = 290/363 (80%), Gaps = 3/363 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W TL G APLV+ARGGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC P
Sbjct  28    STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             DI L N++ +AT++ +K ++Y VNGVPT+ +FP+D+  K L+ V L QGVYSRS+ FDG 
Sbjct  88    DINLANSTYIATIYPNKTTSYSVNGVPTSGYFPLDYTLKDLSSVILTQGVYSRSTLFDGN  147

Query  694   PQQILTVEDVFN-KVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                ILTV+D+     +P G+WLN+QHD+FY+QHNLSMR+FVLSVSR VV +YISSPEV F
Sbjct  148   NFGILTVDDLVKLDKKPKGIWLNIQHDAFYAQHNLSMRSFVLSVSRSVVFSYISSPEVGF  207

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             L+SIASR NP+ TKLVFRF+   + +PSTNQTYGSLL+NL  IKTFASGILVPK YIWPV
Sbjct  208   LRSIASRFNPKTTKLVFRFMRQSDVDPSTNQTYGSLLKNLTFIKTFASGILVPKGYIWPV  267

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             D ++ YLQ  TSLV DAHK GLEV+ASDF +DVPF+F+YSYDP+AEYL F+DNG++SVDG
Sbjct  268   D-ATLYLQSHTSLVSDAHKAGLEVFASDFVNDVPFSFNYSYDPLAEYLQFVDNGDFSVDG  326

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
             VLSDFPITP  AI C++H+      +  + LVIS  GASGDYP CTD AY+KA+SDGVD+
Sbjct  327   VLSDFPITPFEAIGCFAHLGTNATKK-DKTLVISKYGASGDYPACTDLAYNKAISDGVDV  385

Query  1411  IDC  1419
             +DC
Sbjct  386   LDC  388



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   478 bits (1229),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 230/385 (60%), Positives = 292/385 (76%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+A+Q  +  S S W TL+G+ PLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9     LLLCGVVLIQLLASQIHAQRSKSPWPTLTGNPPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCDVQLTKD +GICFPD+ + NASN+  + K++  +Y VNGVPT  WF +DF+ 
Sbjct  69    VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEAVLKNRLKSYSVNGVPTQGWFTLDFSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  VNL +G+ SRS +FD     I+TV+ V   ++PP  WLNVQHD+FY+Q NLSM +
Sbjct  129   KDLKDVNLIRGILSRSEKFDNNANPIMTVQSVATLIKPPLFWLNVQHDAFYAQQNLSMSS  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+++ S+ V+I++ISSPEVNF K IA R   +    VFRFLG +E EP+TN+TYGS+L N
Sbjct  189   FLVAASKTVLIDFISSPEVNFFKKIAGRFGRKGPSFVFRFLGQEEFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D     L P TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  249   LTFVKTFASGILVPKSYVLPLDDKQYLLAP-TSLVQDAHKAGLEVFVSGFANDVDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DN N+SVDGVLSDFPIT S + DC+SH+ +  KNQV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFVDNANFSVDGVLSDFPITASASRDCFSHVGRKAKNQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  367   GDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   480 bits (1235),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/366 (62%), Positives = 286/366 (78%), Gaps = 3/366 (1%)
 Frame = +1

Query  325   NSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGI  504
              S S WQTL+GDAP +IARGGFSGL PDSS +AYSF   TS+   ++WCDVQLTKD +GI
Sbjct  28    RSKSPWQTLTGDAPRIIARGGFSGLLPDSSIDAYSFVSQTSVPGTLLWCDVQLTKDAIGI  87

Query  505   CFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRF  684
             CFPD+K+ NAS++  ++  ++++YL+NGV T  WF IDFNFK L  V L+QG+ SRS  F
Sbjct  88    CFPDVKMMNASHIQDVYPKRKNSYLLNGVLTQDWFTIDFNFKDLNTVFLKQGILSRSDAF  147

Query  685   DGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEV  864
             +G    I TV+D+  +++P G WLNVQHD+FY+QHNLSM +F+LS+S+ V+I+Y+SSPEV
Sbjct  148   EGNNYAISTVKDISTQLKPEGFWLNVQHDAFYAQHNLSMSSFLLSISKTVIIDYLSSPEV  207

Query  865   NFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIW  1044
             NF ++I SR   +  K VFRFL  D+ E STNQTYGSL  NL  +KTFASGILVPKSYIW
Sbjct  208   NFFRNIGSRFGRKGPKFVFRFLEKDDVEVSTNQTYGSLAGNLTFVKTFASGILVPKSYIW  267

Query  1045  PVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSV  1224
             PV+  S YL P TS V DAHK GLEVYAS FA+D   A++YS+DP+AEYLSF+DNG++SV
Sbjct  268   PVE--SQYLLPHTSFVQDAHKAGLEVYASGFANDFDLAYNYSFDPLAEYLSFVDNGDFSV  325

Query  1225  DGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGV  1404
             DGVLSDFP+T S A+DC+SH+     +QV +FLVIS +GASGDYPGCTD AY+KA+ DG 
Sbjct  326   DGVLSDFPLTASSAVDCFSHLGSNASSQV-DFLVISKNGASGDYPGCTDLAYTKAIKDGA  384

Query  1405  DIIDCT  1422
             D+IDC+
Sbjct  385   DVIDCS  390



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   480 bits (1235),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 228/365 (62%), Positives = 285/365 (78%), Gaps = 3/365 (1%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD  GIC
Sbjct  41    SKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAFGIC  100

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FPD+K+ NASN+  ++  + ++YL+NGVPT  WF IDF+ K LT V L +G+ SRS+ FD
Sbjct  101   FPDVKMMNASNIQEVYPKRTNSYLLNGVPTQDWFTIDFSLKDLTSVFLIRGILSRSNAFD  160

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             G    I TV+D+  +++P   WLNVQHD+FY+QHNLS+ +F+LSVS+ V INY+SSPEVN
Sbjct  161   GNSYTISTVQDIATQLKPQSFWLNVQHDAFYAQHNLSISSFLLSVSKTVTINYLSSPEVN  220

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             F ++I SR   +  K VFRFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSYIWP
Sbjct  221   FFRNIGSRFGRKGPKFVFRFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWP  280

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V+  S YL P TS+V DAHK GLEVYAS FA+D   A++YS+DP+AEYLSF+DNG++SVD
Sbjct  281   VE--SQYLLPHTSVVQDAHKAGLEVYASGFANDFDIAYNYSFDPLAEYLSFVDNGDFSVD  338

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             G+LSDFP+T S A+DC+SH+      QV +FLVIS +GASGDYPGCTD AYSKA+ DG D
Sbjct  339   GLLSDFPLTASSAVDCFSHLGTNASTQV-DFLVISKNGASGDYPGCTDLAYSKAIKDGAD  397

Query  1408  IIDCT  1422
             +IDC+
Sbjct  398   VIDCS  402



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 234/363 (64%), Positives = 289/363 (80%), Gaps = 3/363 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W TL G APLV+ARGGFSG+ PDSS  AY+ A +++  +V +WCDVQLTKDGVGIC P
Sbjct  28    STWNTLGGGAPLVVARGGFSGILPDSSGAAYNLAVISTGPDVYIWCDVQLTKDGVGICQP  87

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             DI L N++ +AT++ +K ++Y VNGVPT+ +FP+D+  K L+ V L QGVYSRS+ FDG 
Sbjct  88    DINLANSTYIATIYPNKTTSYSVNGVPTSGYFPLDYTLKDLSSVILTQGVYSRSTLFDGN  147

Query  694   PQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                ILTV+D+    Q P G+WLN+QHD+FY+QHNLSMR+FVLSVSR VV +YISSPEV F
Sbjct  148   GFGILTVDDLVKLDQKPKGIWLNIQHDAFYAQHNLSMRSFVLSVSRSVVFSYISSPEVGF  207

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             L+SIASR NP+ TKLVFRF+   + +PSTNQTYGSLL+NL  IKTFASGILVPK YIWPV
Sbjct  208   LRSIASRFNPKTTKLVFRFMRQSDVDPSTNQTYGSLLKNLTFIKTFASGILVPKGYIWPV  267

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             D ++ YLQ  TSLV DAHK GLEV+ASDF +DVP +F+YSYDP+AEYL F+DNG++SVDG
Sbjct  268   D-ATLYLQSHTSLVSDAHKAGLEVFASDFVNDVPSSFNYSYDPLAEYLQFVDNGDFSVDG  326

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
             VLSDFPITP  AI C++H+      +  + LVIS  GASGDYP CTD AY+KA+SDGVD+
Sbjct  327   VLSDFPITPFEAIGCFAHLGTNATKK-DKTLVISKYGASGDYPACTDLAYNKAISDGVDV  385

Query  1411  IDC  1419
             +DC
Sbjct  386   LDC  388



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 293/380 (77%), Gaps = 6/380 (2%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13    IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF IDF+ K L  VNL
Sbjct  73    DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWFTIDFSLKDLNKVNL  132

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRR  831
              +G+ SRS RFDG    ILTV+DV  +++P GLWLNVQH++FY+QHNLSM TF+ + S+ 
Sbjct  133   IRGILSRSERFDGNGYSILTVQDVNTELKPQGLWLNVQHEAFYAQHNLSMTTFLTTASKT  192

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGN---DETEPSTNQTYGSLLQNLASIK  1002
             V+I++ISSPEVNF K IA R        VFRFL     ++ EP+TN++YGS+L NL  +K
Sbjct  193   VIIDFISSPEVNFFKKIAGRFGREGPIFVFRFLEKETXEQFEPTTNRSYGSILSNLTFVK  252

Query  1003  TFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPV  1182
             TFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DYSYDPV
Sbjct  253   TFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDYSYDPV  311

Query  1183  AEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPG  1362
             +EYLSF+DNGN+SVDGVLSDFPI+ S +++C+SHM +    QV +FLVIS +GASGDYPG
Sbjct  312   SEYLSFVDNGNFSVDGVLSDFPISASASVECFSHMGRNATKQV-DFLVISKNGASGDYPG  370

Query  1363  CTDXAYSKAVSDGVDIIDCT  1422
             CTD AY+KA+ DG D+IDC+
Sbjct  371   CTDLAYAKAIKDGADVIDCS  390



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   478 bits (1231),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 235/386 (61%), Positives = 294/386 (76%), Gaps = 6/386 (2%)
 Frame = +1

Query  265   IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             +F L+L+    T + AQ    S S WQTL+GDAPLVIARGGFSGL PDSS +AYSF   T
Sbjct  17    LFALILIHLLPTQLFAQ---RSKSPWQTLTGDAPLVIARGGFSGLLPDSSLDAYSFVSQT  73

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             S+++ ++WCDVQLTKDG+GICFPD+ + NASN+   + +++++YLVNGV T  WF IDF 
Sbjct  74    SVSDAVLWCDVQLTKDGIGICFPDLTMMNASNIQDAYPNRKNSYLVNGVTTQDWFTIDFT  133

Query  625   FKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
              K L  V L +G+ SRS  FD     I TV+DV  +++P G WLNVQHD+FY+QHNLSM 
Sbjct  134   SKDLRSVFLIRGILSRSDAFDNNRYTISTVQDVAKQLKPVGFWLNVQHDAFYAQHNLSMS  193

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             TF+LSVS+ V I+Y+SSPEVNF ++I SR   +  K VFRFL  D+ E STN TYGSL++
Sbjct  194   TFLLSVSKTVTIDYLSSPEVNFFRNIGSRFGKKGPKFVFRFLEKDDVEVSTNLTYGSLVK  253

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  +KTFASG++VPKSYIWPV+  S YL P TS V DAHK GLEVYAS FA+D   A++
Sbjct  254   NLTFVKTFASGVMVPKSYIWPVE--SLYLLPHTSFVQDAHKAGLEVYASGFANDFDLAYN  311

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DP+AEYLSF+DNG++SVDGVLSDFP+T S A+DC+SH+      QV +FLVIS +GA
Sbjct  312   YSFDPMAEYLSFVDNGDFSVDGVLSDFPLTASSAVDCFSHLGSNASPQV-DFLVISKNGA  370

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SGDYPGCTD AYSKA+ DG DIIDC+
Sbjct  371   SGDYPGCTDLAYSKAIKDGADIIDCS  396



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   478 bits (1229),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 227/363 (63%), Positives = 289/363 (80%), Gaps = 4/363 (1%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             TS WQTLSG+APLVIA+GGFSG+FPDSS++AY+ A +TSL NV++WCDVQLTKDG GICF
Sbjct  32    TSPWQTLSGNAPLVIAKGGFSGIFPDSSYHAYALALITSLPNVVLWCDVQLTKDGDGICF  91

Query  511   PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  690
             P + L N+S+++ +F D +  Y VNG     +F +DF    LT V L QG+YSR+++FDG
Sbjct  92    PYLNLGNSSSISYVFNDTK-MYRVNGQLMEGFFSVDFTLDDLTNVYLTQGIYSRANKFDG  150

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                +ILTVEDV  +++PPGLWLN+QHD+F++QHNLSMR+FVLSVSRRV+++YISSPEV F
Sbjct  151   NMFKILTVEDVAKQLKPPGLWLNIQHDAFFTQHNLSMRSFVLSVSRRVIVSYISSPEVAF  210

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             L+SI +R     TKLVFRFL  D+ EP+TNQTY S+L+NL  +KTFAS ILVPK+YIWPV
Sbjct  211   LRSITARFKQSTTKLVFRFLRADDIEPTTNQTYDSILKNLTFVKTFASAILVPKNYIWPV  270

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             + +  YLQP TS+VL+AH+ GLEV+ASDFA+DVP +++YSYDP+ E LSFIDNG +SVDG
Sbjct  271   N-TDLYLQPHTSVVLNAHREGLEVFASDFANDVPLSYNYSYDPIKECLSFIDNGKFSVDG  329

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
             +LSDFPITPS AIDC++H+      + P  LVIS +GASG YP  TD AY +A  DG D+
Sbjct  330   ILSDFPITPSEAIDCFAHLSTNSSGKAP--LVISHNGASGIYPSSTDIAYKQAFDDGADV  387

Query  1411  IDC  1419
             IDC
Sbjct  388   IDC  390


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 85/331 (26%), Positives = 153/331 (46%), Gaps = 35/331 (11%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A  STNS       SG APLVI+  G SG++P S+  AY  A      +VI  C VQ+T+
Sbjct  346   AHLSTNS-------SGKAPLVISHNGASGIYPSSTDIAYKQA-FDDGADVID-CAVQMTQ  396

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYS  669
             DGV IC   I L + +NV     + +ST +    P    F  +  ++++  +       S
Sbjct  397   DGVSICLGSINLMDGTNVVQTDFNSRSTTIRQIQPIPGIFTFNLTWEEIKTLKPVISNPS  456

Query  670   RSSRFDGTPQ-----QILTVED--VFNKVQPPGLWLNVQHDSFYSQH-NLSMRTFVLSVS  825
             R       P       I +++D   F K +P  + +++++ ++ ++   LS+   V+   
Sbjct  457   RDFALYRNPAYKYAGSIFSLKDFLAFAKDKPLSVLISIENAAYLAESLGLSVTNAVIDAL  516

Query  826   RRVVINYISSPEVNFL---KSIASRINPRVT-KLVFRFLGNDETEPSTNQTYGSLLQNLA  993
              +   N  ++ +V      +S+  +   +   +LV++    DE     + +      ++ 
Sbjct  517   NQSGYNNQTNQKVMIQSSNRSVLIKFKEKTNYQLVYKI---DEDIRDADDS------SIK  567

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYS  1170
              IK FA  + + K  ++P ++   +L   T++V       L VY   F ++ V  A+D+ 
Sbjct  568   DIKQFAHSVAITKESVFPTNQ--LFLTGATNIVSKLQSSNLTVYVYLFRNEFVSQAWDFF  625

Query  1171  YDPVAEYLSFIDNGNYSVDGVLSDFPITPSG  1263
              DPV E  SF+      +DG+++DFP T + 
Sbjct  626   SDPVVEINSFVMGA--GIDGIITDFPGTATA  654



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   478 bits (1230),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 239/380 (63%), Positives = 295/380 (78%), Gaps = 6/380 (2%)
 Frame = +1

Query  289   SAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  468
             S + LV+AQGS  +T+ W TLSG  PLVIARGGFSG++PDSS  AYS A  TSL NVI+W
Sbjct  22    SVLPLVSAQGS--NTTSWNTLSGSPPLVIARGGFSGIYPDSSDIAYSLAAQTSLANVILW  79

Query  469   CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLV  645
             CDVQLTKD  GIC PDIKL+NA+++  + + K  TY VNGV T+ +F +D+  K+L + V
Sbjct  80    CDVQLTKDREGICIPDIKLENATDIGHVSEFKSKTYSVNGVQTSGYFSVDYTLKELLSNV  139

Query  646   NLQQGVYSRSSRFDGTPQQILTVEDVFNKV--QPPGLWLNVQHDSFYSQHNLSMRTFVLS  819
              L QG Y+R++RFDG+   ILTV ++  +    P GLWLN+QHD FY+QHNLSM+ FVLS
Sbjct  140   VLIQGDYTRTNRFDGSDFPILTVNELVRRETPNPSGLWLNIQHDVFYAQHNLSMKNFVLS  199

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             VSR V ++YISSPE  FL+S+ + + P  TKLVFRFL  D+ +PSTNQTYGSLL+NL SI
Sbjct  200   VSRTVNVSYISSPEAGFLRSLRALVKPSKTKLVFRFLEKDKVDPSTNQTYGSLLKNLTSI  259

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDP  1179
             KTFASGILVPK YIWPVD +S YL P TSLV DAHKVGLEV+ASDF +D+  +++YSYDP
Sbjct  260   KTFASGILVPKEYIWPVDPTSLYLLPHTSLVSDAHKVGLEVFASDFMNDISISYNYSYDP  319

Query  1180  VAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYP  1359
             VAEYL+FIDNGN+SVDGVLSDFP+T S AIDC++H+      QV   L+IS  GASGDYP
Sbjct  320   VAEYLNFIDNGNFSVDGVLSDFPLTSSEAIDCFAHIGLNAPKQV-NTLIISKYGASGDYP  378

Query  1360  GCTDXAYSKAVSDGVDIIDC  1419
              CTD +Y KA+SDGVD++DC
Sbjct  379   PCTDLSYGKAISDGVDVLDC  398


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 141/310 (45%), Gaps = 28/310 (9%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             L+I++ G SG +P  +  +Y  A    +   ++ C VQ++KDG+  C   I L  ++NVA
Sbjct  366   LIISKYGASGDYPPCTDLSYGKAISDGVD--VLDCPVQMSKDGIPFCLSSIDLIESTNVA  423

Query  547   T-----LFKDKQSTYLVNGVPT--TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQI  705
                   L K        NG+ T   AW  I  +   L L         R+  ++    Q 
Sbjct  424   QSSFSRLGKTIPEIKSGNGIFTFDLAWNDIK-SLSPLMLNPHSMNNLYRNPEYNKK-GQY  481

Query  706   LTVEDVFNKVQPPGLWLNV----QHDSFYS-QHNLSMRTFVLSVSRRVVINYISSPEVNF  870
             LT+ D  N  +     L+V    ++ ++ + + NLS+   V+    R   +   +P+V  
Sbjct  482   LTLSDFLNLTKAHTSTLSVVIIIENAAYLARKQNLSVTDAVIDTLSRAGYDKPGAPKV-M  540

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LASIKTFASGILVPKSYIWP  1047
             ++S  S +      L F+     E     ++  G  + + +++IK FA  ++V K+ ++P
Sbjct  541   IQSTNSSV-----LLKFKEKAKYELVYKIDEIVGGAVDSAISNIKRFAHSVVVKKASVYP  595

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSV  1224
             V  S  +   +T +V       L VY   F+++ V   +D+  D   E  +F+ +    +
Sbjct  596   V--SELFAIGSTKIVSKFKSSNLSVYVETFSNEFVSQDWDFMSDAYVEINTFVQDAE--I  651

Query  1225  DGVLSDFPIT  1254
             DGV++DFP T
Sbjct  652   DGVITDFPKT  661



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   477 bits (1228),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 295/385 (77%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+A Q  +    + W+TLSG +P VIARGGFSGLFPDSS +AY+FA LTS
Sbjct  9     LLLCGVVLIQLLAVQIDAQRPKTHWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMLTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCD+QLTKDG GICFPD+ + NASNV T++   QSTY VNGVPT  WF IDF+ 
Sbjct  69    VADAVLWCDLQLTKDGAGICFPDLTMSNASNVETVYPKGQSTYPVNGVPTPGWFTIDFSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             + LT V+L +G+ SRS +FDG    I TV+ +  +++P GLWLNVQHD+FY+QHNLSM  
Sbjct  129   RALTNVSLIRGILSRSDKFDGNGYTISTVQTINKEMKPQGLWLNVQHDAFYAQHNLSMSN  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++SV++ V++++ISSPEVNF + IA R        VFRFL  ++ EP+TN+TYGS+L N
Sbjct  189   FLISVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVFRFLEKEQFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  249   LTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNGN+SVDGVLSDFPIT S +++C+SH+ +    QV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFMDNGNFSVDGVLSDFPITASASVECFSHVARNATKQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCT+ AY KA++DG D+IDC+
Sbjct  367   GDYPGCTNLAYEKAINDGADVIDCS  391



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   476 bits (1224),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 223/352 (63%), Positives = 282/352 (80%), Gaps = 2/352 (1%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  543
             PLVIA+GGFSG+FPDSS+ AYS A +TS+ +V+ WCDVQLTKDG GIC P +KLDN++++
Sbjct  32    PLVIAKGGFSGIFPDSSYAAYSLALITSVPDVVSWCDVQLTKDGAGICAPSVKLDNSTDI  91

Query  544   ATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDV  723
             + +FKD+  TY VNG+ T  WF IDF    L  V L QG+YSR+++FDG    ILTV+D+
Sbjct  92    SNIFKDQSRTYSVNGMDTQGWFSIDFTLNDLANVVLTQGIYSRTNKFDGNLFPILTVQDM  151

Query  724   FNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPR  903
              ++V+PP LWLN+QHD F++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P 
Sbjct  152   VSQVKPPALWLNIQHDMFFTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPT  211

Query  904   VTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTT  1083
              TKL+FRF+G D  EPS NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  T
Sbjct  212   KTKLIFRFMGKDVLEPSINQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHT  270

Query  1084  SLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSG  1263
             SLV DAHK GL V+ASDF +DVP +++YS+DPVAE LS++DNG +SVDGV++DFPIT S 
Sbjct  271   SLVSDAHKAGLTVFASDFVNDVPLSYNYSFDPVAETLSYVDNGAFSVDGVITDFPITSSA  330

Query  1264  AIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             AI C++H  K    Q  + LVISF+GASGDYPGCTD AYSKA+ DG DIIDC
Sbjct  331   AIRCFAHPSKNSSVQA-KPLVISFNGASGDYPGCTDLAYSKAIQDGADIIDC  381


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 84/315 (27%), Positives = 148/315 (47%), Gaps = 38/315 (12%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  543
             PLVI+  G SG +P  +  AYS A        I+ C VQ++KDG+  C     L ++SNV
Sbjct  348   PLVISFNGASGDYPGCTDLAYSKAIQDGAD--IIDCPVQMSKDGIPFCLSSANLIDSSNV  405

Query  544   ATL-FKDKQST--YLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRF----DGTPQ  699
             AT  F++  +T   + +G   T  F    N+  + TL       YS+   F    +    
Sbjct  406   ATTKFRNLMTTAPEIQSG---TGIFSFSLNWSDIQTLTPAIASPYSQFKIFRNPANKNAG  462

Query  700   QILTVEDVFNKVQP---PGLWLNVQHDSFYSQ-HNLSMRTFVLSVSRRVVINYISSPEVN  867
             + L++ +    V+     G+ + +++ ++ ++  +LS+   VL+   +    + +  E  
Sbjct  463   KFLSLSEFLVLVKNSSVSGVLIGIENAAYLAEKQSLSVTDAVLAALSKA--GFSNQTEKV  520

Query  868   FLKSIASRINPRVT-----KLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPK  1032
              +KS  S +   +      KLV+    ++    + N T       +  IK FA  ++V K
Sbjct  521   MIKSTNSSVLMNIKENANYKLVYEV--DENIRDANNDT-------VLDIKKFADSVVVMK  571

Query  1033  SYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDN  1209
             + ++P  ++  +L   T +V   H   L VY   F+++ V  A+D+  D   E  SF+  
Sbjct  572   NSVFP--ENQFFLTGITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVEVNSFVVG  629

Query  1210  GNYSVDGVLSDFPIT  1254
             G+  VDGV++DFP T
Sbjct  630   GD--VDGVITDFPKT  642



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   476 bits (1225),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 292/385 (76%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L AAQ  +    S W TL+GD P VIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9     LLLCGVVLIQLFAAQINAQKPKSPWPTLTGDPPFVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +++V++WCDVQLTKD +GICFPD+ + NAS++  ++  +Q +Y VNGVPT+ WF IDF+ 
Sbjct  69    VSDVVLWCDVQLTKDALGICFPDLTMSNASSIEVVYPTRQKSYPVNGVPTSGWFTIDFSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  VNL +G+ SRS +FDG    I+TV+ V  +++P   WLNVQHD+FY+Q NLSM +
Sbjct  129   KDLKAVNLIRGILSRSEKFDGNSNPIMTVQSVATQMKPSFFWLNVQHDAFYAQQNLSMSS  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+++ S+ V I++ISSPEVNF + I+ R       LVFRFL  +E EP+TN+TYGS+L N
Sbjct  189   FLIAASKTVPIDFISSPEVNFFRKISGRFGRNGPSLVFRFLRQEEFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S FA+D+  A DY
Sbjct  249   LTFVKTFASGILVPKSYILPLDD-QQYLLPPTSLVQDAHKAGLEVFVSGFANDIDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNGN+SVDGVL+DFPIT S ++DC+SH+ +    QV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFVDNGNFSVDGVLTDFPITASASLDCFSHIGRNATKQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  367   GDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   476 bits (1225),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 224/368 (61%), Positives = 286/368 (78%), Gaps = 3/368 (1%)
 Frame = +1

Query  319   STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  498
             +  S S WQTL+GDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTK+ +
Sbjct  36    AQRSKSPWQTLTGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKEAI  95

Query  499   GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSS  678
             GICFPD+K+ NASN+  ++  + ++YL+NGVPT  WF IDF+ K L  V L +G+ SRS+
Sbjct  96    GICFPDVKMMNASNIQEVYPKRTNSYLLNGVPTQDWFTIDFSLKDLKSVFLIRGILSRSN  155

Query  679   RFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSP  858
              FDG    I TV+D+  +++P   WLNVQHD+FY+QHNLS+ +F+LSVS+ V +NY+SSP
Sbjct  156   AFDGNSYTISTVQDIATQLKPQSFWLNVQHDAFYAQHNLSISSFLLSVSKTVTVNYLSSP  215

Query  859   EVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSY  1038
             EV+F ++I SR   +  K VFRFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSY
Sbjct  216   EVDFFRNIGSRFERKGPKFVFRFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSY  275

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNY  1218
             IWPV+  S YL P TS+V DAHK GLEVYAS FA+D   A++YS+DP+AEYLSF+DNG++
Sbjct  276   IWPVE--SQYLLPHTSVVQDAHKAGLEVYASGFANDFDIAYNYSFDPLAEYLSFVDNGDF  333

Query  1219  SVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSD  1398
             SVDG+LSDFP+T S A+DC+SH+      QV +FLVIS +GASGDYPGCTD AYSKA+ D
Sbjct  334   SVDGLLSDFPLTASSAVDCFSHLGTNASTQV-DFLVISKNGASGDYPGCTDLAYSKAIKD  392

Query  1399  GVDIIDCT  1422
             G D+IDC+
Sbjct  393   GADVIDCS  400



>ref|XP_007146553.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
 gb|ESW18547.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
Length=503

 Score =   467 bits (1201),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 287/373 (77%), Gaps = 5/373 (1%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS  AY F    SL NVI+WCDVQL
Sbjct  28    VSAQVSNATT--WNTLSGNPPLVIARGGFSGIFPDSSEKAYIFGVTASLKNVIVWCDVQL  85

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQG  660
             TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F +D+  K L + V L QG
Sbjct  86    TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYFSVDYTLKDLRSNVFLVQG  145

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
              +SR++   G   +ILTV+DV N   P GLWLN+QHD+FY+QHNLSM+ F+ SVS  V +
Sbjct  146   DHSRATTI-GKGFEILTVKDVVNTTSPQGLWLNIQHDAFYTQHNLSMKNFIRSVSTTVNV  204

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPE +FL+SI + INP++TKLVFRFLG +E +PS  QTYGSLLQNL SIKTFASGI
Sbjct  205   SYISSPEASFLRSIKTDINPKITKLVFRFLGKEEVDPSIKQTYGSLLQNLTSIKTFASGI  264

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPVD +S YLQP TSLV DAHKVGLEV+AS F +D+P +++YSYDPV+E+LSF
Sbjct  265   LVPKDYIWPVDPTSHYLQPHTSLVSDAHKVGLEVFASTFQNDIPISYNYSYDPVSEHLSF  324

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             I+NGN+SVDGVLSDFP+T S AIDC++HM      +V   LVIS  GASGDYP CTD AY
Sbjct  325   IENGNFSVDGVLSDFPLTSSAAIDCFAHMGLNAPKKV-NTLVISKYGASGDYPPCTDLAY  383

Query  1381  SKAVSDGVDIIDC  1419
              KA+ DGVDI+DC
Sbjct  384   KKAILDGVDILDC  396



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   474 bits (1220),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 293/385 (76%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+A+Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9     LLLCGVVLIQLLASQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCDVQLTKD  GICFPD+ + NASN+  + K++  +Y VNGVPT   F +DF+ 
Sbjct  69    VPDAVLWCDVQLTKDAFGICFPDLTMSNASNIEAVHKNRLKSYSVNGVPTQGRFTLDFSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  VNL +G+ SRS +FD     I+TV+ V  +++PP  WLNVQHD+FY+Q NLSM +
Sbjct  129   KDLKDVNLIRGILSRSEKFDDNVNPIMTVQSVATQIKPPLFWLNVQHDAFYAQQNLSMSS  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+++ S+ V+I++ISSPEVNF K IA R   +    VFRFLG +E EP+TN+TYGS+L N
Sbjct  189   FLVAASKTVLIDFISSPEVNFFKKIAGRFGRKGPSFVFRFLGQEEFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D+    L P TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  249   LTFVKTFASGILVPKSYVLPLDEEQYLLAP-TSLVQDAHKAGLEVFVSGFANDVDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DN N+SVDGVLSDFPIT S + +C+SH+ +  KNQV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFMDNANFSVDGVLSDFPITASASRNCFSHVGRKAKNQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  367   GDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   474 bits (1220),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 293/385 (76%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+++Q  +  S S W TL+G+APLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  9     LLLCGVVLIQLLSSQIHAQRSKSPWPTLTGEAPLVIARGGFSGLFPDSSYDAYNFAMLTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCDVQLTKD +GICFPD+ + NASN+  + K++  +Y VNGVPT   F +DF+ 
Sbjct  69    VPDAVLWCDVQLTKDALGICFPDLTMSNASNIEVVHKNQLKSYSVNGVPTQGLFTLDFSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  VNL +G+ SRS +FD     I+TV+ V  +++PP  WLNVQHD+FY+Q NLSM +
Sbjct  129   KDLKDVNLIRGILSRSEKFDDNANPIMTVQSVATQIKPPLYWLNVQHDAFYAQQNLSMSS  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+++ S+ V I++ISSPEVNF K IA R   +    VFRFLG +E EP+TN+TYGS+L N
Sbjct  189   FLVAASKTVFIDFISSPEVNFFKKIAGRFGRKGPSFVFRFLGQEEFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D+    L P TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  249   LTFVKTFASGILVPKSYVLPLDEEQYLLAP-TSLVQDAHKAGLEVFVSGFANDVDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DN N+SVDGVLSDFPIT S + DC+SH+ +  KNQV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFMDNANFSVDGVLSDFPITASASRDCFSHVGRKAKNQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  367   GDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   474 bits (1219),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 232/385 (60%), Positives = 287/385 (75%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVT---LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V    L +   +  S S W TL+GDAPLVIARGGFSGLFPDSS++AY+FA LTS
Sbjct  10    LLLCVVVLIQLLASHIHAQRSKSPWPTLTGDAPLVIARGGFSGLFPDSSYDAYNFAMLTS  69

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + +  +WCDVQLTKD +GICFPD+ + NAS +  ++   Q +Y VNGVPT  WF IDF+ 
Sbjct  70    VPDAALWCDVQLTKDALGICFPDLNMANASTIDGVYPKGQKSYSVNGVPTQGWFTIDFSL  129

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  VNL +G+ SRS RFD     ILTV+ V  +++P   WLNVQHD+FY+QHNLSM +
Sbjct  130   KDLKNVNLIRGILSRSERFDTNVNPILTVQSVATQIKPSFFWLNVQHDAFYAQHNLSMSS  189

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+++ S+ V I++ISSPEVNF + IA R        VFRFLG +E EP+TN+TYGS+L N
Sbjct  190   FLIAASKTVPIDFISSPEVNFFRKIAGRFGRNGPSFVFRFLGQEEFEPTTNRTYGSILSN  249

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D    YL P TSLV DAHK+GLEV+ S FA+DV  A DY
Sbjct  250   LTFVKTFASGILVPKSYILPLDD-QLYLLPPTSLVQDAHKLGLEVFVSGFANDVDIAHDY  308

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNGN+SVDGVLSDFPIT S + DC+SH+ +    QV +FLVIS +GAS
Sbjct  309   SFDPVSEYLSFVDNGNFSVDGVLSDFPITASASRDCFSHIGRNATKQV-DFLVISKNGAS  367

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  368   GDYPGCTDLAYEKAIKDGADVIDCS  392



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   473 bits (1217),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/386 (61%), Positives = 287/386 (74%), Gaps = 6/386 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             +LLC  V   L A Q  +  S+S WQTLSGDAPLVIARGGFSGLFPDSSFNAY FA  TS
Sbjct  6     VLLCCVVLIQLFAGQADAQRSSSPWQTLSGDAPLVIARGGFSGLFPDSSFNAYDFAKQTS  65

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +    +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q TY VNGV T  WF IDF+ 
Sbjct  66    VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPNRQKTYSVNGVSTQGWFTIDFSL  125

Query  628   KQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
             + L + V L +G+ SRS +F+G    I+TVEDV  +++P   WLNVQ+D+FY+QHNLSM 
Sbjct  126   RDLISNVKLNRGILSRSEKFNGI-YAIMTVEDVTTQIKPESFWLNVQYDAFYAQHNLSMS  184

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F++S S  V I+YISSPEVNF K IA R        VF+FLG ++ EP+TN+TYGS+L 
Sbjct  185   SFLISASTTVSIDYISSPEVNFFKKIAGRFGRNGPSFVFQFLGKEDFEPTTNRTYGSILS  244

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  +KTFASGILVPKSYI P++     L P  SLVLDAHK GL+VY S F +D   A D
Sbjct  245   NLTFVKTFASGILVPKSYILPLNDKQYLLLPPASLVLDAHKAGLQVYVSGFVNDNDIAHD  304

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS DPV+EYLSF+DNGN+SVDGVLSDFPIT S +IDC+SH+ +    QV +FLVIS +GA
Sbjct  305   YSSDPVSEYLSFVDNGNFSVDGVLSDFPITASASIDCFSHLGRNATKQV-DFLVISKNGA  363

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SGDYPGCTD AY KA+ DG D+IDC+
Sbjct  364   SGDYPGCTDMAYDKAIKDGADVIDCS  389



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   471 bits (1213),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 237/396 (60%), Positives = 290/396 (73%), Gaps = 9/396 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             M  LRS  + L+LC  V   L ++Q  +  S S WQTL GDAPLVIARGGFSGLFPDSS 
Sbjct  1     MRGLRS--SSLILCGFVLIQLFSSQIDAQRSKSPWQTLLGDAPLVIARGGFSGLFPDSSL  58

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
             +AYSFA  TS+   ++WCDVQLTKDG GICFPD+ + NAS +   +  +Q TY VNGVPT
Sbjct  59    DAYSFAMQTSVAGAVLWCDVQLTKDGAGICFPDLTMSNASTIDVAYPTRQKTYTVNGVPT  118

Query  598   TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSF  777
               WF IDF+ K L  V L +G+ SRS +FDG    I TV+ V   ++P G WLNVQHD+F
Sbjct  119   QNWFTIDFSLKDLKSVFLVRGILSRSDKFDGNGYAISTVQTVSTLLKPEGFWLNVQHDAF  178

Query  778   YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  957
             Y+QHNLSM  F+LS S+  +I++ISSPEVNF K IA R   +    VFRFLG +E EP+T
Sbjct  179   YAQHNLSMSNFLLSASKTAIIDFISSPEVNFFKKIAGRFGRKGPTFVFRFLGTEEFEPTT  238

Query  958   NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYL-QPTTSLVLDAHKVGLEVYASD  1134
             NQTYGS+L NL  +KTFAS ILVPKSY+ PV K   YL  P  SLV DAHK GLEV+ S 
Sbjct  239   NQTYGSILSNLTFVKTFASAILVPKSYVLPVAK--QYLVPPPRSLVQDAHKAGLEVFVSG  296

Query  1135  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  1314
             FA+DV  A+DYS+DPV+EYLSF+DNGN+SVDGVL+DFPIT S ++ C+SH+ +    QV 
Sbjct  297   FANDVDIAYDYSFDPVSEYLSFVDNGNFSVDGVLTDFPITASASVACFSHIGRNATKQV-  355

Query  1315  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +FLVIS +GASGDYPGCTD AY+KA+ DG D+IDC+
Sbjct  356   DFLVISKNGASGDYPGCTDLAYAKAIKDGADVIDCS  391



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   471 bits (1213),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 231/395 (58%), Positives = 296/395 (75%), Gaps = 7/395 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             M  LR+  + LLLC  V   L+AAQ  +  S S W TL+GD P VIARGGFSGLFPDSS 
Sbjct  1     MRGLRA--SSLLLCGVVLIQLLAAQIDAQKSKSPWLTLTGDFPRVIARGGFSGLFPDSSL  58

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
             +AY FA +TS+ +V++WCD+QLTKDG GICFP + + NAS++  ++ ++Q +YLVNGVPT
Sbjct  59    DAYKFAMITSVPDVVLWCDLQLTKDGAGICFPGLTMSNASSINGVYPNRQKSYLVNGVPT  118

Query  598   TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSF  777
               WF IDF+ + L  V L +G+ SRS +FDG    I TV+DV + ++P G WLNVQHD+F
Sbjct  119   QGWFTIDFSLRDLKDVTLIRGILSRSEKFDGNGYSIQTVQDV-DALKPQGFWLNVQHDAF  177

Query  778   YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  957
             Y++HNLSM +F++S S+ V+I++ISSPEVNF + IA R        VFRFL  +E EP+T
Sbjct  178   YAEHNLSMSSFLVSASKTVIIDFISSPEVNFFRKIAGRFGRNGPSFVFRFLEKEEFEPTT  237

Query  958   NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  1137
             N+TYGS+L NL  +KTFASGILVPKSYI P++     L  T+SLV DAHK GLEV+AS F
Sbjct  238   NRTYGSILSNLTFVKTFASGILVPKSYILPLNDEQYLLPQTSSLVQDAHKAGLEVFASGF  297

Query  1138  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  1317
             A+DV  A DYSYDPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SHM +    QV +
Sbjct  298   ANDVDIAHDYSYDPVSEYLSFVDNGNFSVDGVLSDFPITASASVDCFSHMGRNATKQV-D  356

Query  1318  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             FLV+S +GASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  357   FLVMSKNGASGDYPACTNLAYQKAIKDGADVIDCS  391



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   471 bits (1212),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 242/394 (61%), Positives = 306/394 (78%), Gaps = 10/394 (3%)
 Frame = +1

Query  247   MWKLRSIFNLL--LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFN  420
             MW  R+   +L  LL  ++ LV+AQGS    S W+TL+GD PLVIARGGFSGLFP  S  
Sbjct  1     MWNSRAPLFVLAALLFYSLALVSAQGS----SPWKTLTGDPPLVIARGGFSGLFPGFSSA  56

Query  421   AYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTT  600
             AY+ A +TS+ +V+++CDVQLTK+  GICFPD+ L+N+SNV  +F+ K+ TY VNG PT 
Sbjct  57    AYNLALITSVPDVVLYCDVQLTKEAAGICFPDLLLNNSSNVDQVFEKKEKTYPVNGFPTK  116

Query  601   AWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFY  780
               F ID++ K L  + + QGVYSRS++FDG    ILTVEDV  + +PPGLWLN++++ F+
Sbjct  117   GSFSIDYSLKDLANIFVTQGVYSRSNKFDGNMYPILTVEDVAMQFRPPGLWLNIENNIFF  176

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
             SQHNLSMR +VLSVS++VV+N+ISSPEV+FL SI +R++P  TKL+F+FL   E EPSTN
Sbjct  177   SQHNLSMRNYVLSVSKKVVVNFISSPEVDFLNSIKARVSPTTTKLIFKFLDEAEIEPSTN  236

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             QTYGSLL+NL  IKTFASGI+VPK+YIWPV    +YL+P TS+V DAHK GL V+AS+  
Sbjct  237   QTYGSLLKNLTFIKTFASGIIVPKTYIWPV-TVDNYLKPHTSIVSDAHKAGLTVFASELY  295

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +DVPF F+YSYDPV+EYLSF DNG++SVDGVLSDFP+TPS AIDCY+H  K     VP  
Sbjct  296   NDVPFPFNYSYDPVSEYLSFFDNGDFSVDGVLSDFPLTPSAAIDCYAHPEKNA--SVPAT  353

Query  1321  -LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
              LVIS DGASGDYPGCTD AY  A++DGVD++DC
Sbjct  354   PLVISKDGASGDYPGCTDLAYMHAITDGVDVLDC  387



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   471 bits (1212),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 223/365 (61%), Positives = 284/365 (78%), Gaps = 3/365 (1%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             S S WQTL+GDAPL++ARGGFSGLFPDSS ++YSF   TS+   ++WCD+QLTKD +GIC
Sbjct  39    SKSPWQTLTGDAPLIVARGGFSGLFPDSSLDSYSFVAQTSVQGTVLWCDLQLTKDAIGIC  98

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FPD+K+ NASN+  +F  ++++YL++GV T  WF IDFNFK L  V L +G+ SRS  FD
Sbjct  99    FPDVKMMNASNIQVVFPKQKNSYLLDGVLTQDWFTIDFNFKDLKNVFLIRGMLSRSDAFD  158

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             G    I TV+D+  +++P   WLNVQH++FY+QHNLS+ +F+LS  + V I+Y+SSPEVN
Sbjct  159   GNNYAISTVQDIATQLKPKSFWLNVQHEAFYAQHNLSISSFLLSAPKTVTIHYLSSPEVN  218

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             F ++I SR+  +  K VFRFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSYIWP
Sbjct  219   FFRNIGSRLGRKGPKFVFRFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSYIWP  278

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V+  S YL P TS+V DAHK GLEVYAS FA+D   A++YS+DP+AEYLSFIDNG++SVD
Sbjct  279   VE--SQYLLPHTSVVQDAHKAGLEVYASGFANDFDIAYNYSFDPLAEYLSFIDNGDFSVD  336

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVLSDFP+T S A+DC+S++      QV +FL+IS +GASGDYPGCTD AYSKA+ DG D
Sbjct  337   GVLSDFPLTASSAVDCFSNLGTNASTQV-DFLIISKNGASGDYPGCTDLAYSKAIKDGAD  395

Query  1408  IIDCT  1422
             +IDC+
Sbjct  396   VIDCS  400



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   470 bits (1210),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 293/385 (76%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9     LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCD+QLTKDG GICFPD+ + NASNV +++   QSTY VNGVPT  WF ID + 
Sbjct  69    VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPKGQSTYPVNGVPTPGWFTIDLSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             + LT V+L +G+ SRS +FDG    I TV+ V  +++P G WLNVQHD+FY+QHNLSM  
Sbjct  129   RALTNVSLIRGILSRSDKFDGNGYTISTVQTVNKEMKPQGFWLNVQHDAFYAQHNLSMSN  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++SV++ V++++ISSPEVNF + IA R        VFRFL  ++ EP+TN+TYGS+L N
Sbjct  189   FLVSVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVFRFLEKEQFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  249   LTFVKTFASGILVPKSYVLPLDD-KQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNGN+SVDGVLSDFPIT S +++C+SH+ +    QV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFMDNGNFSVDGVLSDFPITASASVECFSHVARNATKQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCT+ AY KA++DG D+IDC+
Sbjct  367   GDYPGCTNLAYEKAINDGADVIDCS  391



>ref|XP_004150252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Cucumis 
sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   470 bits (1210),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/376 (62%), Positives = 294/376 (78%), Gaps = 8/376 (2%)
 Frame = +1

Query  301   LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  480
             LV+AQGS N+   WQTLSGDAP V+ARGGFSGLFPDSS  AY+FA + S+ +VI+WCDVQ
Sbjct  22    LVSAQGS-NTPPLWQTLSGDAPFVVARGGFSGLFPDSSGVAYNFAAIVSVPDVILWCDVQ  80

Query  481   LTKDGVGICFPDIKLDNASNVATLF-KDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQ  657
             LTKDGVGIC PD++LDNA++ + +    +  +Y VNGV  +  F +D++FK+L  V++ Q
Sbjct  81    LTKDGVGICLPDLRLDNATDASVILGTTRTRSYSVNGVSMSGLFTVDYDFKELENVSVVQ  140

Query  658   GVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSV--SRR  831
             G+Y+RS++FDG    ILT EDV N+ +P G WLN+QHD F++QHN+SMR FVLSV  +R 
Sbjct  141   GIYTRSTKFDGNQFIILTPEDVANQFKPRGFWLNIQHDVFFTQHNVSMRNFVLSVIRTRS  200

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFA  1011
              ++NYISSPEV FL+SIA+R+ PR TKL+ RFLG  + E +TNQTY SL QNL  IKTFA
Sbjct  201   TIVNYISSPEVGFLRSIAARV-PRTTKLILRFLGPTDREITTNQTYDSLKQNLTFIKTFA  259

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEY  1191
             SGILVPK+YIWP +   SYLQ  TSLV DAHK  LEV+ASDF SD+P  ++YSYDPVAEY
Sbjct  260   SGILVPKTYIWPTE--DSYLQAQTSLVSDAHKAQLEVFASDFYSDLPLPYNYSYDPVAEY  317

Query  1192  LSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTD  1371
             LS+ DNG +SVDGVLSDFPITPS AI C++H+ K  K+Q  + LVIS  GASGD+P CTD
Sbjct  318   LSYFDNGKFSVDGVLSDFPITPSSAIACFAHLGKNAKSQ-DKPLVISKFGASGDFPACTD  376

Query  1372  XAYSKAVSDGVDIIDC  1419
              AY+ A+SDGV+++DC
Sbjct  377   LAYTNAISDGVEVLDC  392


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 82/320 (26%), Positives = 151/320 (47%), Gaps = 37/320 (12%)
 Frame = +1

Query  352   SGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDN  531
             S D PLVI++ G SG FP  +  AY+ A    +   ++ C VQ++KDG+  C   I L +
Sbjct  355   SQDKPLVISKFGASGDFPACTDLAYTNAISDGVE--VLDCPVQISKDGIPFCMSSINLID  412

Query  532   ASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-----TLVNLQQGVYS--RSSRFDG  690
             ++ ++      +ST +    P    F  D  ++++     +++N     Y+  R+ RF  
Sbjct  413   STTISQSPFINRSTNIPEISPNDGVFAFDLTWEEIKSLTPSILNPYSAKYTLFRNPRFRN  472

Query  691   TPQQILTVEDVF----NKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSV-------SRRVV  837
             +  +  T+ D      N     G+ + +++ ++ ++H  S+   VLS        ++  V
Sbjct  473   S-GEFRTLPDFLALAKNASTLSGVLIQIENAAYLAKHGFSVTDAVLSSLSEAGYDNQTAV  531

Query  838   INYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASG  1017
                I SP+   L  I  +   +  +LV++       EP ++     L   +  IK+FA  
Sbjct  532   KVLIQSPDSAVL--IKFKQENKNYELVYKV-----DEPISD----VLNTTVEDIKSFADS  580

Query  1018  ILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYL  1194
             + + KS ++PV++   +L   T +V     + L VY   F+++ V  A+D+  D   E  
Sbjct  581   VTITKSSVFPVNQ--FFLTGATDVVKKLKALNLSVYVESFSNEFVSQAWDFFSDATVEIN  638

Query  1195  SFIDNGNYSVDGVLSDFPIT  1254
             SF+      +DGV++DFP T
Sbjct  639   SFVLGAE--IDGVITDFPKT  656



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   470 bits (1209),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 294/392 (75%), Gaps = 3/392 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW  R++   L     +       ++   S W+TL+G  PLV+ARGGFSG+FPDSS +AY
Sbjct  1     MWNPRALSAPLAALLLLLHALIAIASAQRSAWKTLNGGPPLVVARGGFSGIFPDSSDSAY  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             S A +T+  +V + CDVQLTKD VGIC PDI L N++ +AT + +  ++YLVNGVP   +
Sbjct  61    SLAVITTGPDVYVSCDVQLTKDAVGICLPDINLANSTYIATTYPNDTTSYLVNGVPIRGY  120

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYS  783
             F +D+  KQL+ V L QGVYSR++RFDG    ILTV+D+    Q P G+WLN+QHD+FY+
Sbjct  121   FSLDYTMKQLSDVLLTQGVYSRTNRFDGIGFLILTVDDLVTLNQKPKGIWLNIQHDTFYA  180

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSMR+FV+S S+R+V +YISSPEVNFL+ I+SR+N + TKLVFRF+  DE EPS NQ
Sbjct  181   QHNLSMRSFVISASKRIVFSYISSPEVNFLRGISSRLNLKTTKLVFRFMDKDELEPSINQ  240

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYGSLL+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV DAHKVGLEV+ SDF +
Sbjct  241   TYGSLLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLVSDAHKVGLEVFGSDFVN  299

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             DVP +F+YSYDP+ EYL FIDNG +SVDGVLSDFP+TP  AI C+S +      Q  + L
Sbjct  300   DVPSSFNYSYDPLTEYLQFIDNGEFSVDGVLSDFPVTPFEAIGCFSQLGTNATKQ-DKTL  358

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             VIS  GASGDYP CT+ AY KA++DGVD++DC
Sbjct  359   VISKYGASGDYPACTNLAYEKAIADGVDVLDC  390



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   470 bits (1209),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 286/385 (74%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             +LLC  V +    G T+   S+S+WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6     VLLCCVVLIQLFAGQTDAQRSSSRWQTLSGDAPLVIARGGFSGLFPDSSSIAYGFAKQTS  65

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +    +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q TY VNGV T  WF IDF+ 
Sbjct  66    VAGAALWCDVQLTKDGAGICFPDLKLNNASTVEDVYPNRQKTYSVNGVSTQGWFTIDFSL  125

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             + L+ V L +G+ SRS +F+G    ILTVEDV  +++P   WLNVQ+D+FY+Q NLSM +
Sbjct  126   RDLSDVKLNRGILSRSEKFNGI-YPILTVEDVTTQIKPESFWLNVQYDAFYAQQNLSMSS  184

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++S SR V I+YISSPEVNF K IA R        VF+FLG ++ EP+TN+TY S+L N
Sbjct  185   FLISASRTVSIDYISSPEVNFFKKIAGRFGRNGPSFVFQFLGKEDFEPTTNRTYDSILSN  244

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D +   + P  SLVLDAHK GL+VY S F +D   A DY
Sbjct  245   LTFVKTFASGILVPKSYILPLDDNQYLVLPPKSLVLDAHKAGLQVYVSGFVNDNDIAHDY  304

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S DPV+EYLSF+DNGN+SVDGVLSDFPIT S +IDC+SH+ +    QV +FLVIS +GAS
Sbjct  305   SSDPVSEYLSFVDNGNFSVDGVLSDFPITASASIDCFSHLGRNATKQV-DFLVISKNGAS  363

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             G+YPGCTD AY KA+ DG D+IDC+
Sbjct  364   GEYPGCTDMAYDKAIKDGADVIDCS  388



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   470 bits (1209),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/384 (61%), Positives = 282/384 (73%), Gaps = 4/384 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             +LLC  V   L A Q    S+S WQTLSGDAPLVIARGGFSGLFPDSS NAYSFA  TS+
Sbjct  6     VLLCCVVLIQLFAGQTDARSSSPWQTLSGDAPLVIARGGFSGLFPDSSLNAYSFAVQTSV  65

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
                 +WCDVQLTKDG GICFPD+KL+NAS V  ++ ++Q +Y VNGV T  WF IDF+ +
Sbjct  66    PGSALWCDVQLTKDGAGICFPDLKLNNASTVEYVYPNRQKSYPVNGVSTQGWFTIDFSLR  125

Query  631   QLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTF  810
              L  V+L +G+ SR+ +FDG    ILTVEDV  +++P   WLNVQHD+F+ Q NLSM  F
Sbjct  126   DLNDVSLIRGILSRTEKFDGI-YPILTVEDVTTQIKPESFWLNVQHDAFFEQQNLSMSKF  184

Query  811   VLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNL  990
             ++S SR V INYISSPEVNF   I+ R        VF+FL  ++ EP+TNQTYGS+L NL
Sbjct  185   LISASRIVSINYISSPEVNFFTKISGRFGRNGPLFVFQFLRKEDIEPTTNQTYGSILSNL  244

Query  991   ASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYS  1170
               +KTFASGILVPKSYI P+D     + P  SLV DAHK GL+VY S FA+D+  A DYS
Sbjct  245   TFVKTFASGILVPKSYILPLDDKQYLVPPPKSLVQDAHKAGLQVYVSGFANDIDIAHDYS  304

Query  1171  YDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASG  1350
              DPV+EYLSF+DNGN+SVDGVLSDFP+T S +IDC+SH+ +    QV  FLVIS +GASG
Sbjct  305   SDPVSEYLSFVDNGNFSVDGVLSDFPLTASSSIDCFSHLGQNAIKQV-NFLVISKNGASG  363

Query  1351  DYPGCTDXAYSKAVSDGVDIIDCT  1422
             DYPGCTD AY KA+ DG D+IDC+
Sbjct  364   DYPGCTDLAYDKAIKDGADVIDCS  387



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   470 bits (1209),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 293/385 (76%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LLLC  V   L+A Q  +    ++W+TLSG +P VIARGGFSGLFPDSS +AY+FA  TS
Sbjct  9     LLLCGVVLIQLLAVQIDAQRPKTQWKTLSGFSPRVIARGGFSGLFPDSSLDAYNFAMQTS  68

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCD+QLTKDG GICFPD+ + NASNV +++   QSTY VNGVPT  WF ID + 
Sbjct  69    VLDAVLWCDLQLTKDGAGICFPDLTMSNASNVESVYPKGQSTYPVNGVPTPGWFTIDLSL  128

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             + LT V+L +G+ SRS +FDG    I TV+ V  +++P G WLNVQHD+FY+QHNLSM  
Sbjct  129   RALTNVSLIRGILSRSDKFDGNGYTISTVQTVNKEMKPQGFWLNVQHDAFYAQHNLSMSN  188

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++SV++ V++++ISSPEVNF + IA R        VFRFL  ++ EP+TN+TYGS+L N
Sbjct  189   FLVSVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVFRFLEKEQFEPTTNRTYGSILSN  248

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  249   LTFVKTFASGILVPKSYVLPLDD-KQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDY  307

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNGN+SVDGVLSDFPIT S +++C+SH+ +    QV +FLVIS +GAS
Sbjct  308   SFDPVSEYLSFMDNGNFSVDGVLSDFPITASASVECFSHVARNATKQV-DFLVISKNGAS  366

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCT+ AY KA++DG D+IDC+
Sbjct  367   GDYPGCTNLAYEKAINDGADVIDCS  391



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   470 bits (1209),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/368 (60%), Positives = 283/368 (77%), Gaps = 3/368 (1%)
 Frame = +1

Query  319   STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  498
             +  S S WQTLSGDAP +IARGGFSGL PDSS +AYSF G TS+ + ++WCD+QLTKD +
Sbjct  36    AQRSKSPWQTLSGDAPRIIARGGFSGLLPDSSLDAYSFVGQTSVPDAVLWCDLQLTKDAI  95

Query  499   GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSS  678
             GICFPD+K+ NASN+  ++  ++++YL+NGVPT  WF IDF  K L  V L +G+ SRS 
Sbjct  96    GICFPDVKMMNASNIQVVYPKRKNSYLLNGVPTQDWFTIDFTLKDLKSVFLIRGIMSRSD  155

Query  679   RFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSP  858
              FDG    I TV+D+  +++    WLNVQHD+FY+QHNLS+ +F+LS ++ V +NY+SSP
Sbjct  156   AFDGNGYTISTVQDIATQLKLQSFWLNVQHDAFYAQHNLSISSFLLSATKTVTVNYLSSP  215

Query  859   EVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSY  1038
             EVNF ++I SR   +  K VFRFL  D+ E STNQTYGSL  NL  IKTFASGILVPKSY
Sbjct  216   EVNFFRNIGSRFGRKGPKFVFRFLEKDDVEVSTNQTYGSLAGNLTFIKTFASGILVPKSY  275

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNY  1218
             IWPV+  S YL P TS+V DAHK GLEVYAS FA+D   A++YS+DP+AEYLSF+DNG++
Sbjct  276   IWPVE--SQYLLPHTSVVQDAHKAGLEVYASGFANDFDIAYNYSFDPLAEYLSFVDNGDF  333

Query  1219  SVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSD  1398
             SVDG++SDFP+T S A+DC+SH+      QV +FLVIS +GASGDYPGCTD AYSKA+ D
Sbjct  334   SVDGLVSDFPLTASSAVDCFSHLGTNASTQV-DFLVISKNGASGDYPGCTDLAYSKAIKD  392

Query  1399  GVDIIDCT  1422
             G D+I+C+
Sbjct  393   GADVINCS  400



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   469 bits (1208),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/393 (60%), Positives = 294/393 (75%), Gaps = 9/393 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             MW  R++F+ L    A+       + +  S W TL+G+ PLV+A GGFSG+FP SS  AY
Sbjct  1     MWTPRALFSTL----ALLFHLLHSARSDRSPWNTLTGNPPLVVAHGGFSGVFPQSSEVAY  56

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             + A +TS   V +WCDVQLTKD VGIC P++ LDN++ ++ +F +K +TY VN VPT  +
Sbjct  57    NLAVMTSGPEVSIWCDVQLTKDEVGICLPNVILDNSTFISYIFPNKSTTYNVNNVPTNGY  116

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP--PGLWLNVQHDSFY  780
             F +D+  K L+ V L+Q VYSRS  FDGT   ILTV+DV     P  PGLWLN+QHD+FY
Sbjct  117   FSLDYTLKDLSNVPLKQVVYSRSPVFDGT-YMILTVDDVVKSGAPQTPGLWLNIQHDAFY  175

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
             +QH LSM+ FVLSVSRRV +NYISSPE+ FL+SI  R+NP+ TK +FRFL  +ET+PSTN
Sbjct  176   AQHKLSMKRFVLSVSRRVRVNYISSPEIGFLRSIKPRLNPKKTKFIFRFLDQNETDPSTN  235

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             QTYGSLL+NL  IK+FASGILVPK YIWPVD  S YLQP TSLV DAHK+GLEV+AS FA
Sbjct  236   QTYGSLLKNLTFIKSFASGILVPKGYIWPVD-DSLYLQPHTSLVSDAHKLGLEVFASGFA  294

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +D  F+F+YSYDP+AEYL FIDNG +SVDGVLSDFP+TPS AI C++H+      +  + 
Sbjct  295   NDASFSFNYSYDPLAEYLQFIDNGEFSVDGVLSDFPVTPSAAIGCFAHLGTNSTKR-DKT  353

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             L+IS  GASGDYP CTD AY+KA+ DGVD++DC
Sbjct  354   LIISKCGASGDYPACTDLAYNKAILDGVDVLDC  386


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 148/331 (45%), Gaps = 36/331 (11%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A   TNST +      D  L+I++ G SG +P  +  AY+ A L  +   ++ C VQ++K
Sbjct  341   AHLGTNSTKR------DKTLIISKCGASGDYPACTDLAYNKAILDGVD--VLDCPVQMSK  392

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF---NFKQLT--LVNLQ  654
             DG+  C     L  ++        + +  +    P    F  +    + K LT  +VN  
Sbjct  393   DGIPFCLSSADLGESTTAVKSSFSRYAMSIPEIKPGNGIFTFNLTWTDIKGLTPSIVNPF  452

Query  655   QGVYS--RSSRFDGTPQQILTVEDVF----NKVQPPGLWLNVQHDSFYSQ-HNLSMRTFV  813
                YS  R  ++       +T+ D      N+    G+ + V++ ++ ++   LS+   V
Sbjct  453   FAKYSLVRDPKYKNA-GTFVTLSDFLLLTKNQTSLSGVLIIVENAAYLAEKQGLSVTDAV  511

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ-NL  990
             +    +   +   S +V +++S  S +      L F+   + E     ++T G +    +
Sbjct  512   IDALSKAGYDKPGSQKV-YIQSTNSSV-----LLKFKEKTSYELVYKIDETVGDVADAAV  565

Query  991   ASIKTFASGILVPKSYIWPVDK---SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
               IK+FA  ++V K  ++P D    +SS  +    L      V +E ++++F S    A+
Sbjct  566   EDIKSFAGSVVVDKVSVFPRDVAFLTSSLTRTVPKLKASNLSVFVETFSNEFVSQ---AW  622

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
             D+  DP+ E  SFI      +DGV++DFP T
Sbjct  623   DFFSDPIVEINSFIQEAG--IDGVITDFPKT  651



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   468 bits (1205),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 231/391 (59%), Positives = 292/391 (75%), Gaps = 3/391 (1%)
 Frame = +1

Query  250   WKLRSIFNLLLLCSAVTLVAAQGSTNSTS-KWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             W   ++     LCS+  +VA +  ++S   KWQTL+G+ PLVIA+GGFSG+FPDSS NAY
Sbjct  5     WHFCTLILFFWLCSSPPVVAGRRGSSSGGGKWQTLTGNPPLVIAKGGFSGIFPDSSLNAY  64

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A  T L N + WC+V LTKDG GICFP+++L+NASN+  ++ DK +TY VNGV    W
Sbjct  65    RLAVETGLRNSLAWCEVYLTKDGAGICFPELRLENASNIGEVYGDKHNTYTVNGVSVEGW  124

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F +DF    L  V L+Q +Y+RS +FD T   + +V+DV ++  P GLWLN+ +D FYSQ
Sbjct  125   FALDFTLDDLAYVQLRQRIYARSDKFDSTASSVQSVDDVVDQANPVGLWLNIPYDEFYSQ  184

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLS+R+FV+S +RR+ ++YISSPEV FL+S  SR     TKL+F+FLG ++ E STNQT
Sbjct  185   HNLSVRSFVISATRRMNVSYISSPEVGFLRSTVSRFRTGPTKLIFQFLGPNDIELSTNQT  244

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             Y SL +NL  IKTFASGILVPKSYIW VD S  YLQ  TSLVLDAH+  L+V+AS+FA+D
Sbjct  245   YSSLAKNLTFIKTFASGILVPKSYIWVVD-SGLYLQNYTSLVLDAHEASLQVFASNFAND  303

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
                A++YSYDPVAEYLSFIDNG +SVDGVLSD PIT S  IDC+SH+ K +  QV E L+
Sbjct  304   AFMAYNYSYDPVAEYLSFIDNGLFSVDGVLSDSPITASSTIDCHSHIAKNETAQV-ELLI  362

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             IS +GASGDYPGCTD AY+KAVSDGVDI+DC
Sbjct  363   ISSEGASGDYPGCTDKAYAKAVSDGVDILDC  393


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 86/333 (26%), Positives = 154/333 (46%), Gaps = 37/333 (11%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASN-V  543
             L+I+  G SG +P  +  AY+ A    +   I+ C VQ+T DG+  C   I L + SN V
Sbjct  361   LIISSEGASGDYPGCTDKAYAKAVSDGVD--ILDCPVQITNDGIPFCLGSINLMDKSNAV  418

Query  544   ATLFKDKQST----YLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRF-------D  687
              ++F +  +T     + +G+     F  +  + Q+ TL       YS  S F       D
Sbjct  419   ESIFSNMATTNPDLNIRDGI-----FAYNLTWSQIQTLKPAISNPYSNYSLFRNPRARND  473

Query  688   GTPQQILTVEDVFNKVQP-PGLWLNVQHDSFYSQ-HNLSMRTFVLSVSRRVVINYISSPE  861
             G   Q+       N      G+ +++++ ++ ++   L +   VL+  R+   N  +S +
Sbjct  474   GKFMQLTNFLAFGNNSSSVKGVLISIENAAYLAEKQGLGVTDAVLNALRKSGHNNQTSKK  533

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LASIKTFASGILVPKSY  1038
             +  +KS  S +  +     F+  GN E      +    +L + +  IK FA+ +++ K  
Sbjct  534   I-MIKSSDSAVLEK-----FKSSGNYELVYLVGEDISDILNSTIVEIKEFATAVVISKRS  587

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGN  1215
             ++P D+  SY+   TS+V       L VY   F ++ V  A+D+  D   E L+++D  N
Sbjct  588   VFPTDE--SYMTGQTSVVPKIQAFNLPVYVQIFQNEFVAQAWDFFSDAYLEMLNYVDAMN  645

Query  1216  YSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  1314
               ++GV++D+P T   A     +   G KN+ P
Sbjct  646   --INGVVTDYPAT---AAKFKRNRCLGYKNRPP  673



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   468 bits (1205),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 290/381 (76%), Gaps = 7/381 (2%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  456
              L    VT++A      + S W TL+G+AP ++A+GGFSGLFPDSS +AYSFA + S  +
Sbjct  20    FLFLQQVTVIA-----RNASAWLTLTGNAPAIVAKGGFSGLFPDSSHDAYSFALIASSPD  74

Query  457   VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  636
              I+WCDV+LTKDG+GIC PDIKLDN ++++ ++ + Q+ YLVNGV TT WF +D++ ++L
Sbjct  75    TILWCDVRLTKDGLGICLPDIKLDNCTDISNIYPNGQNVYLVNGVNTTGWFSVDYSIQEL  134

Query  637   TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVL  816
             + V + Q +YSR+ RFD     IL VEDV    +PPGLWLN+QHD FY QHNLSM  +VL
Sbjct  135   STVAVTQSIYSRTFRFDFNNYAILAVEDVVTNFEPPGLWLNIQHDIFYGQHNLSMTEYVL  194

Query  817   SVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLAS  996
             SVS+RV +NY+SSPE+ FL SIA+  +   TKLVFRFLG D  EPST+QTYGSLL NL  
Sbjct  195   SVSKRVPVNYLSSPELAFLSSIAADFSNSDTKLVFRFLGKDIAEPSTSQTYGSLLNNLTY  254

Query  997   IKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYD  1176
             IKTF SGILVPKSYIWPV  + +YL P TS+V DAHK+GLE+YA+DFA+D  F+++YSYD
Sbjct  255   IKTFVSGILVPKSYIWPV-TADNYLLPYTSIVKDAHKLGLEIYAADFANDNTFSYNYSYD  313

Query  1177  PVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDY  1356
             P+AEYLSF+DNG +SVDGV++DFPITPS AI C+SH+ K   +   + L+IS +GASGDY
Sbjct  314   PLAEYLSFVDNGVFSVDGVVTDFPITPSEAIGCFSHINKSVIDH-GKPLIISHNGASGDY  372

Query  1357  PGCTDXAYSKAVSDGVDIIDC  1419
             P CTD +Y KAV DG D IDC
Sbjct  373   PDCTDWSYQKAVDDGSDFIDC  393


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 133/312 (43%), Gaps = 26/312 (8%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKL--DNAS  537
             PL+I+  G SG +PD +   +S+       +  + C VQ+T+DG+ IC   I L  D   
Sbjct  360   PLIISHNGASGDYPDCT--DWSYQKAVDDGSDFIDCPVQVTQDGIAICMSSIDLIVDTTV  417

Query  538   NVATLFKDKQSTYLVNGVP-----TTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQ  702
               +       S   +   P        W  I  N K +      +    R+ R+      
Sbjct  418   TKSPFASRLSSIPEIQNTPGIFTFNLTWDEIQKNLKPIISNPESKYQLVRNPRY-ANAGS  476

Query  703   ILTVED--VFNKVQP-PGLWLNVQHDSFYSQH-NLSMRTFVLSVSRRVVINYISSPEVNF  870
              + + D   + K +P  G+ ++V++ +F ++    S+   V+S       N  ++ EV  
Sbjct  477   FMRLSDFLAYAKDKPLGGVLISVEYAAFMAEQLGFSVIDMVISALSDAGHNNQTAFEVMI  536

Query  871   LKSIASRINPRVTKLVFRFLGN-DETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             L + +S +     K  F+ +   DE+         ++  ++  IK FA  + + +  ++P
Sbjct  537   LSTNSSVLVEFRQKTKFKLVYKIDES------IRDAVASSIVEIKEFADAVAIDRQSVYP  590

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSV  1224
             V +  +  Q  T +V      GL VY   F ++ V   +D+  D   E  +++      V
Sbjct  591   VTQQFTTRQ--TDIVSKLQNAGLAVYVYLFQNEFVAQPWDFFSDATVEINTYVQGAG--V  646

Query  1225  DGVLSDFPITPS  1260
             DG+++DFP T S
Sbjct  647   DGIITDFPATAS  658



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   468 bits (1204),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 285/385 (74%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVT--LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A LTS
Sbjct  18    LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +++ +Y VNGV T  WFP DF+ 
Sbjct  78    VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPNDFSL  137

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
              +L    L +G+ SR+ RFDG    I T+EDV   +   G WLNVQHD+FY Q NLSM +
Sbjct  138   TELQNFLLIRGILSRTDRFDGNGYLISTIEDVVTTLNREGFWLNVQHDAFYEQQNLSMSS  197

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+LSVSR V I++ISSPEVNF K I           VF+FLG ++ EP+TN+TYGS+L N
Sbjct  198   FLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPTTNRTYGSILSN  257

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S FA+DV  A++Y
Sbjct  258   LTFVKTFASGILVPKSYILPLD-DEQYLVPHTSLVQDAHKAGLQVYVSGFANDVDIAYNY  316

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S DPV+EYLSF+DNG++SVDGVLSDFPIT S A+DC+SH+ +    QV +FLVIS DGAS
Sbjct  317   SSDPVSEYLSFVDNGDFSVDGVLSDFPITASAAVDCFSHIGRNATKQV-DFLVISKDGAS  375

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  376   GDYPGCTDLAYEKAIKDGADVIDCS  400



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   468 bits (1204),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 285/385 (74%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVT--LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V   L AAQ  +  STS+WQTL+GDAPLVIARGGFSGL+PDSS  AY  A LTS
Sbjct  18    LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGDAPLVIARGGFSGLYPDSSIAAYQLATLTS  77

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +++ +Y VNGV T  WFP DF+ 
Sbjct  78    VADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPNREKSYSVNGVTTKGWFPNDFSL  137

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
              +L    L +G+ SR+ RFDG    I T+EDV   +   G WLNVQHD+FY Q NLSM +
Sbjct  138   TELQNFLLIRGILSRTDRFDGNGYLISTIEDVVTTLNREGFWLNVQHDAFYEQQNLSMSS  197

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F+LSVSR V I++ISSPEVNF K I           VF+FLG ++ EP+TN+TYGS+L N
Sbjct  198   FLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPTTNRTYGSILSN  257

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S FA+DV  A++Y
Sbjct  258   LTFVKTFASGILVPKSYILPLD-DEQYLVPHTSLVQDAHKAGLQVYVSGFANDVDIAYNY  316

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S DPV+EYLSF+DNG++SVDGVLSDFPIT S A+DC+SH+ +    QV +FLVIS DGAS
Sbjct  317   SSDPVSEYLSFVDNGDFSVDGVLSDFPITASAAVDCFSHIGRNATKQV-DFLVISKDGAS  375

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  376   GDYPGCTDLAYEKAIKDGADVIDCS  400



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   465 bits (1197),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 295/387 (76%), Gaps = 15/387 (4%)
 Frame = +1

Query  283   LCSAVT--------LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             +CSAV         + AAQG+    S W+TLSGDAP +IA+GGFSGLFPDSS  AY FA 
Sbjct  7     VCSAVASFVLLWLGVAAAQGA----SSWKTLSGDAPAIIAKGGFSGLFPDSSEFAYQFAL  62

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  618
             + S  + I++CDV+LTKDG+G+C PDIKLDN +N+   + D + +YLVNGV TT WF +D
Sbjct  63    IASSPDTILYCDVRLTKDGLGVCLPDIKLDNCTNIPEFYADGKKSYLVNGVSTTGWFSVD  122

Query  619   FNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLS  798
             +N  +L+ V+L+Q +YSR+ RFD +   +L VEDV +K + PG+WLN+QHDSFYSQ N+S
Sbjct  123   YNGTELSQVSLKQSIYSRTPRFDPSFFPLLAVEDVASKFKSPGIWLNIQHDSFYSQFNMS  182

Query  799   MRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSL  978
             MR ++LSV++RVV++YISSPE +FL SI+ R++ + TKLVFRFL     EPST QTYGS+
Sbjct  183   MRNYILSVTKRVVVDYISSPEASFLTSISGRVSNK-TKLVFRFLDEATLEPSTKQTYGSM  241

Query  979   LQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFA  1158
             L+NL  +KTFASGILVPK YIWPV    +YLQP TS+V DAHK GLE+YA+DFA+D   +
Sbjct  242   LKNLTFVKTFASGILVPKKYIWPV-SPDNYLQPYTSIVDDAHKAGLEIYAADFANDFTLS  300

Query  1159  FDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFD  1338
             +++SYDP+ E LSFIDNG +SVDG+L+DFP+TPS AI C++++ K   +   + L+IS +
Sbjct  301   YNHSYDPLTESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTDH-GKPLIISHN  359

Query  1339  GASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             GASGDYPGCTD AY KAV DG D+IDC
Sbjct  360   GASGDYPGCTDLAYQKAVDDGADVIDC  386


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 84/337 (25%), Positives = 145/337 (43%), Gaps = 35/337 (10%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   + +K  T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  331   VTPSEAIGCFANLNKSNTDHGK-PLIISHNGASGDYPGCTDLAYQKA-VDDGADVID-CP  387

Query  475   VQLTKDGVGICFPDIKLDNASNVA--------TLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQ+TKDG+ +C   I L + + VA         + KD QS   V GV T    W  I  N
Sbjct  388   VQITKDGIPVCMGSINLMDGTTVAKSPFASQIAVMKDIQS---VLGVFTFNLTWEDIVKN  444

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH-NL  795
              K      L      R+ R+   G   ++    D        G+ ++++H +F ++    
Sbjct  445   LKPKISTPLSTFALDRNPRYRNAGNFMRLSDFLDFSKDKDLSGIMISIEHAAFLAEELGF  504

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRV---TKLVFRFLGNDETEPSTNQT  966
              M   V+        N  ++ ++  ++S  S +  +    TK    ++ N++   +   +
Sbjct  505   DMVDAVIKALDASGYNKQTAQKI-MIQSTNSSVLVKFKQQTKYDLVYMINEDVRDAAPSS  563

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
                    LA IK FAS + V    I+P  ++  +L   + LV       L +YA    ++
Sbjct  564   -------LADIKKFASAVSVDTGSIFP--ENHHFLTSPSGLVQSLKTANLSIYAYTLMNE  614

Query  1147  -VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
              +   +D+  D  A+  +++      VDG+++D+P T
Sbjct  615   FLSQPYDFFSDATAQINAYVQGAK--VDGLITDYPAT  649



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   466 bits (1198),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 228/383 (60%), Positives = 283/383 (74%), Gaps = 6/383 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24    LILIHLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
               ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF IDF  K 
Sbjct  81    GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPKRKNSYLVNGVPTQDWFTIDFTLKD  140

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
             L  V L +G+ SRS  FD     I TV+D+  +++P   WLNVQHD+FY+QHNLS+  F+
Sbjct  141   LKSVFLIRGILSRSDAFDNNQYAISTVQDIAMELKPKSFWLNVQHDAFYAQHNLSISKFM  200

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
             LS+ + V INY+SSPEV FL+SI  R      K VFRFL  D+ E STNQTYG+LL NL 
Sbjct  201   LSLPKTVTINYLSSPEVTFLRSIGGRFGKAGPKFVFRFLEKDDVEVSTNQTYGTLLGNLT  260

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              IKTFASG+LVPKSYIWP++    YL P TS V DAHK GLEVYAS FA+D   A++YS+
Sbjct  261   FIKTFASGVLVPKSYIWPLE--DQYLSPHTSFVQDAHKAGLEVYASGFANDFDMAYNYSF  318

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGD  1353
             DP+AEYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +FLVIS +GASGD
Sbjct  319   DPLAEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-DFLVISKNGASGD  377

Query  1354  YPGCTDXAYSKAVSDGVDIIDCT  1422
             YPGCTD AYSKA+ DG DIIDC+
Sbjct  378   YPGCTDLAYSKAIKDGADIIDCS  400



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   465 bits (1197),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/383 (60%), Positives = 283/383 (74%), Gaps = 6/383 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24    LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
               ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF IDF  K 
Sbjct  81    GAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYPKRKNSYLVNGVPTQDWFTIDFTLKD  140

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
             L  V L +G+ SRS  FD     I TV+D+  +++P   WLNVQHD+FY+QHNLS+  F+
Sbjct  141   LKSVFLIRGILSRSDAFDNNQYAISTVQDIAMELKPKSFWLNVQHDAFYAQHNLSISKFL  200

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
             LS+ + V INY+SSPEV FL+SI  R      K VFRFL  D+ E STNQTYG+LL NL 
Sbjct  201   LSLPKTVTINYLSSPEVTFLRSIGGRFGKAGPKFVFRFLEKDDVEVSTNQTYGTLLGNLT  260

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              IKTFASG+LVPKSYIWP++    YL P TS V DAHK GLEVYAS FA+D   A++YS+
Sbjct  261   FIKTFASGVLVPKSYIWPLE--DQYLSPHTSFVQDAHKAGLEVYASGFANDFDMAYNYSF  318

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGD  1353
             DP+AEYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +FLVIS +GASGD
Sbjct  319   DPLAEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-DFLVISKNGASGD  377

Query  1354  YPGCTDXAYSKAVSDGVDIIDCT  1422
             YPGCTD AYSKA+ DG DIIDC+
Sbjct  378   YPGCTDLAYSKAIKDGADIIDCS  400



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   462 bits (1188),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 291/391 (74%), Gaps = 7/391 (2%)
 Frame = +1

Query  250   WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  429
             W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8     WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  430   FAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  609
             FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  ++  Y VNGV T  WF
Sbjct  66    FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPSREKVYDVNGVRTPGWF  125

Query  610   PIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
              +D+   +LT  V L Q +YSR   FD     IL V+DV  + +PPGLWLN+QHD FY +
Sbjct  126   SVDYTLSELTQSVALTQAIYSRPDGFDNM-FPILAVDDV-TQFRPPGLWLNIQHDIFYRK  183

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNL+MR++VLSVSRRV++NYISSPEVNFL+SI +R     TKLVFRFL  D  EPSTNQT
Sbjct  184   HNLNMRSYVLSVSRRVIVNYISSPEVNFLRSIEARFRKSKTKLVFRFLNQDIPEPSTNQT  243

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YG LL+NL  IKTFASGILVPK YIW V  S +YLQ  TS+V+DAHK GLE++A+DFA+D
Sbjct  244   YGLLLKNLTFIKTFASGILVPKHYIWLV-TSDNYLQSYTSIVMDAHKAGLEIFAADFAND  302

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
                +++YSYDP++EYL FIDNG +SVDGVL+D+PITPS AI C+SH+ K   + V   L+
Sbjct  303   NIISYNYSYDPLSEYLYFIDNGFFSVDGVLTDYPITPSEAIGCFSHINKSSMDHVRP-LI  361

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  362   ISHNGASGDYPDCTDLAYQKAVKDGADVIDC  392



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   464 bits (1194),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 229/371 (62%), Positives = 287/371 (77%), Gaps = 5/371 (1%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL N+I+WCDVQLTK
Sbjct  27    ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  666
             DG GIC  +IKL+NA+++  +F+++  TY VNGV T+A+F +D+   +L + V L QG +
Sbjct  85    DGEGICISNIKLENATDIDKIFENRSKTYSVNGVQTSAYFAVDYTLTELRSNVLLIQGDF  144

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             +R+  FD    +ILTV ++       G WLN+Q+D+FY+QHNLSM+ FVLSVSR V ++Y
Sbjct  145   ARNPNFDDN-FEILTVNEMITITPASGPWLNIQYDAFYAQHNLSMKNFVLSVSRTVNVSY  203

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPE  FL+SI + INPR+TK+VFRFL  DE +PSTN+TYGSLL+NLASIKTFASGILV
Sbjct  204   ISSPEAGFLRSIKAHINPRITKVVFRFLEKDEVDPSTNRTYGSLLKNLASIKTFASGILV  263

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK YIWPVD +  YL P TSLV DAHKVGLEV+ASD  +D+P +++YSYDPVAEYL+FID
Sbjct  264   PKGYIWPVDPTGLYLLPHTSLVSDAHKVGLEVFASDILNDIPISYNYSYDPVAEYLNFID  323

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NGN+SVDGVLSDFP+TPS AIDC++H+      +V   LVIS  GASGDYP CTD AY K
Sbjct  324   NGNFSVDGVLSDFPLTPSEAIDCFAHIGLNSPKKV-NILVISKYGASGDYPPCTDLAYEK  382

Query  1387  AVSDGVDIIDC  1419
             A+SDGVD++DC
Sbjct  383   AISDGVDVLDC  393


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 138/308 (45%), Gaps = 24/308 (8%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI++ G SG +P  +  AY  A    +   ++ C VQ++KDG+  C   I L  +++VA
Sbjct  361   LVISKYGASGDYPPCTDLAYEKAISDGVD--VLDCPVQMSKDGIPFCLSSIDLIESTDVA  418

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQ----QILT  711
                  K    +         F  D  +  + +L       YS SS +         Q LT
Sbjct  419   LSSFSKLGKIIPEIKSGNGIFTFDLAWDDIKSLAPSMLNPYSTSSLYRNPKSNKKGQFLT  478

Query  712   VEDVFN--KVQPP--GLWLNVQHDSFYS-QHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
             + D  N  K Q    G+ + +++ ++ + + NLS+   V+    +   +   +P+V    
Sbjct  479   LLDFLNLTKAQTSLLGVVIIIENAAYLARKQNLSVTEAVIDTLSKAGYDKPGAPKVMIQS  538

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LASIKTFASGILVPKSYIWPVD  1053
             + +S +      L F+     E     ++     + + ++ IK FA  ++V K+ ++P  
Sbjct  539   TNSSVL------LKFKEKTKYELVYKIDEIIRDAVDSAISDIKRFAHSVVVKKASVYPDR  592

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             K   ++  +T +V       L VY   F+++ V  A+D+  D   E  +F+ +    +DG
Sbjct  593   K--QFVTGSTKIVPKFKSSNLTVYVETFSNEFVSQAWDFMSDATVEINTFVKDA--GIDG  648

Query  1231  VLSDFPIT  1254
             V++DFP T
Sbjct  649   VITDFPKT  656



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   463 bits (1191),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 276/364 (76%), Gaps = 3/364 (1%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGIC
Sbjct  40    SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FP + + N SNV   +  K+++YL+NGVPT  WF +DF  + L  V L +GV SRS+ FD
Sbjct  100   FPYVTMYNDSNVQEAYPKKKNSYLLNGVPTQDWFTVDFTSRDLNTVFLTRGVLSRSNAFD  159

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
              T   I TV++V ++ +P G WLNVQHD+FY+QHNLSM +F+L+VS+ V+I+Y+SSPEV+
Sbjct  160   NTQNVISTVQEVASEFKPAGFWLNVQHDAFYTQHNLSMSSFLLTVSKTVIIDYLSSPEVS  219

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             F ++I  R      K VFRFL  D+ E STNQTYGSL++NL  IKTFASG+LVPKSYIWP
Sbjct  220   FFRNIGGRFGKTGPKFVFRFLDKDDVEVSTNQTYGSLMKNLTFIKTFASGVLVPKSYIWP  279

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V     YL P TS V DAH  GL+VY S FA+D   A++YSYDP+ EYLSF+DNG++SVD
Sbjct  280   V--KDQYLLPHTSFVRDAHTAGLQVYGSGFANDFDIAYNYSYDPLTEYLSFMDNGDFSVD  337

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             G LSDFP+T S AIDC+SH+      QV +FLVIS +GA+GDYPG TD AY+KA+ DG D
Sbjct  338   GFLSDFPLTASSAIDCFSHLGSNASTQV-DFLVISKNGANGDYPGSTDLAYTKAIKDGAD  396

Query  1408  IIDC  1419
             IIDC
Sbjct  397   IIDC  400



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   476 bits (1226),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/386 (60%), Positives = 286/386 (74%), Gaps = 6/386 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTN---STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             + LLC  V +    G T+   S   WQTLSGDAPLVIARGGFSGLFPDSS  AYSF   T
Sbjct  44    MFLLCGVVLIQLFAGQTDAQRSRGPWQTLSGDAPLVIARGGFSGLFPDSSLKAYSFVKQT  103

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             S+    +WCDVQLTKDG GICFPD+KL+NAS +  ++ +++ +YLVNGVPT  WF I+F+
Sbjct  104   SVAGAALWCDVQLTKDGAGICFPDLKLNNASTIDFVYPNRKKSYLVNGVPTQGWFTIEFS  163

Query  625   FKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
              ++L+ V L +G+  RS +FDG    I TV DV  +++P   WLNVQHD+FY+Q NLSM 
Sbjct  164   LRELSNVTLNRGILFRSEKFDGI-YPISTVGDVTTQIKPESFWLNVQHDAFYAQQNLSMS  222

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F++S SR V I+Y+SSPEVNF K IA    P     VF+FLG +E EP+TN+TYGS+L 
Sbjct  223   SFLISASRNVSIDYVSSPEVNFFKKIAGDFGPNGPSFVFQFLGKEEFEPTTNRTYGSILS  282

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S FA+D+  A D
Sbjct  283   NLTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLQVYVSGFANDIDIAHD  341

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DPV EYLSF+DNGN+SVDGVLSDFPIT S +I+C+SH+ K    QV +FLVIS +GA
Sbjct  342   YSFDPVTEYLSFVDNGNFSVDGVLSDFPITASSSIECFSHLGKNATKQV-DFLVISKNGA  400

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SGDYPGCTD AY KA+ DG D+IDC+
Sbjct  401   SGDYPGCTDMAYDKAIKDGADVIDCS  426



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   462 bits (1188),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 291/391 (74%), Gaps = 7/391 (2%)
 Frame = +1

Query  250   WKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYS  429
             W++  +    L    + LV AQG TNS S+WQTLSG+AP +IA+GGFSGLFPDSS  A+ 
Sbjct  8     WEVSFLVAFFLAVQHLGLVTAQG-TNS-SRWQTLSGNAPAIIAKGGFSGLFPDSSAYAFQ  65

Query  430   FAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWF  609
             FA   S ++ I+WCDVQLT D VGIC PDIKL+N +N+A+++  ++  Y VNGV T  WF
Sbjct  66    FALAISSSDTILWCDVQLTMDKVGICVPDIKLNNCTNIASVYPSREKVYDVNGVRTPGWF  125

Query  610   PIDFNFKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
              +D+   +LT  V L Q +YSR   FD     IL V+DV  + +PPGLWLN+QHD FY +
Sbjct  126   SVDYTLSELTQSVALTQAIYSRPDGFDNM-FPILAVDDV-TQFRPPGLWLNIQHDIFYRK  183

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNL+MR++VLSVSRRV++NYISSPEVNFL+SI +R     TKLVFRFL  D  EPSTNQT
Sbjct  184   HNLNMRSYVLSVSRRVIVNYISSPEVNFLRSIEARFRKSKTKLVFRFLNQDIPEPSTNQT  243

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YG LL+NL  IKTFASGILVPK YIW V  S +YLQ  TS+V+DAHK GLE++A+DFA+D
Sbjct  244   YGLLLKNLTFIKTFASGILVPKHYIWLV-TSDNYLQSYTSIVMDAHKAGLEIFAADFAND  302

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
                +++YSYDP++EYL FIDNG +SVDGVL+D+PITPS AI C+SH+ K   + V   L+
Sbjct  303   NIISYNYSYDPLSEYLYFIDNGFFSVDGVLTDYPITPSEAIGCFSHINKSSMDHVRP-LI  361

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  362   ISHNGASGDYPDCTDLAYQKAVKDGADVIDC  392


 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 141/315 (45%), Gaps = 35/315 (11%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  543
             PL+I+  G SG +PD +  AY  A +    +VI  C VQ+TKDG+ IC   I L + + V
Sbjct  359   PLIISHNGASGDYPDCTDLAYQKA-VKDGADVID-CPVQVTKDGILICMSSIDLLSDTTV  416

Query  544   A-TLFKDKQSTYL-VNGVPTTAWFPIDFNFKQLTLVNL----QQGVYS--RSSRFDGTPQ  699
               + F  + S    + G P    F +  +  Q  L+      + G Y+  R+ R+     
Sbjct  417   TRSPFSSRTSIIPDIKGTPGIYTFNLTLDEIQKYLLPTISAPELGGYNLVRNPRYKNK-G  475

Query  700   QILTVED--VFNKVQP-PGLWLNVQHDSFYSQH-NLSMRTFVLSVSRRVVINYISSPEVN  867
                T+ D   F K +   G+ + ++H +F ++    S+   V++ +     N   +P V 
Sbjct  476   NFTTLNDFLAFAKDKDLSGILITIEHAAFMAEKLQFSVTDAVINATSSAGYNNQITPAV-  534

Query  868   FLKSIASRINPRVT-----KLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPK  1032
              ++S  S +  +       KLV++    DET         ++  ++  IK FA  + +  
Sbjct  535   MIQSTNSSVLKKFKQQTKYKLVYKI---DET------VRDAVNSSIEDIKEFADSVAIDT  585

Query  1033  SYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDN  1209
               I+P  ++  ++   T +V   HK  L VY     ++ V   +D+  D   +  SF   
Sbjct  586   DSIYP--ETQLFIATQTDIVNKLHKHNLSVYVYLLQNEFVSQPWDFFSDATVQINSFFKG  643

Query  1210  GNYSVDGVLSDFPIT  1254
                 VDG+++DFP T
Sbjct  644   A--EVDGIITDFPGT  656



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   462 bits (1188),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 230/386 (60%), Positives = 286/386 (74%), Gaps = 6/386 (2%)
 Frame = +1

Query  277   LLLCSAVT--LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V   L A Q  +  STS+WQTLSGDAPLVIARGGFSGL PDSS  AY+ A LTS
Sbjct  18    LLFCGVVMIQLFATQIDAEGSTSRWQTLSGDAPLVIARGGFSGLLPDSSLVAYNLATLTS  77

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +T+V++WCDVQLTKDG GICFPD+ + NASN+  ++ +++++Y VNGV T  WF ID   
Sbjct  78    VTSVVLWCDVQLTKDGAGICFPDLNMANASNIDVVYPNRKNSYPVNGVTTQGWFAIDSTL  137

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMR  804
             + L  V L +G+ SRS +FDG    I T++ V   ++P  G WLNVQHD+FY Q NL M 
Sbjct  138   RDLQNVALIRGILSRSDKFDGNGYPISTIQSVNEHIKPQGGFWLNVQHDAFYEQQNLIMS  197

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F+LS SR V IN+ISSPEVNF K IA R        VF+FL N++ EP+TNQTYGS+L 
Sbjct  198   SFLLSASRTVSINFISSPEVNFFKKIAGRFKRNGPSFVFQFLRNEDFEPTTNQTYGSILG  257

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEVY S FASDV  A++
Sbjct  258   NLTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLEVYVSGFASDVDIAYN  316

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+SH+ +    QV +FLVIS DGA
Sbjct  317   YSFDPVSEYLSFVDNGDFSVDGMLSDFPLTESASIDCFSHIGRNATKQV-DFLVISKDGA  375

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SG+YP CT+ AY KA+ DG ++IDC+
Sbjct  376   SGEYPRCTNLAYDKAIRDGANVIDCS  401



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   462 bits (1188),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 276/364 (76%), Gaps = 3/364 (1%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             S S WQTL+G+APLVIARGGFSGLFPDSSFNAYSF   TS  + ++WCDVQLTKDGVGIC
Sbjct  40    SKSPWQTLTGEAPLVIARGGFSGLFPDSSFNAYSFVASTSAPDAVLWCDVQLTKDGVGIC  99

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FP + + N SNV   +  K+++YL+NGVPT  WF +DF  + L  V L +GV SRS+ FD
Sbjct  100   FPYVTMYNDSNVQDAYPKKKNSYLLNGVPTQDWFTVDFTSRDLNTVFLTRGVLSRSNAFD  159

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
              T   I TV++V ++ +P G WLNVQHD+FY+QHNLSM +F+L+VS+ V+I+Y+SSPEV+
Sbjct  160   NTQNVISTVQEVASEFKPAGFWLNVQHDAFYTQHNLSMSSFLLTVSKTVIIDYLSSPEVS  219

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             F ++I  R      K VFRFL  D+ E STNQTYGSL++NL  IKTFASG+LVPKSYIWP
Sbjct  220   FFRNIGGRFGKTGPKFVFRFLDKDDVEVSTNQTYGSLMKNLTFIKTFASGVLVPKSYIWP  279

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V     YL P TS V DAH  GL+VY S FA+D   A++YSYDP+AEYLSF+DNG++SVD
Sbjct  280   V--KDQYLLPHTSFVRDAHTAGLQVYGSGFANDFDIAYNYSYDPLAEYLSFMDNGDFSVD  337

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             G LSDFP T S A+DC+SH+      QV +FLVIS +GA+GDYPG TD AY+KA+ DG D
Sbjct  338   GFLSDFPSTASSAVDCFSHLGSNASTQV-DFLVISKNGANGDYPGSTDLAYTKAIKDGAD  396

Query  1408  IIDC  1419
             IIDC
Sbjct  397   IIDC  400



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   462 bits (1188),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 232/385 (60%), Positives = 282/385 (73%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVT--LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             +LLC  V   L AAQ     S S WQTLSGDAPLVIARGGFSGLFPDSS  AYSFA  TS
Sbjct  15    VLLCGIVLAHLFAAQIDGQRSRSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYSFAMQTS  74

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +    +WCDVQLTKDG+GICFPD+ L+NAS +  ++  +Q +Y VNGV T  WF IDF+ 
Sbjct  75    VAGSALWCDVQLTKDGLGICFPDLTLNNASTIEFVYPSRQKSYPVNGVRTRGWFTIDFSL  134

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
               L  V+L +G+YSRS +FD     ILTV+ V    +    WLNVQHD+FY QHNLSM +
Sbjct  135   SDLNNVSLIRGIYSRSEKFDENGYSILTVQIVTTLKEQEVFWLNVQHDAFYEQHNLSMSS  194

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++S SR V I+YISSPE+NF + +A R        VFRFLG ++ EP+TN+TYGS+L N
Sbjct  195   FLISASRTVSIDYISSPELNFFRKVAGRFGRDGPIFVFRFLGKEDFEPTTNRTYGSILSN  254

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S FA+DV  A+ Y
Sbjct  255   LTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLKVYVSGFANDVDIAYTY  313

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNG +SVDGVLSDFPIT S +I+C+SH+ +    QV +FLVIS +GAS
Sbjct  314   SFDPVSEYLSFVDNGYFSVDGVLSDFPITASASIECFSHISRNATKQV-DFLVISKNGAS  372

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  373   GDYPGCTDLAYEKAIQDGADVIDCS  397



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   461 bits (1186),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 227/387 (59%), Positives = 294/387 (76%), Gaps = 8/387 (2%)
 Frame = +1

Query  280   LLCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             +L S+V L+   AAQ  + +S S WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6     VLLSSVVLIQLFAAQIDAKSSRSPWQTLSGDAPLVIARGGFSGLFPDSSSVAYKFAKQTS  65

Query  448   L--TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  621
             +  T+ ++WCDVQLTKDG GICFPD+KL+NASN+  LF ++Q+ Y VNGV +  WF IDF
Sbjct  66    VAGTSSVLWCDVQLTKDGHGICFPDLKLNNASNIGDLFPNRQNFYPVNGVTSQGWFTIDF  125

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
             + + L   +L +G++SRS +FDG    ILTV+DV  +++P   WLN+QHD+FY+QHNLS+
Sbjct  126   SLRDLKNASLIRGIFSRSEKFDGNGYSILTVQDVSMQIKPESFWLNIQHDAFYAQHNLSI  185

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
              +F++S SR V I+YISSP++NF   +  R        VF+FLG +E EP+T +TYGS+L
Sbjct  186   SSFLISASRTVSIDYISSPKLNFFSKVKGRFWRNEPSFVFQFLGKEEFEPTTKRTYGSIL  245

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL++Y S FA+DV  A+
Sbjct  246   SNLTYVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLKLYVSGFANDVDIAY  304

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             +YS+DPV+EYLSF++NG +SVDGVLSDFPIT S +IDC+SH+ +  + Q+ +FLVI+ +G
Sbjct  305   NYSFDPVSEYLSFVNNGYFSVDGVLSDFPITASTSIDCFSHIGRNARKQM-DFLVITKNG  363

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  364   ASGDYPGCTDLAYEKAIQDGADVIDCS  390



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   461 bits (1185),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 219/383 (57%), Positives = 295/383 (77%), Gaps = 8/383 (2%)
 Frame = +1

Query  271   NLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             +L+LL   V   A +GS+     W+TL+G+AP +IA+GGFSG+FPDSS  AY FA + S 
Sbjct  12    SLVLLWLGVAAAAQKGSS-----WKTLNGNAPAIIAKGGFSGIFPDSSEFAYQFALIASS  66

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
             ++ I++CDV+LTKDG+GIC PDIK+DN +N+   ++    +YLVNGV T  WF +D+N  
Sbjct  67    SDTILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGSKSYLVNGVSTAGWFSVDYNGT  126

Query  631   QLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTF  810
             +L  V+L+Q ++SR+ RFD +   IL VED+ +K +PPGLWLNVQHDSFYSQ NLSM  +
Sbjct  127   ELGQVSLKQSIFSRTPRFDRSFFPILAVEDIASKFKPPGLWLNVQHDSFYSQFNLSMTNY  186

Query  811   VLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNL  990
             +LSVS+RV++ YISSPEV+FL  ++ ++    TKLVFRFL     EPST QTYGS+L+NL
Sbjct  187   ILSVSKRVIVGYISSPEVSFLTKVSGKVRNN-TKLVFRFLDESTIEPSTKQTYGSMLKNL  245

Query  991   ASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYS  1170
               +KTFASGI+VPK+YIWPV    +YL+P TS+V DAHK GLE+YA+DFA+D  F++++S
Sbjct  246   TFVKTFASGIIVPKNYIWPV-SPDNYLEPYTSVVDDAHKAGLEIYAADFANDFMFSYNHS  304

Query  1171  YDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASG  1350
             YDP+AEYLSFIDNG++SVDGVL+DFP+TPS AI C++++ K +K+   + L+IS +GASG
Sbjct  305   YDPLAEYLSFIDNGDFSVDGVLTDFPVTPSEAIGCFTNLNKSKKDH-GKPLIISHNGASG  363

Query  1351  DYPGCTDXAYSKAVSDGVDIIDC  1419
             DYP CTD AY KAV DG D++DC
Sbjct  364   DYPACTDLAYQKAVDDGADVVDC  386


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 152/356 (43%), Gaps = 63/356 (18%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  543
             PL+I+  G SG +P  +  AY  A +    +V+  C VQLTKDG+ IC   + L + + V
Sbjct  353   PLIISHNGASGDYPACTDLAYQKA-VDDGADVVD-CPVQLTKDGIPICISSVNLMDDTTV  410

Query  544   A--------TLFKDKQSTYLVNGVPT--TAWFPIDFNFKQLTLVNLQQGVYSRSSRFD--  687
             A         + KD +S   V GV T    W  I  N +             R+ R+   
Sbjct  411   AKSQFASQTAVIKDIES---VLGVFTFNLTWDDIVKNLRPKISTPFSSFKLDRNPRYRNA  467

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ-----------HNLSMRTFVLSVSRRV  834
             G   ++    D     +  G+ +NV+H +F ++             L    +    +++V
Sbjct  468   GNFMRLSDFLDFTKDKELSGIMINVEHAAFAAEKLGFDMVDAVIKTLDAAGYSNQTAQKV  527

Query  835   VINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDE---TEPSTNQTYGSLLQNLASIKT  1005
             +I   +S  +   K        + TK    ++ N+E    EPS+          LA+IK 
Sbjct  528   MIQSANSSVLVKFK--------QQTKYDLVYMVNEEVKDAEPSS----------LAAIKK  569

Query  1006  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA----SDFASDVPFAFDYSY  1173
             FA  + V  S I+P  ++  +    T+LV   HK GL VY     ++FAS     +D+  
Sbjct  570   FADAVSVEGSSIFP--ENHHFTTYRTNLVESLHKAGLPVYVYTLMNEFASQ---PYDFFS  624

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             D  A+  +++      VDGV++DFP T +      + M  G  N  P F+  +  G
Sbjct  625   DATAQINAYVQGAG--VDGVITDFPAT-ARRYKLNTCMNMG--NNTPSFMAPAHPG  675



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   457 bits (1177),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 217/364 (60%), Positives = 281/364 (77%), Gaps = 4/364 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P
Sbjct  27    SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             ++ L N++N+  +F +K ++YLVNG  T  +F +D++F+ L+ V + QGV+SRS   DG 
Sbjct  87    NLNLLNSTNIFGVFPNKTTSYLVNGESTAGYFSVDYSFEDLSTVTVTQGVFSRSPLLDGN  146

Query  694   PQQILTVEDVFNKVQP--PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
                I TV++V   V P  PGLWLN+QHD+FYSQHNLSMR+FVL+VSRR+ ++YISSPE  
Sbjct  147   NFIINTVDEVLKLVAPQTPGLWLNIQHDAFYSQHNLSMRSFVLAVSRRLHVSYISSPEAG  206

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FL+SI  R NP+ TKLVFRFL  ++T+PSTNQTYGS L+NL  IKTFASGILVPK YIWP
Sbjct  207   FLRSITKRFNPKTTKLVFRFLNQEDTDPSTNQTYGSFLKNLTFIKTFASGILVPKGYIWP  266

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             VD +S YLQP TSLV DAHK GLEV+A+DF++D+  +++YS+DP+AE L FIDNG ++VD
Sbjct  267   VD-ASLYLQPHTSLVSDAHKAGLEVFAADFSNDIVISYNYSFDPLAESLQFIDNGEFTVD  325

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVL+DFP+TPS AIDC++H+      +  + L+IS  GASGD+P CT+ AY+KA+ DGVD
Sbjct  326   GVLTDFPLTPSAAIDCFAHIGNNATRR-DKTLIISKYGASGDFPACTNLAYNKAIQDGVD  384

Query  1408  IIDC  1419
             ++DC
Sbjct  385   VLDC  388



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 287/392 (73%), Gaps = 4/392 (1%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQG-STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M+  R+   +L +   + L+  Q  +  S S WQTL+G+APL+IARGGFSG+FPDSSFNA
Sbjct  12    MFGFRASKFILSVLVLIQLLPTQLLAQRSKSPWQTLTGEAPLIIARGGFSGMFPDSSFNA  71

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
             YSF   TS  + ++WCDVQLTKDGVGICFP + + N SNV   +   +++YL+NGV T  
Sbjct  72    YSFVASTSAPDAVLWCDVQLTKDGVGICFPYVTMYNDSNVRDAYPKNKNSYLLNGVLTQD  131

Query  604   WFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             WF +DF  K L  V L +GV SRS+ FD     I TV+DV  + +P G WLNVQHD+FY+
Sbjct  132   WFTVDFTSKDLNTVFLTRGVLSRSNAFDNNQNVISTVQDVATEFKPAGFWLNVQHDAFYT  191

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             QHNLSM +F+LSVS+ V+I+Y+SSPEV+F ++I +R      K VFRFL  D+ E STNQ
Sbjct  192   QHNLSMSSFLLSVSKTVIIDYLSSPEVSFFRNIGARFGKTGPKFVFRFLDKDDVEVSTNQ  251

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYG+L++NL  IKTFASG+LVPKSYIWPV     YL P TS V DAHK GLEVYAS FA+
Sbjct  252   TYGALMRNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFVRDAHKAGLEVYASGFAN  309

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D   A++YSYDP+ EYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +FL
Sbjct  310   DFDIAYNYSYDPLTEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-DFL  368

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             VIS +GA+GDYPG TD AY+KA+ DG DIIDC
Sbjct  369   VISKNGANGDYPGSTDLAYTKAIKDGADIIDC  400



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   460 bits (1184),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/374 (61%), Positives = 285/374 (76%), Gaps = 6/374 (2%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             V+AQ  TN  S W TL+G+ PLVIA GGFSG+FPDSS  AYS A  TSL +V +WCDVQL
Sbjct  26    VSAQ--TNKRSDWNTLTGNPPLVIAHGGFSGIFPDSSGAAYSLALQTSLPDVALWCDVQL  83

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  663
             TKD  GIC P++ L N++ V+    +K ++Y VNGV T  +F +D+  + L+ V L QGV
Sbjct  84    TKDAAGICLPNVNLLNSTYVSIAIPNKTTSYSVNGVSTRGYFSVDYTLEDLSNVFLSQGV  143

Query  664   YSRSSRFDGTPQQILTVEDVFNKVQP--PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVV  837
             +SRS+  D     ILTV+DV   V P  P LWLN+QHD+FY+QH LSMR++VLSVSRRV 
Sbjct  144   FSRSALLDANGYLILTVDDVVKSVAPQKPNLWLNIQHDAFYTQHKLSMRSYVLSVSRRVP  203

Query  838   INYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASG  1017
             ++YISSPEV FL+SI +R +P++TKLVFRFL  D+T+PSTNQTYGSLL+NL  IKTFASG
Sbjct  204   VSYISSPEVGFLRSITTRFDPKITKLVFRFLNQDDTDPSTNQTYGSLLKNLTFIKTFASG  263

Query  1018  ILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLS  1197
             ILVPK YIWPVD +S YLQ  T+LV DAHK GLEVYASDF++DV  +++YSYDP+AEYL 
Sbjct  264   ILVPKEYIWPVD-ASLYLQQHTTLVSDAHKAGLEVYASDFSNDVVNSYNYSYDPLAEYLQ  322

Query  1198  FIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXA  1377
             FIDNG++SVDGVL+DFPITPS AI C++H+      +  + L+IS  GASGDYP CTD A
Sbjct  323   FIDNGDFSVDGVLTDFPITPSEAIGCFAHL-GANATRKDKTLIISKYGASGDYPACTDLA  381

Query  1378  YSKAVSDGVDIIDC  1419
             Y  A+ DG D++DC
Sbjct  382   YKNAILDGADVLDC  395



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   459 bits (1181),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 224/382 (59%), Positives = 291/382 (76%), Gaps = 9/382 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L+LL   V   AAQ +T+    W+TLSG AP ++A+GGFSGLFPDSS +AY F   +S  
Sbjct  13    LMLLWLGV--AAAQKATS----WKTLSGKAPAIVAKGGFSGLFPDSSPDAYGFVQYSSSP  66

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             + +++CDV+LTKD VG+C PDIK+DN +N+A ++   Q +YLVNGVPT+ WF +D+N  +
Sbjct  67    DTVLYCDVRLTKDEVGLCLPDIKMDNCTNIADIYAQGQKSYLVNGVPTSGWFSVDYNNTE  126

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
             L  V+L Q + SRS RFD      L VEDV +K +PPG+WLNVQHD FYSQ NLSMR ++
Sbjct  127   LGQVSLIQSIASRSPRFDSNFYPPLAVEDVRSKFKPPGIWLNVQHDRFYSQFNLSMRNYI  186

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
             +SVS+RVV+NYISSPEV+FL S+  R++ + TKLVFR+L     EPS NQTYGS+L+NL 
Sbjct  187   ISVSKRVVVNYISSPEVSFLTSVLGRVSKK-TKLVFRYLDESTLEPSMNQTYGSMLKNLT  245

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              +KTFASGILVPKSYIWP   + +YLQP TS+V DAHK GLE+YA+DFA+D   +++YSY
Sbjct  246   FVKTFASGILVPKSYIWPT-SADNYLQPHTSVVNDAHKAGLEIYAADFANDFMISYNYSY  304

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGD  1353
             DP+AE L+FIDNG +SVDGVL+DFP+TPS AI C++++ K   +   + L+IS +GASGD
Sbjct  305   DPLAECLTFIDNGVFSVDGVLTDFPVTPSEAIGCFTNLNKSNTDH-GKPLIISHNGASGD  363

Query  1354  YPGCTDXAYSKAVSDGVDIIDC  1419
             YPGCTD AY KAV DG D+IDC
Sbjct  364   YPGCTDLAYQKAVDDGADVIDC  385


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 143/336 (43%), Gaps = 33/336 (10%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   + +K  T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  330   VTPSEAIGCFTNLNKSNTDHGK-PLIISHNGASGDYPGCTDLAYQKA-VDDGADVID-CP  386

Query  475   VQLTKDGVGICFPDIKLDNASNVA--------TLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQ+TKDGV +C   + L + + VA         + K+ QS     GV T    W  I  N
Sbjct  387   VQVTKDGVLVCMSSVNLMDDTTVARSQFASQTAVIKEIQS---ARGVFTFNLTWDDIVKN  443

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH-NL  795
              + +    L      R+ R+   G   ++    D        G+ ++++H +F ++    
Sbjct  444   LRPIISTPLSTYRMDRNPRYRNAGKFMRLSDFLDFTKNKDLSGIMISIEHATFVAEELGF  503

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRIN--PRVTKLVFRFLGNDETEPSTNQTY  969
              M   V+        N  ++ +V    + +S +    + TK    ++ N+E   +T  + 
Sbjct  504   DMVDTVIKALGDAGYNNQTTQKVMIQSTNSSVLEKFKQQTKYDLVYMINEEVRDATPSS-  562

Query  970   GSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-  1146
                   L  IK FAS + V  S ++P  +   +    T+LV      GL VY     ++ 
Sbjct  563   ------LVDIKKFASAVSVDTSSVFP--EPHHFTMYKTNLVQTLQTAGLSVYVYTLMNEF  614

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
             V   +D+  D   +  +++      VDG+++DFP T
Sbjct  615   VSQPYDFFADATVQINAYVKGAG--VDGLITDFPAT  648



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   458 bits (1179),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 228/367 (62%), Positives = 283/367 (77%), Gaps = 3/367 (1%)
 Frame = +1

Query  322   TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  501
             TNST+ W TL+G  PLVIARGGFSG+FPDSS  AY FA  T L N+I WCDVQLTKD  G
Sbjct  31    TNSTT-WNTLTGAPPLVIARGGFSGIFPDSSDLAYIFAVRTGLKNLIAWCDVQLTKDRQG  89

Query  502   ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSS  678
             ICFPDIKL+NA+++   F ++  TY VNGVPTTA+F +D+  + L + V L QG YSR++
Sbjct  90    ICFPDIKLENATDINYAFPNRSQTYPVNGVPTTAYFAVDYTLEDLRSYVVLTQGDYSRTN  149

Query  679   RFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSP  858
              FD    +ILTV D+  +  PPGLWLN+QHD FY++HNLSM+ ++LSVSR V ++YISSP
Sbjct  150   LFDYNLFEILTVSDLVKRAAPPGLWLNIQHDLFYTKHNLSMKNYILSVSRTVNVSYISSP  209

Query  859   EVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSY  1038
             E  FL+SI ++IN R TKLVFRFL  ++ +PST+  YGSLL+NL SIK FASGILVPK Y
Sbjct  210   EAGFLRSIRTQINQRKTKLVFRFLKKNDVDPSTSLMYGSLLKNLTSIKAFASGILVPKEY  269

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNY  1218
             IWPV  ++ YL   TSLV DAHKVGLEV+ASDF +D+P +F+YSYDPVAEYL+FIDN N+
Sbjct  270   IWPVHPTNLYLLSHTSLVSDAHKVGLEVFASDFQNDIPISFNYSYDPVAEYLNFIDNENF  329

Query  1219  SVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSD  1398
             SVDGVLSDFP+T S AIDC++H+      +V + LVIS  GASGDYP CT+ AY  ++SD
Sbjct  330   SVDGVLSDFPLTSSEAIDCFAHVGLNATKKV-KTLVISKYGASGDYPPCTNLAYENSISD  388

Query  1399  GVDIIDC  1419
             G DI+DC
Sbjct  389   GADILDC  395


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 147/330 (45%), Gaps = 37/330 (11%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A    N+T K +TL      VI++ G SG +P  +  AY  +   S    I+ C VQ+++
Sbjct  350   AHVGLNATKKVKTL------VISKYGASGDYPPCTNLAYENS--ISDGADILDCPVQMSQ  401

Query  490   DGVGICFPDIKLDNASNVA-TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             DG+  C   I L  ++NVA T+F ++  T  +     +  F  D  ++ +   NL   ++
Sbjct  402   DGIPFCLRSIDLIESTNVAQTIFSNRSKTIPIKS--GSGIFAFDLAWEDIK--NLTPSMF  457

Query  667   SRSSRFD-------GTPQQILTVEDVFNKVQPPGLWLNV-----QHDSFYSQHNLSMRTF  810
             +  S +            + L + D  N ++     L         D    + NLS+   
Sbjct  458   NPYSNYHLFRNQEYNKQGKFLRLTDFLNLIKGQTSLLGAVIIIENADYLAREKNLSVTDA  517

Query  811   VLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-  987
             V+   R+   +   +P V  ++S  S +      L F+   N E     ++  G  + + 
Sbjct  518   VIDTLRKAGYDKQGAPNV-MIQSTNSSV-----LLKFKEKTNYELVYRIDEIVGDAVDSA  571

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  1164
             +  IK FA  +++ KS ++P++    +L  +T +V       + VY   F+++ V  A+D
Sbjct  572   IRDIKRFAHSVILHKSSVYPLN--DFFLTGSTKIVPKFKSSNISVYVETFSNEFVSSAWD  629

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
             +  D   E  +F+ +    +DGV++DFP T
Sbjct  630   FLSDSTVEINTFVQDA--EIDGVITDFPKT  657



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   458 bits (1179),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 227/386 (59%), Positives = 286/386 (74%), Gaps = 6/386 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL CS V   L AAQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AY+ A  TS
Sbjct  16    LLFCSVVLIQLFAAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             +  V++WCDVQLTKDG GICFP++ + NASN+  ++ + Q +Y VNGV T  WF ID   
Sbjct  76    VAEVVLWCDVQLTKDGAGICFPELNMANASNIDFVYPNGQKSYPVNGVTTQGWFAIDSTL  135

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMR  804
             + L  V L +G+ SRS++FDG    I T+++V  +++P  G WLNVQHD+FY QHNLSM 
Sbjct  136   RDLQNVILTRGILSRSNKFDGNGYTIPTIQNVTEQMKPEGGFWLNVQHDAFYEQHNLSMS  195

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F+L  SR V +++ISSPEVNF K IA R        VF+FLG ++ EP+TNQTYG +L 
Sbjct  196   SFILXASRTVSMDFISSPEVNFFKKIAGRFKRNGPSFVFQFLGKEDFEPTTNQTYGFILS  255

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  +KTFASGILVPKSYI+ +D    YL P TSLV DAHK GLEVY S FA+DV  A +
Sbjct  256   NLTFVKTFASGILVPKSYIFQLD-DKQYLIPHTSLVQDAHKAGLEVYVSGFANDVDIAHN  314

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC++H+ +    QV +FLVIS DGA
Sbjct  315   YSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASASIDCFAHIGRNATKQV-DFLVISKDGA  373

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  374   SGDYPGCTNFAYEKAIKDGADVIDCS  399



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   457 bits (1177),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 283/382 (74%), Gaps = 10/382 (3%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             LL L    TL      T S+S W TL+G+ P+VIARGGFSG+FPDSS  AY  A +TS  
Sbjct  12    LLFLIHFFTL-----QTTSSSSWLTLNGEPPVVIARGGFSGMFPDSSIVAYDSATVTSTP  66

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NV +WCD+QL KD +G CFP +  +N SN+  +F  ++ +Y+VNGVP+  WFP+D+   +
Sbjct  67    NVTLWCDLQLAKDDIGFCFPHLSFENGSNIEYVFPGQKKSYIVNGVPSKGWFPVDYTIDE  126

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
             L  + L Q +YSR   FD     I TVE+V N      LWLN+QH +FYSQHNLSMR +V
Sbjct  127   LFTLTLTQDIYSRPPIFDDI-YSIATVEEVANASS--SLWLNIQHTAFYSQHNLSMRNYV  183

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
             LSVS+ V ++YISSPE++FL+SI      R+TKL+FRFL  DE EPS+N TYG L++NL+
Sbjct  184   LSVSKHVAVSYISSPEISFLQSIKKNFARRMTKLIFRFLEQDEIEPSSNLTYGHLMKNLS  243

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              I+TF+SGILVPKS+IWPVD +  YL P TSLV DAHK G+EV+AS+FA+DV FA++YSY
Sbjct  244   YIRTFSSGILVPKSFIWPVD-AEFYLLPHTSLVTDAHKEGIEVFASEFANDVLFAYNYSY  302

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGD  1353
             DP+AEYLSFIDNGN+SVDG+LSD+PITP  AI+C+ H+    K Q  EF +IS +GASGD
Sbjct  303   DPLAEYLSFIDNGNFSVDGILSDYPITPYQAINCFCHLNTDAK-QRGEFSIISMNGASGD  361

Query  1354  YPGCTDXAYSKAVSDGVDIIDC  1419
             YPGCTD AY KAV+DGVDI+DC
Sbjct  362   YPGCTDLAYQKAVNDGVDILDC  383



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   457 bits (1176),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 216/380 (57%), Positives = 290/380 (76%), Gaps = 3/380 (1%)
 Frame = +1

Query  280   LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  459
             L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA + S  + 
Sbjct  9     LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  460   IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  639
             I++CDV+LTKDG+GIC PDIK+DN +N+   ++  + +YLVNGV T  WF +D+N  +L 
Sbjct  69    ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGRKSYLVNGVSTAGWFSVDYNGTELG  128

Query  640   LVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLS  819
              V+L+Q ++SRS RFD +   IL VED+ +K +PPG+WLNVQHDSFYSQ NLSM  ++ S
Sbjct  129   QVSLKQSIFSRSPRFDPSFFPILAVEDIASKFKPPGMWLNVQHDSFYSQFNLSMSNYIFS  188

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             VS+RV+++YISSPEV+FL  ++ +++   T+LVFRFL     EPST QTYGS+L+NL  +
Sbjct  189   VSKRVIVDYISSPEVSFLTKVSGKLSNN-TRLVFRFLDESTIEPSTKQTYGSMLKNLTFV  247

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDP  1179
             KTFASGI+VPK YIWPV    +YL+P TS+V DAHK GLE+YA+DFA+D  F++++SYDP
Sbjct  248   KTFASGIIVPKKYIWPV-SPDNYLEPHTSVVDDAHKAGLEIYAADFANDFMFSYNHSYDP  306

Query  1180  VAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYP  1359
             +AEYLSFIDNG +SVDGVL+DFP+TPS AI C+++++K + +   + L+IS +GASGDYP
Sbjct  307   LAEYLSFIDNGAFSVDGVLTDFPVTPSEAIGCFTNLKKSKTDH-GKPLIISHNGASGDYP  365

Query  1360  GCTDXAYSKAVSDGVDIIDC  1419
              CTD AY KAV DG D+IDC
Sbjct  366   ACTDLAYQKAVDDGADVIDC  385


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 158/377 (42%), Gaps = 60/377 (16%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   +  K +T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  330   VTPSEAIGCFTNLKKSKTDHGK-PLIISHNGASGDYPACTDLAYQKA-VDDGADVID-CP  386

Query  475   VQLTKDGVGICFPDIKLDNASNVA--------TLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQLTKDG+ IC   I L + + VA         + KD +S   V GV T    W  I  N
Sbjct  387   VQLTKDGIPICMSSINLMDDTTVAKSQFASQTAVIKDIES---VLGVFTFNLTWDDIVKN  443

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH---  789
              +             R+ R+   G   ++    D        G+ ++V+H +F ++    
Sbjct  444   LRPKISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKDKDLSGIMISVEHAAFVAEELGF  503

Query  790   --------NLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDET  945
                      L    +    +++V+I   +S  +   K        + TK    ++ N+E 
Sbjct  504   DMVDSVIKTLDAAGYSNQTAQKVMIQSSNSSVLVKFK--------QQTKYDLVYMINEEV  555

Query  946   EPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVY  1125
             + +   +       LA+IK FA  + V  + I+P ++  +  Q  T+LV      GL VY
Sbjct  556   KDAAPSS-------LAAIKKFADAVSVEGNSIFPENRHFTTYQ--TNLVESLQNAGLPVY  606

Query  1126  A----SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSG-AIDCYSHMR  1290
                  ++FAS     +D+  D  A+  +++      V+GV++DFP T     ++   HM 
Sbjct  607   VYTLMNEFASQ---PYDFFSDATAQINAYVQGAG--VNGVITDFPATARRYKLNTCMHM-  660

Query  1291  KGQKNQVPEFLVISFDG  1341
                 N  P F+  +  G
Sbjct  661   ---GNNTPSFMAPARPG  674



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   457 bits (1177),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 217/364 (60%), Positives = 281/364 (77%), Gaps = 4/364 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W TL+G  PLVI+ GGFSG+FPDSS +AY  A  TS  N  +WCDVQLTKD VGIC P
Sbjct  27    SVWNTLTGSPPLVISHGGFSGIFPDSSDSAYILAAATSTPNAALWCDVQLTKDAVGICLP  86

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             ++ L N++N+  +F +K ++YLVNG  T  +F +D++F+ L+ V + QGV+SRS   DG 
Sbjct  87    NLNLLNSTNIFGVFPNKTTSYLVNGESTAGYFSVDYSFEDLSTVTVTQGVFSRSPLLDGN  146

Query  694   PQQILTVEDVFNKVQP--PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
                I TV++V   V P  PGLWLN+QHD+FYSQHNLSMR+FVL+VSRR+ ++YISSPE  
Sbjct  147   NFIINTVDEVLKLVAPQTPGLWLNIQHDAFYSQHNLSMRSFVLAVSRRLHVSYISSPEAG  206

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FL+SI  R NP+ TKLVFRFL  ++T+PSTNQTYGS L+NL  IKTFASGILVPK YIWP
Sbjct  207   FLRSITKRFNPKTTKLVFRFLNQEDTDPSTNQTYGSFLKNLTFIKTFASGILVPKGYIWP  266

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             VD +S YLQP TSLV DAHK GLEV+A+DF++D+  +++YS+DP+AE L FIDNG ++VD
Sbjct  267   VD-ASLYLQPHTSLVSDAHKAGLEVFAADFSNDIVISYNYSFDPLAESLQFIDNGEFTVD  325

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVL+DFP+TPS AIDC++H+      +  + L+IS  GASGD+P CT+ AY+KA+ DGVD
Sbjct  326   GVLTDFPLTPSAAIDCFAHIGNNATRR-DKTLIISKYGASGDFPACTNLAYNKAIQDGVD  384

Query  1408  IIDC  1419
             ++DC
Sbjct  385   VLDC  388



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   457 bits (1175),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 232/376 (62%), Positives = 282/376 (75%), Gaps = 15/376 (4%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             V LV+A   + +TS+WQTL G  PLVIARGGFSGLFP SS  AY F   TS+ +V++WCD
Sbjct  22    VALVSADKDS-TTSQWQTLKGKPPLVIARGGFSGLFPGSSSVAYDFTLSTSVPDVLLWCD  80

Query  475   VQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ  654
             VQLTK+G GICFPD+ L N+S+V  ++     TY            ID+  K L  V++ 
Sbjct  81    VQLTKEGAGICFPDLLLSNSSDVDIIYPKTVKTYT-----------IDYTLKDLANVSVT  129

Query  655   QGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMRTFVLSVSRR  831
             QG+YSR  RFDG   QILTVEDV   ++PP GLWLN++++ F+SQHNLSMR FV SV R+
Sbjct  130   QGIYSRIDRFDGNGYQILTVEDVAKILKPPAGLWLNIENNIFFSQHNLSMRNFVHSVMRK  189

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFA  1011
             VV+NYISSPEV FL SI   ++PR TKLVFRFLG  E EPSTNQTYGSLL+NL  IKTFA
Sbjct  190   VVVNYISSPEVAFLNSIKGAVSPRTTKLVFRFLGLTEIEPSTNQTYGSLLKNLTFIKTFA  249

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEY  1191
             SGILVPK+YIWPV  + +YL+P TSLVLDAHK  L V+AS F +D    ++YSYDP+AEY
Sbjct  250   SGILVPKTYIWPV-TTDNYLEPHTSLVLDAHKAKLTVFASGFMNDATLPYNYSYDPLAEY  308

Query  1192  LSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTD  1371
             LSFIDNGN++VDGVLSDFPITPS AIDC++H+R+    Q  + LVIS +GASGDYP CTD
Sbjct  309   LSFIDNGNFTVDGVLSDFPITPSAAIDCFAHLRQNASVQ-DKPLVISKNGASGDYPDCTD  367

Query  1372  XAYSKAVSDGVDIIDC  1419
              AY KA+ DGVD++DC
Sbjct  368   LAYMKALEDGVDVLDC  383



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   456 bits (1173),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/380 (57%), Positives = 290/380 (76%), Gaps = 3/380 (1%)
 Frame = +1

Query  280   LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  459
             L+ S V L     +    S W+TLSG+AP +IA+GGFSG+FPDSS  AY FA + S  + 
Sbjct  9     LVSSLVFLWLGVAAAQKASSWKTLSGNAPAIIAKGGFSGIFPDSSEFAYQFALIASSPDT  68

Query  460   IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  639
             I++CDV+LTKDG+GIC PDIK+DN +N+   ++  + +YLVNGV T  WF +D+N  +L 
Sbjct  69    ILYCDVRLTKDGLGICLPDIKMDNCTNIPDFYQQGRKSYLVNGVSTAGWFSVDYNGTELG  128

Query  640   LVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLS  819
              V+L+Q ++SRS RFD +   IL VED+ +K +PPG+WLNVQHDSFYSQ NLSM  ++LS
Sbjct  129   QVSLKQSIFSRSPRFDPSFFPILAVEDIASKFKPPGMWLNVQHDSFYSQFNLSMSNYILS  188

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             VS+RV+++YISSPEV+FL  ++ +++   T+LVFRFL     EPST QTYGS+L+N   +
Sbjct  189   VSKRVIVDYISSPEVSFLTKVSGKLSNN-TRLVFRFLDESTIEPSTKQTYGSMLKNFTFV  247

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDP  1179
             KTFASGI+VPK YIWPV    +YL+P TS+V DAHK GLE+YA++FA+D  F++++SYDP
Sbjct  248   KTFASGIIVPKKYIWPV-SPDNYLEPHTSVVDDAHKAGLEIYAANFANDFMFSYNHSYDP  306

Query  1180  VAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYP  1359
             +AEYLSFIDNG +SVDGVL+DFP+TPS AI C+++++K +K    + L+IS +GASGDYP
Sbjct  307   LAEYLSFIDNGAFSVDGVLTDFPVTPSEAIGCFTNLKK-RKTDHGKPLIISHNGASGDYP  365

Query  1360  GCTDXAYSKAVSDGVDIIDC  1419
              CTD AY KAV DG D+IDC
Sbjct  366   ACTDLAYQKAVDDGADVIDC  385


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 158/377 (42%), Gaps = 60/377 (16%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   +  K +T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  330   VTPSEAIGCFTNLKKRKTDHGK-PLIISHNGASGDYPACTDLAYQKA-VDDGADVID-CP  386

Query  475   VQLTKDGVGICFPDIKLDNASNVA--------TLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQLTKDG+ IC   I L + + VA         + KD +S   V GV T    W  I  N
Sbjct  387   VQLTKDGIPICMSSINLMDDTTVAKSQFASQTAVIKDIES---VLGVFTFNLTWDDIVKN  443

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH---  789
              +             R+ R+   G   ++    D        G+ ++V+H +F ++    
Sbjct  444   LRPKISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKDKDLSGIMISVEHAAFVAEELGF  503

Query  790   --------NLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDET  945
                      L    +    +++V+I   +S  +   K        + TK    ++ N+E 
Sbjct  504   DMVDSVIKTLDAAGYSNQTAQKVMIQSSNSSVLVKFK--------QQTKYDLVYMINEEV  555

Query  946   EPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVY  1125
             + +   +       LA+IK FA  + V  + I+P ++  +  Q  T+LV      GL VY
Sbjct  556   KDAAPSS-------LAAIKKFADAVSVEGNSIFPENRHFTTYQ--TNLVESLQNAGLPVY  606

Query  1126  A----SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSG-AIDCYSHMR  1290
                  ++FAS     +D+  D  A+  +++      V+GV++DFP T     ++   HM 
Sbjct  607   VYTLMNEFASQ---PYDFFSDATAQINAYVQGAG--VNGVITDFPATARRYKLNTCMHM-  660

Query  1291  KGQKNQVPEFLVISFDG  1341
                 N  P F+  +  G
Sbjct  661   ---GNNTPSFMAPARPG  674



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   456 bits (1173),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 288/373 (77%), Gaps = 7/373 (2%)
 Frame = +1

Query  301   LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  480
             + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + I++CDV+
Sbjct  20    VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  481   LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  660
             LTKDG+G+C P+IK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+ V+L+Q 
Sbjct  76    LTKDGLGVCLPEIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQS  135

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             ++SR+ RFD +   +L VEDV +K +PPG+WLN+QHD FYSQ N+SMR ++LSVSRRV++
Sbjct  136   IFSRTPRFDPSFFPLLAVEDVASKFKPPGMWLNIQHDGFYSQFNMSMRKYILSVSRRVIV  195

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPE +FL SI+ R++   TKL+FRFL     EPST +TYGS+L+NL  IKTFASGI
Sbjct  196   DYISSPEASFLTSISGRVS-NNTKLMFRFLDEATLEPSTKETYGSMLKNLTFIKTFASGI  254

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPV    +YLQP TS+V DAHK GLE+YA+DFA+D   ++++SYDP+AE LSF
Sbjct  255   LVPKKYIWPV-SPDNYLQPYTSIVDDAHKAGLEIYAADFANDFALSYNHSYDPLAESLSF  313

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             IDNG +SVDG+L+DFP+TPS A+ C++++ K   +   + L+IS +GASGDYPGCTD AY
Sbjct  314   IDNGAFSVDGMLTDFPVTPSEAVGCFANLNKSNTDH-GKPLIISHNGASGDYPGCTDLAY  372

Query  1381  SKAVSDGVDIIDC  1419
              KAV DG D+IDC
Sbjct  373   QKAVDDGADVIDC  385


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 93/361 (26%), Positives = 157/361 (43%), Gaps = 38/361 (11%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   + +K  T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  330   VTPSEAVGCFANLNKSNTDHG-KPLIISHNGASGDYPGCTDLAYQKA-VDDGADVID-CP  386

Query  475   VQLTKDGVGICFPDIKLDNASNV--------ATLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQ+TKDG+ +C   I L +++ V        A + KD +S   V GV T    W  I  N
Sbjct  387   VQVTKDGIPVCMGSINLMDSTTVAKSPFASQAAVMKDIES---VLGVFTFNLTWDDIVKN  443

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH-NL  795
              K      L      R+ R+   G   ++    D        G+ ++++H +F ++    
Sbjct  444   LKPKISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKDKDLSGIMISIEHAAFLAEELGF  503

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRV---TKLVFRFLGNDETEPSTNQT  966
              M   V+        N  ++ +V  ++S  S +  +    TK    ++ N++   +   +
Sbjct  504   DMVDAVIKALDDSGYNKQTAQKV-MIQSTNSSVLVKFKQETKYDLVYMINEDVSDAAPSS  562

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
                    LA IK FA  + V  S ++P ++  +  Q  T LV      GL VYA +  ++
Sbjct  563   -------LAGIKKFADAVSVETSSVFPENRHFTSHQ--TDLVESLQTAGLSVYAYNLMNE  613

Query  1147  -VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
              V   +D+  D  A+ ++++      VDG+++DFP T   A    S+      N+ P F+
Sbjct  614   FVSQPYDFFSDATAQIIAYVQGAG--VDGLITDFPAT---ARRYKSNTCVNMGNKTPSFM  668

Query  1324  V  1326
              
Sbjct  669   A  669



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   456 bits (1174),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/365 (61%), Positives = 277/365 (76%), Gaps = 3/365 (1%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             STS WQTLSGDAPLVIARGGFSGLFPDSS +AY+FA LTS+ +V++WCDVQLTKDGVGIC
Sbjct  43    STSPWQTLSGDAPLVIARGGFSGLFPDSSSDAYNFAILTSVADVVLWCDVQLTKDGVGIC  102

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FPD+ L NAS +  ++ + Q +Y+VNGV T  WF ID  FK L  V L +G+ SRS +FD
Sbjct  103   FPDLNLANASIIKYIYPNGQKSYMVNGVTTQGWFTIDTTFKDLENVTLNRGILSRSEKFD  162

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
                  I T+++V   ++  G WLNVQHD+FY+QHNLSM  ++LSVSR   I++ISSPEVN
Sbjct  163   DV-NGISTIQNVAALIKQEGFWLNVQHDAFYAQHNLSMSNYLLSVSRTASIDFISSPEVN  221

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             F   IA R        VF+FL  ++ EP+TNQTYGS+L NL  +KTFASGILVPKSYI P
Sbjct  222   FFMKIAGRFGRNGPSFVFQFLRQEDLEPTTNQTYGSILSNLTFVKTFASGILVPKSYILP  281

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             +D    YL P TSLV DAHK GL VY S F++D+  A DYS+DPV+EYLSF+DNG++SVD
Sbjct  282   LDD-QQYLLPYTSLVQDAHKAGLAVYVSGFSNDIYIAHDYSFDPVSEYLSFVDNGDFSVD  340

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             G++SDFPIT S +IDC+SH+ +  +  V +FLVIS +GASG+YPGCTD AY KA+ DG D
Sbjct  341   GMVSDFPITASSSIDCFSHIGRNARKHV-DFLVISKNGASGNYPGCTDLAYEKAIKDGAD  399

Query  1408  IIDCT  1422
             +IDC+
Sbjct  400   VIDCS  404



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   459 bits (1180),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 288/373 (77%), Gaps = 7/373 (2%)
 Frame = +1

Query  301   LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  480
             + AAQG     S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + I++CDV+
Sbjct  20    VAAAQGD----SPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDTILYCDVR  75

Query  481   LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  660
             LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+ V+L+Q 
Sbjct  76    LTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELSQVSLKQS  135

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             ++SR+ RFD +   +L VEDV +K +PPG+WLN+QHD FYSQ N+SMR ++LSVSRRV++
Sbjct  136   IFSRTPRFDPSFFPLLAVEDVASKFKPPGMWLNIQHDGFYSQFNMSMRKYILSVSRRVIV  195

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPE +FL SI+ R++   TKLVFRFL     EPST +TYGS+L+NL  IKTFASGI
Sbjct  196   DYISSPEASFLTSISGRVS-NNTKLVFRFLDEATLEPSTKETYGSMLKNLTFIKTFASGI  254

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPV    +YLQP TS+V DAHK GLE+YA+DFA+D   ++++SYDP+AE LSF
Sbjct  255   LVPKKYIWPV-SPDNYLQPYTSIVDDAHKAGLEIYAADFANDFALSYNHSYDPLAESLSF  313

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             IDNG +SVDG+L+DFP+TPS AI C++++ K   +   + L+IS +GASGDYPGCTD AY
Sbjct  314   IDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTDH-GKPLIISHNGASGDYPGCTDLAY  372

Query  1381  SKAVSDGVDIIDC  1419
              KAV DG D+IDC
Sbjct  373   QKAVDDGADVIDC  385



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   455 bits (1170),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 280/362 (77%), Gaps = 3/362 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TLSG AP ++A+GGFSGLFPDSS  AY FA + S  + I++CDV+LTKD +GIC P
Sbjct  29    SSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALVASSPDTILYCDVRLTKDEIGICLP  88

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             DI++DN +N+   +   Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+ RFD +
Sbjct  89    DIRMDNCTNIPDFYAQGQKSYLVNGVPTSGWFSVDYNGTELGQVTLKQSINSRTPRFDSS  148

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                +L VEDV +K +PPG+WLNVQHDSFYSQ NLSMR +++SVS+RVV NYISSPEV+FL
Sbjct  149   FFALLAVEDVQSKFKPPGIWLNVQHDSFYSQFNLSMRNYIISVSKRVVANYISSPEVSFL  208

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
              SI  RI+ + TKLVFRFL     EPS NQTYGS+++NL  +KTFASGILVPKSYIWP +
Sbjct  209   TSILGRISNK-TKLVFRFLDESTLEPSMNQTYGSMMKNLTFVKTFASGILVPKSYIWP-N  266

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
                +YLQP TS+V DAHK GLE+YA+DFA+D   ++++SYDP+AEYLSFIDN  +SVDGV
Sbjct  267   SPDNYLQPYTSVVDDAHKAGLEIYAADFANDFLLSYNHSYDPLAEYLSFIDNDVFSVDGV  326

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             L+DFP+T S AI C++++ K   +   + L+IS +GASGDYPGCTD AY KAV DG D+I
Sbjct  327   LTDFPVTASEAIGCFTNLNKSNTDH-GKPLIISHNGASGDYPGCTDLAYQKAVDDGADVI  385

Query  1414  DC  1419
             DC
Sbjct  386   DC  387



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   455 bits (1171),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 230/396 (58%), Positives = 291/396 (73%), Gaps = 8/396 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             M  LRS  + +LLCS V   L A Q  +  S S+WQTLSGDAPLVIARGGFSGL PDSS 
Sbjct  14    MLLLRS--STILLCSVVLIQLFAPQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSL  71

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
             +AY+ A  TS+ +VI+WCDV LTKDG+GICFP++ L NAS +  ++ + Q +Y VNGV T
Sbjct  72    DAYNLAIQTSVADVILWCDVHLTKDGIGICFPNLNLANASTIQYVYPNGQKSYPVNGVIT  131

Query  598   TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDS  774
               WF ID   + L  V L +G+ SRS +FDG    I T++ V  +++P  G WLNVQHD+
Sbjct  132   QGWFTIDSTLRDLENVTLIRGLLSRSDKFDGNGYLISTIQSVTEQIKPQGGFWLNVQHDA  191

Query  775   FYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  954
             FY QHNLSM +F++SVSR V I++ISSPEVNF K I  R+       VF+FLG ++ EPS
Sbjct  192   FYEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGRVKRNGPSFVFQFLGKEDFEPS  251

Query  955   TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  1134
             TN+TY S+L NLA +KTFAS ILVPKSYI+P+D    YL P TSLV DAHK GLEVY S 
Sbjct  252   TNRTYASILSNLAFVKTFASKILVPKSYIFPLD-DKQYLLPLTSLVQDAHKAGLEVYVSG  310

Query  1135  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  1314
             FA+D   A++YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC++H+ +    QV 
Sbjct  311   FANDADIAYNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASTSIDCFAHVGRNATKQV-  369

Query  1315  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +FLVIS  GASGDYP CT+ AY KA+ DGVD+IDC+
Sbjct  370   DFLVISKGGASGDYPSCTNLAYEKAIKDGVDVIDCS  405



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/380 (57%), Positives = 287/380 (76%), Gaps = 3/380 (1%)
 Frame = +1

Query  280   LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  459
             ++ S V L     +    S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + 
Sbjct  9     VVASVVLLWLGVATAQGDSPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDT  68

Query  460   IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  639
             +++CDV+LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+
Sbjct  69    VLYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELS  128

Query  640   LVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLS  819
              V+L+Q ++SR+ RFD +   +L VEDV +K +PPG+WLN+QHD FYSQ N+SMR ++LS
Sbjct  129   QVSLKQAIFSRTPRFDPSFFPLLAVEDVASKFKPPGMWLNIQHDDFYSQFNMSMRKYILS  188

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             VSRRV+++YISSPE +FL SI+ RI+   TKLVFRFL     EPST  TYGS+L+NL  I
Sbjct  189   VSRRVIVDYISSPEASFLTSISGRIS-NNTKLVFRFLDEATLEPSTKDTYGSMLKNLTFI  247

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDP  1179
             KTFASGILVPK Y+WPV    +YLQ  TS+V DAHKVGLE+YA+DFA+D   ++++SYDP
Sbjct  248   KTFASGILVPKKYVWPV-SPDNYLQMYTSIVDDAHKVGLEIYAADFANDFALSYNHSYDP  306

Query  1180  VAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYP  1359
             +AE LSFIDNG +SVDG+L+DFP+TPS AI C++++ K       + L+IS +GASGDYP
Sbjct  307   LAESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTAH-GKPLIISHNGASGDYP  365

Query  1360  GCTDXAYSKAVSDGVDIIDC  1419
             GCTD AY KAV DG D+IDC
Sbjct  366   GCTDLAYQKAVDDGADVIDC  385


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 93/361 (26%), Positives = 155/361 (43%), Gaps = 38/361 (11%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   + +K  T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  330   VTPSEAIGCFANLNKSNTAHG-KPLIISHNGASGDYPGCTDLAYQKA-VDDGADVID-CP  386

Query  475   VQLTKDGVGICFPDIKLDNASNVA--------TLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQ+TKDG+ +C   I L + + VA         + KD +S   V GV T    W  I  N
Sbjct  387   VQVTKDGIPVCMGSINLMDGTTVAKSPFASQTAVMKDIES---VLGVFTFNLTWDDIVKN  443

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH-NL  795
              K      L      R+ R+   G   ++    D        G+ ++++H +F +     
Sbjct  444   LKPKISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKDKDLSGIMISIEHAAFLAAELGF  503

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRV---TKLVFRFLGNDETEPSTNQT  966
              M   V+        N  ++ +V  ++S  S +  +    TK    ++ N++   +   +
Sbjct  504   DMVDAVIKALDDSGYNKQTAQKV-MIQSTNSSVLVKFKQQTKYDLVYMINEDVSDAAPSS  562

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
                    LA IK FA  + V  S ++P ++  +  Q  T LV      GL VYA +  ++
Sbjct  563   -------LAGIKKFADAVSVETSSVFPENRHFTSHQ--TDLVESLQTAGLSVYAYNLMNE  613

Query  1147  -VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
              V   +D+  D  A+ ++++      VDG+++DFP T   A    S+      N+ P F+
Sbjct  614   FVSQPYDFFSDATAQIIAYVQGAG--VDGLITDFPAT---ARRYKSNTCMNMGNKTPSFM  668

Query  1324  V  1326
              
Sbjct  669   A  669



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   454 bits (1169),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/380 (57%), Positives = 287/380 (76%), Gaps = 3/380 (1%)
 Frame = +1

Query  280   LLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNV  459
             ++ S V L     +    S W+TLSG+AP +IA+GGFSGLFPDSS  AY FA + S  + 
Sbjct  9     VVASVVLLWLGVATAQGDSPWKTLSGNAPAIIAKGGFSGLFPDSSEFAYQFAMIASSPDT  68

Query  460   IMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT  639
             +++CDV+LTKDG+G+C PDIK+DN +N+   +   + +YLVNGV TT WF +D+N  +L+
Sbjct  69    VLYCDVRLTKDGLGVCLPDIKMDNCTNIPDFYPKGKKSYLVNGVSTTGWFSVDYNGTELS  128

Query  640   LVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLS  819
              V+L+Q ++SR+ RFD +   +L VEDV +K +PPG+WLN+QHD FYSQ N+SMR ++LS
Sbjct  129   QVSLKQAIFSRTPRFDPSFFPLLAVEDVASKFKPPGMWLNIQHDDFYSQFNMSMRKYILS  188

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             VSRRV+++YISSPE +FL SI+ RI+   TKLVFRFL     EPST  TYGS+L+NL  I
Sbjct  189   VSRRVIVDYISSPEASFLTSISGRIS-NNTKLVFRFLDEATLEPSTKDTYGSMLKNLTFI  247

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDP  1179
             KTFASGILVPK Y+WPV    +YLQ  TS+V DAHKVGLE+YA+DFA+D   ++++SYDP
Sbjct  248   KTFASGILVPKKYVWPV-SPDNYLQMYTSIVDDAHKVGLEIYAADFANDFALSYNHSYDP  306

Query  1180  VAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYP  1359
             +AE LSFIDNG +SVDG+L+DFP+TPS AI C++++ K       + L+IS +GASGDYP
Sbjct  307   LAESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTAH-GKPLIISHNGASGDYP  365

Query  1360  GCTDXAYSKAVSDGVDIIDC  1419
             GCTD AY KAV DG D+IDC
Sbjct  366   GCTDLAYQKAVDDGADVIDC  385


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 93/361 (26%), Positives = 155/361 (43%), Gaps = 38/361 (11%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             VT   A G   + +K  T  G  PL+I+  G SG +P  +  AY  A +    +VI  C 
Sbjct  330   VTPSEAIGCFANLNKSNTAHG-KPLIISHNGASGDYPGCTDLAYQKA-VDDGADVID-CP  386

Query  475   VQLTKDGVGICFPDIKLDNASNVA--------TLFKDKQSTYLVNGVPT--TAWFPIDFN  624
             VQ+TKDG+ +C   I L + + VA         + KD +S   V GV T    W  I  N
Sbjct  387   VQVTKDGIPVCMGSINLMDGTTVAKSPFASQTAVMKDIES---VLGVFTFNLTWDDIVKN  443

Query  625   FKQLTLVNLQQGVYSRSSRFD--GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQH-NL  795
              K      L      R+ R+   G   ++    D        G+ ++++H +F +     
Sbjct  444   LKPKISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKDKDLSGIMISIEHAAFLAAELGF  503

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRV---TKLVFRFLGNDETEPSTNQT  966
              M   V+        N  ++ +V  ++S  S +  +    TK    ++ N++   +   +
Sbjct  504   DMVDAVIKALDDSGYNKQTAQKV-MIQSTNSSVLVKFKQQTKYDLVYMINEDVSDAAPSS  562

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
                    LA IK FA  + V  S ++P ++  +  Q  T LV      GL VYA +  ++
Sbjct  563   -------LAGIKKFADAVSVETSSVFPENRHFTSHQ--TDLVESLQTAGLSVYAYNLMNE  613

Query  1147  -VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
              V   +D+  D  A+ ++++      VDG+++DFP T   A    S+      N+ P F+
Sbjct  614   FVSQPYDFFSDATAQIIAYVQGAG--VDGLITDFPAT---ARRYKSNTCMNMGNKTPSFM  668

Query  1324  V  1326
              
Sbjct  669   A  669



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   454 bits (1169),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 231/407 (57%), Positives = 285/407 (70%), Gaps = 27/407 (7%)
 Frame = +1

Query  277   LLLCSAVT--LVAAQ-GSTNSTSKWQTLSG----------------------DAPLVIAR  381
             LL C  V   L AAQ  +  STS+WQTL+G                      DAPLVIAR
Sbjct  18    LLFCGVVLIHLFAAQIDAQRSTSRWQTLNGESCSHFISFFCALFPRKQENLCDAPLVIAR  77

Query  382   GGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD  561
             GGFSGL+PDSS  AY  A LTS+ +V++WCD+QLTKDG+GICFPD+ L NAS +  ++ +
Sbjct  78    GGFSGLYPDSSIAAYQLATLTSVADVVLWCDLQLTKDGLGICFPDLNLANASTIDRVYPN  137

Query  562   KQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQP  741
             ++ +Y VNGV T  WFP DF+  +L    L +G+ SR+ RFDG    I T+EDV   +  
Sbjct  138   REKSYSVNGVTTKGWFPNDFSLTELQNFLLIRGILSRTDRFDGNGYLISTIEDVVTTLNR  197

Query  742   PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVF  921
              G WLNVQHD+FY Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF
Sbjct  198   EGFWLNVQHDAFYEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVF  257

Query  922   RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDA  1101
             +FLG ++ EP+TN+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DA
Sbjct  258   QFLGKEDFEPTTNRTYGSILSNLTFVKTFASGILVPKSYILPLDD-EQYLVPHTSLVQDA  316

Query  1102  HKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYS  1281
             HK GL+VY S FA+DV  A++YS DPV+EYLSF+DNG++SVDGVLSDFPIT S A+DC+S
Sbjct  317   HKAGLQVYVSGFANDVDIAYNYSSDPVSEYLSFVDNGDFSVDGVLSDFPITASAAVDCFS  376

Query  1282  HMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             H+ +    QV +FLVIS DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  377   HIGRNATKQV-DFLVISKDGASGDYPGCTDLAYEKAIKDGADVIDCS  422



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   463 bits (1192),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 288/385 (75%), Gaps = 7/385 (2%)
 Frame = +1

Query  280   LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA + S+
Sbjct  20    LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  79

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
              +V++WCDVQLTKDG GICFPD+ L NASN   ++ ++Q +Y VNGV T  WFPIDF+  
Sbjct  80    ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPNRQKSYPVNGVTTKGWFPIDFSLT  139

Query  631   QL--TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
             +L   L +L +G+ SRS +FD     I TV++V  +++P   WLNVQHD FY QHNLSM 
Sbjct  140   ELQKVLFSLIRGILSRSGKFDENGYSISTVQNVATQMKPALFWLNVQHDEFYEQHNLSMS  199

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F+LS SR V I++ISSPEVNF + IA          VF+F+G ++ EP+TN+TYGS+L 
Sbjct  200   SFLLSTSRTVSIDFISSPEVNFFRKIAGGFGNNGPSFVFQFMGKEDFEPTTNRTYGSILS  259

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL+ +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL++YAS FA+DV  A++
Sbjct  260   NLSFVKTFASGILVPKSYILPLD-DKQYLLPHTSLVQDAHKAGLKLYASGFANDVDIAYN  318

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DPV+EYLSF+DNGN+SVDG+LSDFP+T S ++DC+SH+ +    QV +FLVIS +GA
Sbjct  319   YSWDPVSEYLSFVDNGNFSVDGMLSDFPLTASASVDCFSHIGRNATKQV-DFLVISKNGA  377

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SG+YPGCT  AY KA+ DG D+IDC
Sbjct  378   SGEYPGCTKLAYEKAIKDGSDVIDC  402



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   453 bits (1166),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 233/373 (62%), Positives = 280/373 (75%), Gaps = 6/373 (2%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL NVI+WCDVQL
Sbjct  27    VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQG  660
             TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F  D+  K+L + V L QG
Sbjct  85    TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYFSADYTLKELRSNVFLVQG  144

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
              YSR +   G   +ILTV+DV     P GLWLN+QHD+FY+QHNLSM+ F+  V   V +
Sbjct  145   DYSRPTL--GGVFEILTVKDVVKTTFPQGLWLNIQHDAFYTQHNLSMKNFIRFVYTTVNV  202

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPE  FLKSI + INP++TKLVFRFLG +E +PST QTYGSLLQNL  IKTFASGI
Sbjct  203   SYISSPEAGFLKSIKTDINPKITKLVFRFLGKEEVDPSTKQTYGSLLQNLTFIKTFASGI  262

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPVD +S YLQP TSLV DAHKVGLEV+AS F +D+P +++YSYDP  E+LSF
Sbjct  263   LVPKDYIWPVDPTSHYLQPHTSLVSDAHKVGLEVFASTFQNDIPISYNYSYDPFFEHLSF  322

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             I+NGN+SVDGVLSDFP+T S AIDC+ HM      +V   LVIS  GASGDYP CTD AY
Sbjct  323   IENGNFSVDGVLSDFPLTSSAAIDCFVHMGLNAPKKV-NTLVISKYGASGDYPPCTDLAY  381

Query  1381  SKAVSDGVDIIDC  1419
              KA+ DGVDI+DC
Sbjct  382   KKAILDGVDILDC  394


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 80/312 (26%), Positives = 144/312 (46%), Gaps = 31/312 (10%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI++ G SG +P  +  AY  A L  +   I+ C VQ++KDG+  CF  I L  ++NVA
Sbjct  362   LVISKYGASGDYPPCTDLAYKKAILDGVD--ILDCPVQMSKDGIPFCFNSIDLIKSTNVA  419

Query  547   -----TLFKDKQSTYLVNGVPT--TAWFPIDFNFKQLTLVNL--QQGVYSRSSRFDGTPQ  699
                   L K        +G+     AW   D     L+++NL  +  +Y R+ +F+    
Sbjct  420   KSSFSNLSKSIPEIQAGDGIFAFDLAWN--DIKSLSLSMLNLFSEFNLY-RNPKFN-EKV  475

Query  700   QILTVEDVFNKVQPP----GLWLNVQHDSFYS-QHNLSMRTFVLSVSRRVVINYISSPEV  864
              +LT+ +  N  Q      G+ + ++   + + + NLS+   V     +   +   +P V
Sbjct  476   SLLTLSEFLNFTQGHTSLLGVVIIIEKAPYLAREQNLSVIDAVSDTLSKAGYDKTGTPNV  535

Query  865   NFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN-LASIKTFASGILVPKSYI  1041
                 S +S +      L F+     E   S  +    ++ + L+ IKTFA  ++V +  +
Sbjct  536   MIQSSDSSVL------LKFKEKTKYELVYSIPEIVSDIVDSALSDIKTFAHSVVVVRDSV  589

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNY  1218
             +P + +  ++  +T  V     V L VY   F ++ V  A+D+  D   +  +F+ +   
Sbjct  590   YPRN-ALFFVTGSTKTVSKFKSVNLSVYVQTFHNEFVSQAWDFLSDATVQINTFVQDA--  646

Query  1219  SVDGVLSDFPIT  1254
              +DGV++ FP T
Sbjct  647   GIDGVITGFPQT  658



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   454 bits (1169),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 283/383 (74%), Gaps = 6/383 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
               L    + LV A+  T+++S+WQTLSG AP +IARGGFSGLFPDSS +A+ F    S  
Sbjct  64    FFLAVQHLGLVTAK--TSNSSRWQTLSGRAPAIIARGGFSGLFPDSSLDAFLFGVSVSSN  121

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             +  +WC+VQLTKD VGIC PDIKLDN +N+A ++  ++  Y+VNGV T  WF +D+   +
Sbjct  122   DSFLWCNVQLTKDNVGICVPDIKLDNCTNIANVYPGREKVYVVNGVRTPGWFSVDYKATE  181

Query  634   LTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTF  810
             L   V+L Q +YSR+  FD T   IL V+DV  +V+PPGLWLN+QHD FY QHNLSMR++
Sbjct  182   LAQSVSLIQAIYSRTFVFD-TMFPILAVDDVVTQVRPPGLWLNIQHDIFYQQHNLSMRSY  240

Query  811   VLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNL  990
             VLSV +RV++NYISSPEVNFL SI  R     TKLVFRFL  D  EPSTNQTY  LL+NL
Sbjct  241   VLSVFKRVIVNYISSPEVNFLTSIEKRFRQSTTKLVFRFLNEDIAEPSTNQTYSLLLKNL  300

Query  991   ASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYS  1170
               IKTFASGILVPK YIWPV    +YLQP TS+V+DAHK GLE++A+DFA+D   +++YS
Sbjct  301   TFIKTFASGILVPKHYIWPV-TPDNYLQPYTSIVMDAHKAGLEIFAADFANDNIISYNYS  359

Query  1171  YDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASG  1350
             YDP++EYL FIDNG +SVDGVL+DFPITPS  + C+SH+ K   +     L+IS  GASG
Sbjct  360   YDPLSEYLYFIDNGFFSVDGVLTDFPITPSEVVACFSHINKSSIDH-GRPLIISHYGASG  418

Query  1351  DYPGCTDXAYSKAVSDGVDIIDC  1419
             DYP CTD AY KAV+DG D+IDC
Sbjct  419   DYPDCTDLAYQKAVNDGADVIDC  441



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   453 bits (1165),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 230/386 (60%), Positives = 279/386 (72%), Gaps = 7/386 (2%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             +LLC  V   L A Q    S+S WQTLSG APLVIARGGFSGLFPDSS  AY FA  TS+
Sbjct  6     VLLCCVVLIQLFAGQTDARSSSPWQTLSGGAPLVIARGGFSGLFPDSSSAAYGFAVQTSV  65

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
                ++WCDVQLTKDG  ICFPD+KL+NAS V   + ++Q +Y VNGV T  WF IDF+  
Sbjct  66    PGAVLWCDVQLTKDGAAICFPDLKLNNASTVEYFYPNRQKSYPVNGVSTQGWFTIDFSLS  125

Query  631   QLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTF  810
              L+ V L +G+ SR+ +FDG    ILTVE V  +++P   WLNVQHD+FY Q NLSM  F
Sbjct  126   DLSNVYLLRGILSRTEKFDGR-YPILTVEYVTTQIKPESFWLNVQHDAFYEQQNLSMSNF  184

Query  811   VLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNL  990
             ++S SR V INYISSPEVNF   IA R+       VF+FL  ++ EP+TN+TYGS+L NL
Sbjct  185   LISASRIVSINYISSPEVNFFTKIAGRLRRNGPIYVFQFLRKEDIEPTTNRTYGSILSNL  244

Query  991   ASIKTFASGILVPKSYIWPVDKSSSYL--QPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
               +KTFASGILVPKSYI P+D    YL   P  SLV DAH+ GL+VY S FA+D+  A D
Sbjct  245   TFVKTFASGILVPKSYILPLDD-KQYLVPPPPKSLVQDAHEAGLQVYVSGFANDIDIAHD  303

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS DPV+EYLSF+DNGN+SVDGVLSDFP+T S +IDC+SH+ +    QV +FLVIS +GA
Sbjct  304   YSSDPVSEYLSFVDNGNFSVDGVLSDFPLTASSSIDCFSHLGENAIKQV-DFLVISKNGA  362

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SGDYPGCTD AY KA+ DG D+IDC+
Sbjct  363   SGDYPGCTDLAYDKAIKDGADVIDCS  388



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   452 bits (1162),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 291/391 (74%), Gaps = 12/391 (3%)
 Frame = +1

Query  265   IFNLLLLCSAVTLVAAQ---GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFA  435
             +F L +L SAV LVAAQ    S N+TS WQTL G+APLVIA+GGFSG+FPDSS +AY  +
Sbjct  7     LFLLFVLHSAV-LVAAQSYRASKNTTSPWQTLHGNAPLVIAKGGFSGIFPDSSIDAYE-S  64

Query  436   GLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD---KQSTYLVNGVPTTAW  606
              L  L+NVI+WCDVQLTKDG GICFP + LDN+S++     +       Y VNG P    
Sbjct  65    TLLLLSNVILWCDVQLTKDGAGICFPYLNLDNSSDITFYIPNDSKNNRIYYVNGQPMQGH  124

Query  607   FPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ  786
             F +DF    L    L QG++SRS+ FD     ILTVEDV  +++ PGLWLNVQ+D+F+ Q
Sbjct  125   FSVDFTLNDLKNFFLVQGIFSRSNVFDHI-LGILTVEDVAKQLKKPGLWLNVQYDAFFKQ  183

Query  787   HNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQT  966
             HNLSMR+FVLSVSRRV ++YISSPEV FLKSI ++     TKLVFRFL  D+ EP+TNQT
Sbjct  184   HNLSMRSFVLSVSRRVNVSYISSPEVAFLKSITTQFKRSTTKLVFRFLRADDIEPTTNQT  243

Query  967   YGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD  1146
             YGS+L+NL  +KTFAS IL+PK+YIWPV ++  YLQP TS+VL+AH  GLEV+ASDFA+D
Sbjct  244   YGSILKNLTFVKTFASAILIPKNYIWPV-RTDLYLQPHTSVVLNAHGEGLEVFASDFAND  302

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLV  1326
                +++YSYDPV EYLSFIDNG +SVDG+LSDFP+T S AIDC++H+      +VP  L+
Sbjct  303   GLISYNYSYDPVKEYLSFIDNGKFSVDGILSDFPVTASEAIDCFAHVSTNSSGKVP--LI  360

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             IS++GASG YPG TD AY +A  DG D+IDC
Sbjct  361   ISYNGASGIYPGSTDIAYMQAFDDGADVIDC  391


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 158/355 (45%), Gaps = 47/355 (13%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A  STNS       SG  PL+I+  G SG++P S+  AY         +VI  C VQ+T+
Sbjct  347   AHVSTNS-------SGKVPLIISYNGASGIYPGSTDIAY-MQAFDDGADVID-CAVQMTQ  397

Query  490   DGVGICFPDIKL-DNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-----TLVNL  651
             DGV IC   I L DN + + T F  + +T +    P    F  +  + ++     ++ N 
Sbjct  398   DGVPICLGSINLMDNTNVIQTNFLSRLTT-IQQIQPNPGIFTFNLTWDEIKTLKPSIANP  456

Query  652   QQGVYSRSSRFDGTPQQILTVED--VFNKVQPPGLWLNVQHDSFYSQH-NLSMRTFVLSV  822
               G Y   +        I ++ED   F K +P  + +++++ ++ ++   LS+   V+  
Sbjct  457   FIGSYLYRNPAYKYTGNIFSLEDFLAFAKGKPLSVLISIENATYLAKSLGLSITDAVIDA  516

Query  823   SRRVVIN------YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
                   N       I S   + L     + N    +LV++    DE     + +      
Sbjct  517   LNHSGYNQTKQKVMIQSSNSSVLIKFKEKTN---YQLVYKV---DEDIRDADDS------  564

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAF  1161
             ++  IK FA  + + K+ ++P +K   +L   T++V   H   L VY   F ++ +  A+
Sbjct  565   SIMDIKQFAHSVAITKNSVFPTNKL--FLTGATNIVSKLHSSNLTVYVHVFHNEYLSQAW  622

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMR-KGQKNQVPEFL  1323
             D+  DP  E  +F+      +DG+++DFP    G  + Y + R     N+ P ++
Sbjct  623   DFWSDPNFEINNFVMGAR--IDGIITDFP----GTANAYRNNRCLKMGNRKPRYM  671



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   452 bits (1163),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 275/362 (76%), Gaps = 2/362 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P
Sbjct  40    SPWQTLTGNAPVVIAKGGFSGVFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             ++ ++N +N+  ++   +  YLVNGVPT+ WF +D++ K L+LV+L Q V+SR+ +FD +
Sbjct  100   ELTINNGTNIQVVYPQGEKNYLVNGVPTSGWFSVDYSIKDLSLVSLLQDVFSRTDKFDAS  159

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                IL VEDV  +V PP LWLN+QHD FY QHNLSMR+++LS+S+RV+++Y+SSPEV FL
Sbjct  160   LFPILAVEDVQKQVTPPALWLNIQHDMFYRQHNLSMRSYLLSLSKRVILSYVSSPEVIFL  219

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             +SIA       TK +FRFL     EPSTNQTYGSLL+NL  IKTFASGILVPK YIWPV 
Sbjct  220   RSIAGTFRRTKTKFIFRFLDEATIEPSTNQTYGSLLKNLTFIKTFASGILVPKQYIWPV-  278

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              S  YLQP TS+VLDAHK GLEVYAS FA+D  F+++YSYDP+AEYLSFIDNG +SVDGV
Sbjct  279   TSDLYLQPHTSIVLDAHKEGLEVYASGFANDALFSYNYSYDPLAEYLSFIDNGMFSVDGV  338

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             L+DFPIT S AI C+SH  +   ++  + +V S +GASG YP CTD AY +AV DG D I
Sbjct  339   LTDFPITASEAIGCFSHT-EANSSEHGKPVVFSHNGASGMYPDCTDLAYQQAVKDGADFI  397

Query  1414  DC  1419
             DC
Sbjct  398   DC  399



>ref|NP_001168748.1| uncharacterized protein LOC100382543 precursor [Zea mays]
 gb|ACN30591.1| unknown [Zea mays]
Length=747

 Score =   451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/368 (59%), Positives = 278/368 (76%), Gaps = 3/368 (1%)
 Frame = +1

Query  316   GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  495
              +    S W+TLSG AP ++A+GGFSGLFPDSS  AY FA L S  + I++CDV+LTKD 
Sbjct  21    AAAQKASSWKTLSGKAPAIVAKGGFSGLFPDSSEYAYQFALLASSPDTILYCDVRLTKDE  80

Query  496   VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRS  675
             +GIC PDIK+DN +N+   +   Q +YLVNGVPT+ WF +D+N  +L  V L+Q + SR+
Sbjct  81    IGICLPDIKMDNCTNIPDFYAQGQKSYLVNGVPTSGWFSVDYNGTELEQVTLKQSINSRT  140

Query  676   SRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISS  855
              RFD +   +L VEDV +K +P G+WLNVQHDSFYSQ NLSMR +++SVS+RVV+NYISS
Sbjct  141   PRFDSSFFPLLAVEDVQSKFKPSGIWLNVQHDSFYSQFNLSMRNYIISVSKRVVVNYISS  200

Query  856   PEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKS  1035
             PEV+FL S+  RI+ + TKLVFRFL     EPSTNQTYGS+L+NL  + TFASGILVPK 
Sbjct  201   PEVSFLTSLLGRISNK-TKLVFRFLDESSLEPSTNQTYGSMLKNLTFVSTFASGILVPKG  259

Query  1036  YIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGN  1215
             YIWP     +YLQ  TS+V DAHK GLE+YA+DFA+D   ++++SYDP+AEYLSFIDN  
Sbjct  260   YIWP-HSPDNYLQQYTSVVDDAHKAGLEIYAADFANDFVVSYNHSYDPLAEYLSFIDNDV  318

Query  1216  YSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVS  1395
             +SVDGVL+DFPIT S AI C++++ K   +   + L+IS +GASGDYPGCTD AY KAV 
Sbjct  319   FSVDGVLTDFPITASEAIGCFTNLNKSNTDH-GKPLIISHNGASGDYPGCTDLAYQKAVD  377

Query  1396  DGVDIIDC  1419
             DG D+IDC
Sbjct  378   DGADVIDC  385



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   465 bits (1196),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 227/385 (59%), Positives = 284/385 (74%), Gaps = 5/385 (1%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTNST---SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             +LLC  V +      T++    S W+TLSGDAP VI+RGGFSGLFPDSS +AY+FA  TS
Sbjct  6     VLLCGVVLIHVFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYNFALQTS  65

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + I+WCDVQLTKDG GICFPD+ + NAS +  ++   Q TY VNGVPT  WF +DF+ 
Sbjct  66    VADAILWCDVQLTKDGAGICFPDLNMSNASTIEVVYPKGQKTYPVNGVPTQGWFTVDFSL  125

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  V L +G+ SRS RFDG    I TV+ V  +++P GLWLNVQHD+FY+Q+NLSM  
Sbjct  126   KDLNKVYLIRGILSRSDRFDGNGYTISTVQTVNIELRPRGLWLNVQHDAFYAQNNLSMSN  185

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++S S+ V I+YISSPEVNF   IA R        VFRFL  +  EP+TN++YGS+L N
Sbjct  186   FLISASKNVSIDYISSPEVNFFTKIAGRFGHNGPIFVFRFLEKETFEPTTNRSYGSILSN  245

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DY
Sbjct  246   LTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDY  304

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             SYDPV+EYLSF+DNGN+SVDGVLSDFPI+ S +++C+SH+R+    QV +FLVIS +GAS
Sbjct  305   SYDPVSEYLSFVDNGNFSVDGVLSDFPISASASVECFSHLRRNATKQV-DFLVISKNGAS  363

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG  +IDC+
Sbjct  364   GDYPGCTDLAYDKAIRDGAGVIDCS  388



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   449 bits (1154),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/375 (57%), Positives = 277/375 (74%), Gaps = 2/375 (1%)
 Frame = +1

Query  295   VTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCD  474
             V  +  Q    +  KW TLSG+AP +IA+GGFSGLF DSS+NAY    L S ++  +WCD
Sbjct  15    VACLLLQLGLTTAQKWLTLSGNAPAIIAKGGFSGLFADSSYNAYKSVSLFSSSDTTLWCD  74

Query  475   VQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ  654
             V+LTKDGVGIC PDI L+N +++   +   + +Y+VNGVPT+ WF +D++  +L  V + 
Sbjct  75    VRLTKDGVGICLPDITLNNCTDIQYSYPQGKKSYMVNGVPTSGWFSVDYDKNELAQVTVT  134

Query  655   QGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRV  834
             Q +YSR++ FD +   I +V+DV  +++P  LWLN+QHD FY QHNLSMR +VLSVS+RV
Sbjct  135   QAIYSRTNAFDSSASPIYSVDDVKTQIKPGALWLNIQHDIFYRQHNLSMRNYVLSVSKRV  194

Query  835   VINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFAS  1014
             ++NY+SSPE+ FL  IA R     TKL+FRFLG D TEPSTNQTYG LL NL  IKTFAS
Sbjct  195   IVNYLSSPELAFLSGIAPRFRNTKTKLIFRFLGKDTTEPSTNQTYGLLLNNLTFIKTFAS  254

Query  1015  GILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYL  1194
             GILVPK+YIWP   S +YL+P TS+V DA K GLEVYA+DFA+D  F+++YSYDP+AE L
Sbjct  255   GILVPKNYIWPT-TSDNYLRPYTSIVTDAQKSGLEVYAADFANDYLFSYNYSYDPLAECL  313

Query  1195  SFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDX  1374
             SFIDNG +SVDGV++DFP+TPS AI C+S + K   +   + L+IS +GASGDY  CTD 
Sbjct  314   SFIDNGFFSVDGVVTDFPVTPSVAIGCFSQLNKSSIDH-GKPLIISHNGASGDYADCTDL  372

Query  1375  AYSKAVSDGVDIIDC  1419
             AY KAV DG D+IDC
Sbjct  373   AYQKAVDDGADVIDC  387



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   448 bits (1153),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 276/368 (75%), Gaps = 4/368 (1%)
 Frame = +1

Query  316   GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDG  495
              +    S W+TLSG+ P +IA+GGFSGLFPDSS  AY F    S  +  +WCDVQLTKDG
Sbjct  24    AAAQKASTWKTLSGNPPAIIAKGGFSGLFPDSSDFAYGFVAAASSPDTALWCDVQLTKDG  83

Query  496   VGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRS  675
              GIC PDI++DN +N+A ++   + TY VNGV T  WF +D++   L+ VNL Q ++SR 
Sbjct  84    AGICLPDIRMDNCTNIANVYPKGKKTYSVNGVSTPGWFSVDYDSTGLSKVNLVQSLFSRV  143

Query  676   SRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISS  855
               +DGT   IL VE VF   + P +WLNVQHDSFYSQ NLSMR+++LSVS++ + +YISS
Sbjct  144   PYYDGT-LPILPVESVFANYKAPAVWLNVQHDSFYSQFNLSMRSYILSVSKQYIADYISS  202

Query  856   PEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKS  1035
             PEVNFL S++ R+N + TKLVFR L     EPSTNQTYGS+L+NL  IKTFASGILVPK+
Sbjct  203   PEVNFLTSLSGRVNKK-TKLVFRLLNELAVEPSTNQTYGSMLKNLTFIKTFASGILVPKN  261

Query  1036  YIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGN  1215
             YIWPV +  +YLQP+TS+V DAHK GLEVYA+DFA+D   +++YSYDP+ EYL+FIDNG 
Sbjct  262   YIWPVTQ-DNYLQPSTSVVGDAHKAGLEVYAADFANDFLLSYNYSYDPLTEYLNFIDNGA  320

Query  1216  YSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVS  1395
             +SVDGVL+DFPITPS AI C+S++   + +     L+IS +GASGDYP CTD AY KAV+
Sbjct  321   FSVDGVLTDFPITPSEAIGCFSNLNNSKTDNAKP-LIISHNGASGDYPDCTDLAYQKAVT  379

Query  1396  DGVDIIDC  1419
             DG D+IDC
Sbjct  380   DGADVIDC  387



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   463 bits (1191),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 281/385 (73%), Gaps = 4/385 (1%)
 Frame = +1

Query  277   LLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             + LC  V   L A+Q  +    S W+TLSGDAP VI+RGGFSGLFPDSS +AY FA  TS
Sbjct  6     VFLCGVVLIHLFASQTDAQRPRSPWKTLSGDAPRVISRGGFSGLFPDSSLDAYIFALQTS  65

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + + ++WCDVQLTKDG GICFPD+ + NAS +  ++   Q TY VNGVPT  WF +DF+ 
Sbjct  66    VADAVLWCDVQLTKDGAGICFPDLNMSNASIIEVVYPKGQKTYPVNGVPTQGWFTVDFSL  125

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             K L  V L + + SRS RFDG    I TV+ V  +++P G WLNVQHD+FY+QHNLSM T
Sbjct  126   KDLNKVYLIRAILSRSDRFDGNEYTISTVQTVNKELKPLGFWLNVQHDAFYAQHNLSMST  185

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++S S+ V ++Y+SSPEVNF   IA R      K VFRFL  ++ EP+TN+TYGS+L N
Sbjct  186   FLISASKTVSVDYLSSPEVNFFTKIAGRFGRNGPKFVFRFLEKEQFEPTTNRTYGSILSN  245

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +K FASGILVPKSY+ P+D    YL P+TSLV DA K GLEV+ S FA+DV  A DY
Sbjct  246   LTFVKNFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAQKAGLEVFVSGFANDVDIAHDY  304

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             SYDPV+EYLSF+DNGN+SVDGVLSDFPIT S +I+C+SH+ +    Q  +FLVIS +GAS
Sbjct  305   SYDPVSEYLSFMDNGNFSVDGVLSDFPITASASIECFSHLGRNAIKQGIDFLVISKNGAS  364

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  365   GDYPGCTDLAYDKAIKDGADVIDCS  389



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   449 bits (1154),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 287/396 (72%), Gaps = 8/396 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSF  417
             M  LRS  + +LLC  V   L A +  +  S S+WQTLSG+AP VIARGGFSGL PDSS 
Sbjct  14    MLLLRS--STILLCGVVLIQLFAPRIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSL  71

Query  418   NAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPT  597
             +AY+ A   S+ +V++WCDVQLTK GVGICFPD+ L NAS V   +   Q +Y VNGV T
Sbjct  72    DAYNLAIQKSVADVVLWCDVQLTKYGVGICFPDLNLANASTVQYAYPKGQKSYPVNGVTT  131

Query  598   TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDS  774
               WF ID   + L  V L +G+ SRS RFDG    IL +++V  +++P  G WLNVQHD+
Sbjct  132   QGWFTIDSTMRDLQNVALIRGILSRSDRFDGNGYTILMIQNVAEQIKPQGGFWLNVQHDA  191

Query  775   FYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  954
             FY +HNLSM +F+LS S+ V +++ISSPEVNF K IA R        VF+FLG ++ EP+
Sbjct  192   FYEEHNLSMSSFLLSASKTVSMDFISSPEVNFFKKIAGRFKRNGPSFVFQFLGKEDVEPT  251

Query  955   TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  1134
             TNQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S 
Sbjct  252   TNQTYGSILSNLTFVKTFASGILVPKSYILPLD-DKQYLIPHTSLVQDAHKEGLKVYVSG  310

Query  1135  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  1314
             FA+D   A++YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC++H+ +    QV 
Sbjct  311   FANDNDLAYNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASASIDCFAHIGRNATKQV-  369

Query  1315  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +FLVIS +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  370   DFLVISKNGASGDYPGCTNLAYEKAIKDGADVIDCS  405



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   448 bits (1152),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 224/387 (58%), Positives = 282/387 (73%), Gaps = 8/387 (2%)
 Frame = +1

Query  277   LLLCSAVT--LVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V   L A Q  +  S S+WQTL+G+ P VIARGGFSGL PDSS +AY+ A  TS
Sbjct  16    LLFCGVVLIHLFATQIDAQRSRSRWQTLTGEVPRVIARGGFSGLLPDSSLDAYNLAIQTS  75

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             + +V++WCDVQLTKDGVGIC+PD+ L NAS V  ++ + Q +Y VNGV T  WF ID   
Sbjct  76    VADVVLWCDVQLTKDGVGICYPDLNLANASTVQFVYPNGQKSYPVNGVTTQGWFTIDSTL  135

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMR  804
             + L  V L +G+ SRS +FDG    ILT+++V  +++P  G WLNVQHD+FY QHNLSM 
Sbjct  136   RDLQNVALIRGILSRSDKFDGNRNMILTIQNVAEQIKPQGGFWLNVQHDAFYEQHNLSMS  195

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F+LS SR V +++ISSPEVNF   IA R        VF+FL  +E EP+TNQTYGS+L 
Sbjct  196   SFLLSTSRTVSMDFISSPEVNFFMKIAGRFKRNGPSFVFQFLRKEEIEPTTNQTYGSILS  255

Query  985   NLASIKTFASGILVPKSYIWP-VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
             NL  +KTFASGILVPKSYI   VDK   YL P TSLV DAH  GLEVY S FA+DV  A+
Sbjct  256   NLTFVKTFASGILVPKSYILRLVDK--QYLVPHTSLVQDAHIAGLEVYVSGFANDVDLAY  313

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             +YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S ++DC++H+ +    QV +FLVIS DG
Sbjct  314   NYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASASVDCFAHIGRNATKQV-DFLVISKDG  372

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  373   ASGDYPRCTNLAYEKAIKDGADVIDCS  399



>ref|XP_006344951.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2-like, partial [Solanum tuberosum]
Length=397

 Score =   435 bits (1119),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 223/361 (62%), Positives = 269/361 (75%), Gaps = 19/361 (5%)
 Frame = +1

Query  346   TLSGDAPLVIARGGFSGLFPDSSFNAYSFAGL-TSLTNVIMWCDVQLTKDGVGICFPDIK  522
             TLSGDAPLVIA GGFSGLF DSS+ AY  A L TSL NVI+WCDVQLTK+ V +CFPD+K
Sbjct  3     TLSGDAPLVIAXGGFSGLFLDSSYEAYIMAILETSLPNVIIWCDVQLTKNEVDMCFPDLK  62

Query  523   LDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQ  702
             LDN S++   +K+ +S YL+N V T  WF IDF+F  L  V  +QGVY R  +FD   Q 
Sbjct  63    LDNTSDIDAYYKNNKSKYLMNIVLTQGWFSIDFDFNDLMHVTSKQGVYFRIEKFD-XKQN  121

Query  703   ILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSI  882
             ILTV DV N+V+  GLWLN+QH +F++QHNLSMR +++ +SR V+INYISSPEV FL +I
Sbjct  122   ILTVXDVANQVKHLGLWLNIQHVNFFTQHNLSMRNYIIFISRNVLINYISSPEVTFLTNI  181

Query  883   ASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSS  1062
              +R NPR TKLVF FLG D+ E S NQTYGSLL N+  IKTFASGILVPKS IWPVD +S
Sbjct  182   VARFNPRFTKLVFLFLGQDDVESSINQTYGSLLNNVTFIKTFASGILVPKSCIWPVD-NS  240

Query  1063  SYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSD  1242
              YLQP TSLVLDAHK  LE++AS+FA+DV FA +YSYDP +EYLS IDN  +SVDGVL D
Sbjct  241   HYLQPYTSLVLDAHKECLEIFASEFANDVHFAXNYSYDPTSEYLSLIDNDVFSVDGVLYD  300

Query  1243  FPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDY--PGCTDXAYSKAVSDGVDIID  1416
             FP+T S  I+              + L+I+ +GASGDY  PGCTD  Y+KAVSDG D++D
Sbjct  301   FPVTASATIE--------------KLLIITSEGASGDYSAPGCTDMVYTKAVSDGADVLD  346

Query  1417  C  1419
             C
Sbjct  347   C  347



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   447 bits (1149),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 226/387 (58%), Positives = 289/387 (75%), Gaps = 13/387 (3%)
 Frame = +1

Query  265   IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             +  L L CSA           + S W TL G  PLVIA  GFSGLFP SS  AY+ A +T
Sbjct  15    LLQLSLFCSA---------QKTPSSWLTLDGFPPLVIAHNGFSGLFPPSSSYAYNLAMMT  65

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             S+ +V++WCDVQLTKD  GICFPDIKLDN+SNV  +++D+  TY V+G     +F IDF 
Sbjct  66    SVPDVVLWCDVQLTKDAAGICFPDIKLDNSSNVNLVYEDRVKTYDVDGASVKGYFAIDFT  125

Query  625   FKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
              ++L+ ++L QG+Y+RS  FDG+  QI  V+DVF + +PPG WLNVQ+D+FY QH LSMR
Sbjct  126   VEELSNISLTQGIYTRSPDFDGSLFQIQLVDDVFVQNKPPGFWLNVQNDAFYRQHKLSMR  185

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F++  S+RV+I++ISS +++FL+++A       TK +FRF   D  EPSTNQT+GSLL+
Sbjct  186   SFLIGASKRVIISHISSSDISFLQALARPFASSKTKRIFRFFDVDAVEPSTNQTFGSLLK  245

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  IKTFA+GILVPK+YIWPVD ++SYL P TSLV DAHK GLEV+ASDFA+D  FA++
Sbjct  246   NLTMIKTFAAGILVPKTYIWPVD-ATSYLLPHTSLVADAHKAGLEVFASDFANDNTFAYN  304

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-RKGQKNQVPEFLVISFDG  1341
             YSY+PVAEYLSFIDNG++SVDG+LSDFPITPS AIDC++H+  K      P  LVIS DG
Sbjct  305   YSYNPVAEYLSFIDNGDFSVDGLLSDFPITPSAAIDCFAHLPTKASPAGAP--LVISHDG  362

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGD+PGCTD AY +A+ DG D+IDCT
Sbjct  363   ASGDFPGCTDIAYEQAIKDGADVIDCT  389


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 144/317 (45%), Gaps = 39/317 (12%)
 Frame = +1

Query  361   APLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASN  540
             APLVI+  G SG FP  +  AY  A +    +VI  C VQ++KDGV  C   + L N + 
Sbjct  354   APLVISHDGASGDFPGCTDIAYEQA-IKDGADVID-CTVQMSKDGVPFCSSSVNLMNTTL  411

Query  541   VA-TLFKDKQSTYLVNGVPTT-AWFPIDFNF---KQLTLV--------NLQQGVYSRSSR  681
             V  T F+   ST  VN + T    F    N+   K LT V        +L +   +R++ 
Sbjct  412   VGQTQFRSLIST--VNDIQTKPGIFSFSLNWTDIKDLTPVISNPFPDYSLYRNPEARNA-  468

Query  682   FDGTPQQILTVEDVFNKVQP-PGLWLNVQHDSFYS-QHNLSMRTFVLSVSRRVVINYISS  855
               G  Q +    D+  K     G+ + +   +F + +  LS+   V     +   +  S+
Sbjct  469   --GKIQSLGDFLDLAKKATSLSGVSIRIGRANFLALKEGLSITDAVKDALDKAGYDGPSA  526

Query  856   PEVNFLK---SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
              +V  +    S+   +  +  KLV+     DE         G+    +A+IK+FA  ++V
Sbjct  527   EKVMIVSTNSSVLKAMKGKKYKLVYDV---DEG------IRGAPDNAIANIKSFADAVIV  577

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
              K+ I+P D    +L   T +V   H   L VY     ++ +  A+D+  DP+ E  S++
Sbjct  578   SKASIFPSD--GGFLIAATDVVKQFHSHKLPVYVRVLRNEFISQAYDFFSDPIVEINSYV  635

Query  1204  DNGNYSVDGVLSDFPIT  1254
                   VDGV++DFP T
Sbjct  636   MGAE--VDGVITDFPKT  650



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   457 bits (1175),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 230/397 (58%), Positives = 292/397 (74%), Gaps = 18/397 (5%)
 Frame = +1

Query  280   LLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             LLC  V   L AAQ  +  STS WQTLSGDAPLVIARGGFSGLFPDSS  AY FA + S+
Sbjct  9     LLCGVVLLQLFAAQVDAQRSTSPWQTLSGDAPLVIARGGFSGLFPDSSLAAYQFAMVVSV  68

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
              +V++WCDVQLTKDG GICFPD+ L NASN   ++ ++Q +Y VNGV T  WFPIDF+  
Sbjct  69    ADVVLWCDVQLTKDGHGICFPDLNLANASNSEEVYPNRQKSYPVNGVTTKGWFPIDFSLT  128

Query  631   QL--TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
             +L   L +L +G+ SRS +FD     I TV++V  +++P   WLNVQHD FY QHNLSM 
Sbjct  129   ELQKVLFSLIRGILSRSGKFDENGYSISTVQNVATQMKPALFWLNVQHDEFYEQHNLSMS  188

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F+LS SR V I++ISSPEVNF + IA          VF+F+G ++ EP+TN+TYGS+L 
Sbjct  189   SFLLSTSRTVSIDFISSPEVNFFRKIAGGFGNNGPSFVFQFMGKEDFEPTTNRTYGSILS  248

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL+ +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL++YAS FA+DV  A++
Sbjct  249   NLSFVKTFASGILVPKSYILPLD-DKQYLLPHTSLVQDAHKAGLKLYASGFANDVDIAYN  307

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-----RKGQKN-QVP----  1314
             YS+DPV+EYLSF+DNGN+SVDG+LSDFP+T S ++DC+SH+     ++ QK+  +P    
Sbjct  308   YSWDPVSEYLSFVDNGNFSVDGMLSDFPLTASASVDCFSHIGRNATKQEQKHYHLPMVRA  367

Query  1315  --EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
               +FLVIS +GASG+YPGCT  AY KA+ DG D+IDC
Sbjct  368   SVDFLVISKNGASGEYPGCTKLAYEKAIKDGSDVIDC  404



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   447 bits (1150),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 273/362 (75%), Gaps = 2/362 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    +   ++ I WCDV+LTKDGVGIC P
Sbjct  40    SPWQTLTGNAPVVIAKGGFSGIFPDSSDAAYKLTYIAGSSDTISWCDVRLTKDGVGICLP  99

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             ++ ++N +N+  ++   +  YLVNGVPT+ WF +D++ K L+ V+L QGV+SR+ +FD +
Sbjct  100   ELTINNGTNIQVVYSQGEKNYLVNGVPTSGWFSVDYSIKDLSQVSLIQGVFSRTDKFDAS  159

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                IL VEDV  +V+PP LWLN+QHD FY QHNLSMR+++LS+S+RV+++Y+SSPEV FL
Sbjct  160   LFPILAVEDVQKQVRPPALWLNIQHDMFYRQHNLSMRSYLLSLSKRVILSYVSSPEVIFL  219

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
              SIA       TK +FRFL     EPSTNQTYG+LL+NL  IKTFASGILVPK YIWPV 
Sbjct  220   SSIAGTFKRTKTKFIFRFLDEATIEPSTNQTYGALLKNLTFIKTFASGILVPKQYIWPV-  278

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              S  YLQP TS+VLDAHK GLEVYAS FA+D  F+++YSYDP+AEYLSFIDNG +SVDGV
Sbjct  279   TSDLYLQPYTSVVLDAHKEGLEVYASGFANDAQFSYNYSYDPLAEYLSFIDNGIFSVDGV  338

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             L+DFPIT S AI C+S   K   ++  + +V S +GASG Y  CTD AY +AV DG D I
Sbjct  339   LTDFPITASEAIGCFSQT-KANSSEHGKPVVFSHNGASGMYADCTDLAYQQAVKDGADFI  397

Query  1414  DC  1419
             DC
Sbjct  398   DC  399



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   447 bits (1149),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/375 (60%), Positives = 277/375 (74%), Gaps = 6/375 (2%)
 Frame = +1

Query  301   LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  480
             LV AQ  TN    W TL+G+ PLVIA GGFSG+FPDSS  AY  A  TSL +V +WCDVQ
Sbjct  26    LVFAQ--TNKRYDWNTLAGNPPLVIAHGGFSGIFPDSSGAAYGLALETSLPDVALWCDVQ  83

Query  481   LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  660
             LTKD  GI  P++ L N++ ++    +K + Y VNGV T  +F +D+  K L+ V L QG
Sbjct  84    LTKDASGIFLPNVNLLNSNYISFAIPNKTTNYSVNGVSTRGYFSVDYTLKDLSNVLLSQG  143

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQP--PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRV  834
             V+SRS+  D     ILTV DV   V P  P LWLN+QHD+FY+QH LS+R++VLSVSR V
Sbjct  144   VFSRSTLLDANGYLILTVNDVVKSVAPQTPSLWLNIQHDAFYTQHKLSIRSYVLSVSRSV  203

Query  835   VINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFAS  1014
              ++YISSPEV FL+SI +R NP++TKLVFRFL  D+T+PSTNQTYGSLL+NL  IKTFAS
Sbjct  204   PVSYISSPEVGFLRSITTRFNPKITKLVFRFLNQDDTDPSTNQTYGSLLKNLTFIKTFAS  263

Query  1015  GILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYL  1194
             GILVPK YIWPVD  S YLQP T+LV DAHK GLEVYASDF +DV  +++YSYDP+AEYL
Sbjct  264   GILVPKEYIWPVD-VSLYLQPHTTLVSDAHKAGLEVYASDFFNDVVNSYNYSYDPLAEYL  322

Query  1195  SFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDX  1374
              FIDNG +SVDGVL+DFPITPS AI C++H+      +  + L+IS  GASGDYP CTD 
Sbjct  323   QFIDNGEFSVDGVLTDFPITPSEAIGCFAHL-GANATRKDKTLIISKYGASGDYPACTDL  381

Query  1375  AYSKAVSDGVDIIDC  1419
             AY  A+ DG D++DC
Sbjct  382   AYKNAILDGADVLDC  396



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   447 bits (1149),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 288/385 (75%), Gaps = 7/385 (2%)
 Frame = +1

Query  283   LCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             LC  + L+   AAQ  +  STS++  L GDAP VIARGGFSGL PDSS +AY+ A  TS+
Sbjct  20    LCCGIVLILLFAAQIDAQRSTSRFIYLPGDAPRVIARGGFSGLLPDSSLDAYNLAIQTSV  79

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
              +V++WCDVQLTKDGVGICFPD+ + NAS V  ++ + Q +Y VNGV T  WF I F+ +
Sbjct  80    ADVVLWCDVQLTKDGVGICFPDLNMANASTVQNVYPNGQKSYPVNGVSTQGWFTIAFSLR  139

Query  631   QLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMRT  807
              L  V+L +G+ SR+ +FDG    I T+++V  +++P  GLWL+VQHD+FY QHNLSM +
Sbjct  140   DLQNVSLIRGILSRTDKFDGNGYTIPTIQNVTEQIKPQGGLWLHVQHDAFYEQHNLSMSS  199

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++SVSR V I++ISSPEVNF K I           VF+FLG ++ EP+TN+TYGS+L N
Sbjct  200   FLVSVSRTVSIDFISSPEVNFFKKITGHFKRNGPSFVFQFLGKEDFEPTTNRTYGSILSN  259

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             LA +KTFAS ILVPKSYI+P+D  + YL P TSLV DAHK GLEVY S FA+D   A++Y
Sbjct  260   LAFVKTFASKILVPKSYIFPLD-DNQYLLPPTSLVQDAHKAGLEVYVSGFANDNDLAYNY  318

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             SYDPV+EYLSF+DNG++SVDGV+SDFP+T S +IDC+SH+ +    QV +FL+IS +GAS
Sbjct  319   SYDPVSEYLSFVDNGDFSVDGVISDFPMTASASIDCFSHIDRNATKQV-DFLIISKNGAS  377

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GD+PGCT+ AY KA+ DG D+IDC+
Sbjct  378   GDFPGCTNLAYEKAIKDGADVIDCS  402



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   444 bits (1142),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 282/390 (72%), Gaps = 7/390 (2%)
 Frame = +1

Query  268   FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AYS A 
Sbjct  16    YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYSLAT  75

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  615
              TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76    QTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  616   DFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPG-LWLNVQHDSFYSQHN  792
             DF+   L  V+L +G+ SRS +FDG    I T+++V  ++ P G  WLNVQHD+FY Q N
Sbjct  136   DFSLGDLQNVSLIRGILSRSDKFDGNGYAISTIQNVAEQISPQGGFWLNVQHDAFYEQQN  195

Query  793   LSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYG  972
             LSM +F+LS S  V I +ISSPEVNF   IA          VF+FL  ++ EP+TNQTYG
Sbjct  196   LSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSFVFQFLEKEDFEPTTNQTYG  255

Query  973   SLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVP  1152
             S+L NL  +KTFASGILVPKSYI P++    YL P TSLV DAHK GL+VY S FA+DV 
Sbjct  256   SILSNLTFVKTFASGILVPKSYILPLND-KRYLLPHTSLVQDAHKAGLQVYVSGFANDVD  314

Query  1153  FAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVIS  1332
              A++YS DPV+EYLSF+DNGN+SVDG+LSDFP+T S +IDC+SH+ +     V +FLVIS
Sbjct  315   IAYNYSSDPVSEYLSFVDNGNFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-DFLVIS  373

Query  1333  FDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
              +GASGDYPGCTD AY  A+ DG D+IDC+
Sbjct  374   KNGASGDYPGCTDLAYENAIKDGADVIDCS  403



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   460 bits (1183),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 286/387 (74%), Gaps = 7/387 (2%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTNST---SKWQTLSGD--APLVIARGGFSGLFPDSSFNAYSFAGL  441
             +LLC  V +      T++    S W+TLSG+  AP VI+RGGFSGLFPDSS +AY+FA  
Sbjct  6     VLLCGVVLIHLFASQTDAQRPGSPWKTLSGESVAPRVISRGGFSGLFPDSSLDAYNFALQ  65

Query  442   TSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDF  621
             TS+ + +MWCDVQLTKDG GICFP + + NASN+   + ++ +TYLV+GV T  WF IDF
Sbjct  66    TSVADAVMWCDVQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVSGVSTQGWFTIDF  125

Query  622   NFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
             + K L+ VNL +G+ SRS RFDG    I TV+ V  +++P GLWLNVQHD+FY+Q+NLSM
Sbjct  126   SLKDLSKVNLIRGILSRSDRFDGNGYTISTVQTVNIELKPRGLWLNVQHDAFYAQNNLSM  185

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
               F++S S+ V I+YISSPEVNF   IA R        VFRFL  +  EP+TN++YGS+L
Sbjct  186   SNFLISASKNVSIDYISSPEVNFFTKIAGRFGHNGPIFVFRFLEKETFEPTTNRSYGSIL  245

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A 
Sbjct  246   SNLTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAH  304

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDG  1341
             DYSYDPV+EYLSF+DNGN+SVDGVLSDFPIT S +IDC+SH+ +    QV +FLVIS +G
Sbjct  305   DYSYDPVSEYLSFVDNGNFSVDGVLSDFPITASASIDCFSHLGRNATKQV-DFLVISKNG  363

Query  1342  ASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             ASGDYPGCTD AY KA+ DG  +IDC+
Sbjct  364   ASGDYPGCTDLAYDKAIRDGAGVIDCS  390



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   445 bits (1144),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 212/367 (58%), Positives = 272/367 (74%), Gaps = 3/367 (1%)
 Frame = +1

Query  319   STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  498
             +  ++S W+TLSG++P +IA+GGFSGLFPDSSF AY    L S  +  +WCDV+LTKD V
Sbjct  26    TARTSSAWRTLSGNSPAIIAKGGFSGLFPDSSFYAYKSVSLFSANDTTLWCDVRLTKDSV  85

Query  499   GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSS  678
             GIC PDIKLDN + +   F   + TY+VNG  T+ WF +D++   L  V L Q +YSR+ 
Sbjct  86    GICLPDIKLDNCTTIQYYFDKGKKTYVVNGANTSGWFSVDYSISDLAPVTLTQAIYSRTY  145

Query  679   RFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSP  858
             RFD     IL+V+DV  +VQP  LWLN+QHD+FY+QHNL+MR +VLS+++R+ +NY+SSP
Sbjct  146   RFDSAGLPILSVDDVVTQVQPSSLWLNIQHDAFYTQHNLNMRNYVLSLTKRITVNYLSSP  205

Query  859   EVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSY  1038
             E+ FL+ IA   N   TKL+FRFL     EPSTN+TY  LL NL  I+TFASGILVPKSY
Sbjct  206   ELAFLRKIAPSFNNTKTKLIFRFLDKGIKEPSTNRTYRLLLNNLKLIRTFASGILVPKSY  265

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNY  1218
             IWPV    +YL P TS+V DAHK GLE+YA+DFA+D  F+++YSYDP+ E LSFIDNG +
Sbjct  266   IWPV-TPDNYLLPYTSIVTDAHKAGLEIYAADFANDNLFSYNYSYDPLTECLSFIDNGLF  324

Query  1219  SVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSD  1398
             SVDGV++DFPITPS AI C+S + K + +  P  L+IS +GASGDYP CTD AY+KAV D
Sbjct  325   SVDGVVTDFPITPSEAIGCFSRLNKSRVDGKP--LIISNNGASGDYPDCTDLAYNKAVED  382

Query  1399  GVDIIDC  1419
             G D+IDC
Sbjct  383   GADVIDC  389



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   442 bits (1137),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 283/390 (73%), Gaps = 7/390 (2%)
 Frame = +1

Query  268   FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16    YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  615
              TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76    QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  616   DFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPG-LWLNVQHDSFYSQHN  792
             DF+   L  V+L +G+ SRS RFDG    I T+++V  K+ P G  WLNVQHD+FY Q N
Sbjct  136   DFSLGDLQNVSLIRGILSRSDRFDGNGYAISTIQNVAEKISPQGGFWLNVQHDAFYEQQN  195

Query  793   LSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYG  972
             LS+ +F+LSVSR V I++ISSPEVNF   I  +        VFRFL  ++ E +TNQTY 
Sbjct  196   LSISSFLLSVSRTVSIDFISSPEVNFFMKIVGQFGRNGPTSVFRFLRKEDFEQTTNQTYS  255

Query  973   SLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVP  1152
             S+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S FA+DV 
Sbjct  256   SILSNLTFVKTFASGILVPKSYILPLD-DKQYLLPHTSLVQDAHKAGLQVYVSGFANDVD  314

Query  1153  FAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVIS  1332
              A +YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+SH+ +     V +FLVIS
Sbjct  315   IAHNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-DFLVIS  373

Query  1333  FDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
              +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  374   KNGASGDYPGCTNLAYEKAIKDGADVIDCS  403



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   443 bits (1139),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 282/390 (72%), Gaps = 7/390 (2%)
 Frame = +1

Query  268   FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AYS A 
Sbjct  16    YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYSLAT  75

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  615
              TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76    QTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  616   DFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPG-LWLNVQHDSFYSQHN  792
             DF+   L  V+L +G+ SRS +FDG    I T+++V  ++ P G  WLNVQHD+FY Q N
Sbjct  136   DFSLGDLQNVSLIRGILSRSDKFDGNGYAISTIQNVAEQISPQGGFWLNVQHDAFYEQQN  195

Query  793   LSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYG  972
             LSM +F+LS S  V I +ISSPEVNF   IA          VF+FL  ++ EP+TNQTYG
Sbjct  196   LSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSFVFQFLEKEDFEPTTNQTYG  255

Query  973   SLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVP  1152
             S+L NL  +KTFASGILVPKSYI P++    YL P TSLV DAHK GL+VY S FA+DV 
Sbjct  256   SILSNLTFVKTFASGILVPKSYILPLN-DKRYLLPHTSLVQDAHKAGLQVYVSGFANDVD  314

Query  1153  FAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVIS  1332
              A++YS DPV+EYLSF+DNGN+SVDG+LSDFP+T S +IDC+SH+ +     V +FLVIS
Sbjct  315   IAYNYSSDPVSEYLSFVDNGNFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-DFLVIS  373

Query  1333  FDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
              +GASGDYPGCTD AY  A+ DG D+IDC+
Sbjct  374   KNGASGDYPGCTDLAYENAIKDGADVIDCS  403



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 253/314 (81%), Gaps = 3/314 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S+WQTL+GD P VIARGGFSG+F DSS  AY  A LT  TNVI+WCDVQL+KD  GICFP
Sbjct  1     SRWQTLNGDVPFVIARGGFSGMFSDSSPAAYRLALLTGPTNVILWCDVQLSKDAAGICFP  60

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             D+KLDN S++ T+F +KQ TYLVNGV T  WF +D+  K +  V L QGV+SRS++FDG 
Sbjct  61    DLKLDNNSDITTVFPNKQKTYLVNGVATKGWFSVDYTLKDIGNVILNQGVFSRSNKFDGN  120

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRR--VVINYISSPEVN  867
                I+TV D +  ++PPG WLN+QH++FY+QHNLSMR FV+S++R   V ++YISSPEV 
Sbjct  121   NYPIMTVADTYTLLKPPGFWLNIQHNAFYAQHNLSMRNFVISLTRNVTVTVDYISSPEVA  180

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FL+SIA+R     TKLVFRFL  D  EPSTN TYGSLL+NL  +KTFASGI+VPKSY+WP
Sbjct  181   FLRSIAARFQRSTTKLVFRFLELDTVEPSTNLTYGSLLKNLTFVKTFASGIIVPKSYVWP  240

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             VD S+ YLQP+TS+VLDAHK GLEV+ASDF +DVPF+F+YSYDPVAEYL F+DNG +SVD
Sbjct  241   VD-SNLYLQPSTSVVLDAHKEGLEVFASDFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVD  299

Query  1228  GVLSDFPITPSGAI  1269
             GV+SDFPITPS AI
Sbjct  300   GVISDFPITPSAAI  313



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   442 bits (1136),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 273/365 (75%), Gaps = 5/365 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TL G  PLVIARGGFSG+FPDSS  +Y+ A  TS  NV +WCDVQLTKDGVGICFP
Sbjct  22    SGWKTLQGSPPLVIARGGFSGIFPDSSSPSYNLALKTSSLNVTLWCDVQLTKDGVGICFP  81

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             D KLDNA++++ ++  K   Y VN   T  WF  D+NF +L  V+L QGVYSR+++FDG+
Sbjct  82    DFKLDNATDISVVYPGKAKDYSVNNFSTRGWFSADYNFNELANVSLVQGVYSRTNKFDGS  141

Query  694   PQQILTVEDVFNKVQPP--GLWLNVQHDSFYSQHNLSMRTFVLSVSRR-VVINYISSPEV  864
                IL VEDV   V+ P  GLWLNVQHD+FY  HNLS++ F+LS+S + V INYISS  V
Sbjct  142   KYHILKVEDVAKLVKSPSTGLWLNVQHDTFYKHHNLSVKKFLLSLSTKGVSINYISSTNV  201

Query  865   NFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIW  1044
             +FL+ + S  + R + L+FRFL   + EP+TNQTYG+LL+NL  I+ FASGILVPK YIW
Sbjct  202   DFLRRVRSNSSLRKSILIFRFLEKHKIEPTTNQTYGALLKNLTLIRKFASGILVPKGYIW  261

Query  1045  PVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSV  1224
             PVD S  YLQ  TS+V DAHK GL+V+ S+  +DV F++++SYDP+AE LSFIDNGN+SV
Sbjct  262   PVD-SELYLQQHTSIVSDAHKKGLKVFVSEIVNDVSFSYNFSYDPMAECLSFIDNGNFSV  320

Query  1225  DGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGV  1404
             DGVLSDFP+TPS AI+C S + K  K QV E LVI+  GASGDYP CTD AY KA SDG 
Sbjct  321   DGVLSDFPVTPSAAINCLSGLGKKAKKQV-ETLVITKYGASGDYPACTDLAYKKAKSDGA  379

Query  1405  DIIDC  1419
             D++DC
Sbjct  380   DVLDC  384


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 151/322 (47%), Gaps = 26/322 (8%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI + G SG +P  +  AY  A   S    ++ C VQ++KDG+  C   I L  ++ VA
Sbjct  352   LVITKYGASGDYPACTDLAYKKA--KSDGADVLDCPVQMSKDGIPFCLSSIDLSMSTTVA  409

Query  547   -TLFKDKQSTY--LVNGVPTTAWFPIDFN-FKQLT---LVNLQQGVYSRSSRFDGTPQQI  705
              T F++  +T   + NG      F + +N  K LT   L   ++ +  R+ +F       
Sbjct  410   NTKFRNHTATIPEIKNGSGIYT-FSLTWNEIKTLTPSILKPYEKYLLFRNPKFKNQ-GNF  467

Query  706   LTVEDVFNKVQPPGLWLNVQHDSFYSQ-HNLSMRTFVLSVSRRVVINYISSPEVNFLKSI  882
             +T+ +  +  +  G+ +++++ ++ ++   LS+   VL+  ++   +   SP+V    + 
Sbjct  468   VTLSEFLSLAKGSGILISIENAAYLAEKRGLSVTNAVLNTLKKAGYDKPKSPKVMIQSTH  527

Query  883   ASRINPRVTKLVF-RFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKS  1059
             +S +     K  + R    DE     +       + +  IKTFA  +++ K+ ++P  +S
Sbjct  528   SSVLKIFKNKSKYERVYKVDENIHDADD------KAVEDIKTFADSVVIQKASVFP--QS  579

Query  1060  SSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
              ++L  +T+ V       L VY   F+++ V  A+DY  D   E  SF+      V+G++
Sbjct  580   EAFLVNSTNTVERFQSFKLSVYVETFSNEFVSQAWDYYSDAFVEINSFVIGAK--VNGII  637

Query  1237  SDFPITPSGAI--DCYSHMRKG  1296
             +DFP T +      C  H  K 
Sbjct  638   TDFPKTAARYTKNKCLKHRNKA  659



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   443 bits (1139),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 220/373 (59%), Positives = 277/373 (74%), Gaps = 6/373 (2%)
 Frame = +1

Query  301   LVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQ  480
             LV AQ    S   WQTL+G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I+WCDV+
Sbjct  32    LVTAQTPKGS---WQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVR  88

Query  481   LTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQG  660
             LTKDGVG+C P++ ++N +N+  ++   +  Y VNGVPT+ WF +D++   L+ V L QG
Sbjct  89    LTKDGVGVCLPELTINNGTNIDVVYPQGKKNYPVNGVPTSGWFSVDYSINDLSPVLLMQG  148

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             V SR++RFD +   ILTVEDV  +V+PP LWLN+QHD FY+QHNLSMR+++LS+S+RV++
Sbjct  149   VLSRTNRFDAS-SVILTVEDVQKQVKPPALWLNIQHDMFYTQHNLSMRSYLLSLSKRVIL  207

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             NY+SS EV FL SI        TK +FRFL     EPSTNQTYGSL +NL  IKTFASGI
Sbjct  208   NYVSSAEVVFLSSITRTFKATKTKFIFRFLDKAAIEPSTNQTYGSLSKNLTFIKTFASGI  267

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPV  S  YLQP TS VLDAHK GLEV+AS FA+D   +++YSYDP+AEYLSF
Sbjct  268   LVPKQYIWPV-TSDLYLQPHTSFVLDAHKEGLEVFASGFANDALISYNYSYDPLAEYLSF  326

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             IDNG +SVDGVL+DFP T S AI C+SH+ K   ++  + LVIS +GASG YP CTD AY
Sbjct  327   IDNGIFSVDGVLTDFPKTASEAIGCFSHI-KANYSEHGKPLVISHNGASGIYPDCTDLAY  385

Query  1381  SKAVSDGVDIIDC  1419
              +AV DGVD+IDC
Sbjct  386   QQAVKDGVDVIDC  398



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   441 bits (1133),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 224/385 (58%), Positives = 285/385 (74%), Gaps = 8/385 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L+L  S V LV++ G     S W+TL G  PLVIARGGFSG+FPDSS  AY+ A  TS  
Sbjct  14    LILQYSLVALVSSAGPP---SGWKTLQGSPPLVIARGGFSGIFPDSSSLAYNLALNTSSP  70

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NVI+WCDVQLTKDG GICFP++KLDNA++++ +++ K   + V+GVPT  WF +D+NF++
Sbjct  71    NVILWCDVQLTKDGTGICFPELKLDNATDISVVYQGKAKDHFVSGVPTRGWFSVDYNFQE  130

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP--GLWLNVQHDSFYSQHNLSMRT  807
             L  V+L QGVYSR++ FDG    IL VE+V N ++ P  GLWLN+QHDSF+ Q NLS+ T
Sbjct  131   LANVSLVQGVYSRTNVFDGNKLPILHVEEVANLIKSPSTGLWLNIQHDSFFKQQNLSVET  190

Query  808   FVLS-VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             F+ S V++ V ++YISSP+V FLK + S  +   T L+FR L   + EP+TNQ+YG LL+
Sbjct  191   FLRSLVAKNVTVSYISSPDVGFLKRVKSIFSHGTTSLIFRVLEQSKIEPTTNQSYGKLLK  250

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NLA IK FASGILVPK YIWPVD SS YLQP TSLV DAHK  L+V+ SD  +DVPF+++
Sbjct  251   NLAQIKAFASGILVPKGYIWPVD-SSLYLQPHTSLVSDAHKEKLQVFVSDHINDVPFSYN  309

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             +SYDPVAE LSF + G++SVDGVLSDFP+TPS AI+C+S   K    QV + LVI+  GA
Sbjct  310   FSYDPVAECLSFFNVGDFSVDGVLSDFPVTPSVAINCFSGQGKNGTKQV-DTLVITKYGA  368

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGD P CTD AY KA SDG D++DC
Sbjct  369   SGDNPACTDLAYKKAKSDGADVLDC  393



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   441 bits (1135),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 283/390 (73%), Gaps = 7/390 (2%)
 Frame = +1

Query  268   FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             ++ +LLC  V   L +AQ  +  S S+WQTLSGD PLVIARGGFSGL PDSS +AY FA 
Sbjct  16    YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDPPLVIARGGFSGLLPDSSIDAYGFAI  75

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  615
              TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76    QTSVDDVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  616   DFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPG-LWLNVQHDSFYSQHN  792
             DF+   L  V+L +G+ SRS RFDG    I T+++V  K+ P G  WLNVQHD+FY Q N
Sbjct  136   DFSLGDLQNVSLIRGILSRSDRFDGNGYAISTIQNVAEKISPQGGFWLNVQHDAFYEQQN  195

Query  793   LSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYG  972
             LS+ +F+LSVSR V I++ISSPEVNF   I  +        VFRFL  ++ E +TNQTY 
Sbjct  196   LSISSFLLSVSRTVSIDFISSPEVNFFMKIVGQFGRNGPTSVFRFLRKEDFEQTTNQTYS  255

Query  973   SLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVP  1152
             S+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S FA+DV 
Sbjct  256   SILSNLTFVKTFASGILVPKSYILPLDD-KQYLLPHTSLVQDAHKAGLQVYVSGFANDVD  314

Query  1153  FAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVIS  1332
              A +YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+SH+ +     V +FLVIS
Sbjct  315   IAHNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-DFLVIS  373

Query  1333  FDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
              +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  374   KNGASGDYPGCTNLAYEKAIKDGADVIDCS  403



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   455 bits (1170),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 217/377 (58%), Positives = 281/377 (75%), Gaps = 3/377 (1%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14    IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             DVQLTKD  GIC+PD+KL+N S + +++  ++ +YLVNGVPT  WF IDF+ + L  V+L
Sbjct  74    DVQLTKDDFGICYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWFTIDFSLRDLKNVSL  133

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRR  831
              QG+ S++ + DG    ILTV+DV  +++P  +WLNVQHD+FY+QHNLSM +F++S SR 
Sbjct  134   IQGILSQTGKIDGNGFSILTVQDVTAQIKPESIWLNVQHDAFYAQHNLSMSSFLVSASRT  193

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFA  1011
             V I+YISSPE+NF + +           VF+FLG ++ EP+T +TYGS+L NL  +KTFA
Sbjct  194   VSIDYISSPELNFFQKLTGHFGRNGPSFVFKFLGKEDFEPTTKRTYGSILSNLTYVKTFA  253

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEY  1191
             SGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F++D   A++YS+DPV+EY
Sbjct  254   SGILVPKSYILPLD-DKQYLLPPTSLVHDAHKAGLQVYVSGFSNDADIAYNYSFDPVSEY  312

Query  1192  LSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTD  1371
             LSF+DNG++SVDGVLSDFPIT S +IDC+SH+ +    QV +FLVIS  GASGDYPGCT+
Sbjct  313   LSFMDNGDFSVDGVLSDFPITASASIDCFSHIGRNATKQV-DFLVISKHGASGDYPGCTN  371

Query  1372  XAYSKAVSDGVDIIDCT  1422
              AY KA+ DG D+IDC+
Sbjct  372   LAYDKAIKDGADVIDCS  388



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   437 bits (1125),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 275/365 (75%), Gaps = 5/365 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFP
Sbjct  26    SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  85

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             D+KLDNA++++ ++  K   Y VN VPT  WF  DFNFK+L +V+L QGVYSR+ +FDG+
Sbjct  86    DVKLDNATDISVVYPGKAKDYSVNMVPTRGWFSFDFNFKELQIVSLVQGVYSRTPKFDGS  145

Query  694   PQQILTVEDVFNKVQ--PPGLWLNVQHDSFYSQHNLSMRTFVLSVS-RRVVINYISSPEV  864
                IL+VE+V   V+    GLWLNVQHD+FY  HNLS+  ++ S+S  +V I+YISSP  
Sbjct  146   NYYILSVENVAKLVKSSSAGLWLNVQHDTFYKHHNLSVEKYLHSLSAEKVTISYISSPNA  205

Query  865   NFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIW  1044
             NFL+ +  + + + T  VFRFL   + EP++N+TYG+LL++L  I+TFASGILVPKSYIW
Sbjct  206   NFLQRVRKKSSLKKTVTVFRFLDQYKIEPTSNKTYGALLKHLKFIRTFASGILVPKSYIW  265

Query  1045  PVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSV  1224
              VD S  YL   TSLV DAHK GL+V+ SD  +DVPF++++SYDP+AE LSFIDNGN+SV
Sbjct  266   SVD-SELYLHQHTSLVSDAHKHGLKVFVSDIVNDVPFSYNFSYDPMAEVLSFIDNGNFSV  324

Query  1225  DGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGV  1404
             DGVLSDFP+TPS AI+C++ + +  K QV E L+I+  GASGDYP CTD AY KA SDG 
Sbjct  325   DGVLSDFPVTPSAAINCFAGIGRNAKKQV-ETLIITKYGASGDYPACTDLAYKKAKSDGA  383

Query  1405  DIIDC  1419
             D+IDC
Sbjct  384   DVIDC  388



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   437 bits (1124),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 275/365 (75%), Gaps = 5/365 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TL G  P+VIARGGFSG+FPDSS  +Y+ A   S  N+ +WCD+QLTKDGVGICFP
Sbjct  49    SGWKTLQGSPPVVIARGGFSGIFPDSSLASYNLALKASSPNITLWCDLQLTKDGVGICFP  108

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             D+KLDNA++++ ++  K   Y VN VPT  WF  DFNFK+L +V+L QGVYSR+ +FDG+
Sbjct  109   DVKLDNATDISVVYPGKAKDYSVNMVPTRGWFSFDFNFKELQIVSLVQGVYSRTPKFDGS  168

Query  694   PQQILTVEDVFNKVQ--PPGLWLNVQHDSFYSQHNLSMRTFVLSVS-RRVVINYISSPEV  864
                IL+VE+V   V+    GLWLNVQHD+FY  HNLS+  ++ S+S  +V I+YISSP  
Sbjct  169   NYYILSVENVAKLVKSSSAGLWLNVQHDTFYKHHNLSVEKYLHSLSAEKVTISYISSPNA  228

Query  865   NFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIW  1044
             NFL+ +  + + + T  VFRFL   + EP++N+TYG+LL++L  I+TFASGILVPKSYIW
Sbjct  229   NFLQRVRKKSSLKKTVTVFRFLDQYKIEPTSNKTYGALLKHLKFIRTFASGILVPKSYIW  288

Query  1045  PVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSV  1224
              VD S  YL   TSLV DAHK GL+V+ SD  +DVPF++++SYDP+AE LSFIDNGN+SV
Sbjct  289   SVD-SELYLHQHTSLVSDAHKHGLKVFVSDIVNDVPFSYNFSYDPMAEVLSFIDNGNFSV  347

Query  1225  DGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGV  1404
             DGVLSDFP+TPS AI+C++ + +  K QV E L+I+  GASGDYP CTD AY KA SDG 
Sbjct  348   DGVLSDFPVTPSAAINCFAGIGRNAKKQV-ETLIITKYGASGDYPACTDLAYKKAKSDGA  406

Query  1405  DIIDC  1419
             D+IDC
Sbjct  407   DVIDC  411



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   437 bits (1124),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 275/362 (76%), Gaps = 7/362 (2%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TLSGDAP VIA+GGFSGLFPDSS  AY FA   S  +   WCDV+LTKDGVGIC P
Sbjct  31    SAWKTLSGDAPAVIAKGGFSGLFPDSSDPAYLFAA--SNQDSAQWCDVRLTKDGVGICLP  88

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             DIK+DN + ++ LF   + TY VNGV TT WF +D+N   LT V L + + SR++RFDG+
Sbjct  89    DIKMDNCTTISDLFPKGKKTYRVNGVSTTGWFSVDYNSIDLTNVTLLRAILSRTNRFDGS  148

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                ++ VE   ++ + P  WLNVQHDSFYSQ NLSMR+++LS+S++  ++YISSPEV+FL
Sbjct  149   -FTLVQVEVALSQYKAPA-WLNVQHDSFYSQFNLSMRSYILSMSKQYTVDYISSPEVSFL  206

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             KS+  R+  R TKLVFRFL     EPSTNQTYGS+L+NL+SIKTFASGILVPK YIWPV 
Sbjct  207   KSLVGRVG-RKTKLVFRFLDEGLVEPSTNQTYGSMLKNLSSIKTFASGILVPKHYIWPV-  264

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              + +YLQP+TS+V DAHK GLE+YA+DFA+D   +++YSYDP+AEYL FIDNG + VDG+
Sbjct  265   TADNYLQPSTSVVDDAHKAGLEIYAADFANDFALSYNYSYDPLAEYLRFIDNGAFCVDGL  324

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             L+DFPITP  AI C+S++   + +     LVIS +GASGDYP CTD AY KAV DG D+I
Sbjct  325   LTDFPITPLEAIGCFSNLNNTKADHGAP-LVISHNGASGDYPDCTDLAYQKAVVDGADVI  383

Query  1414  DC  1419
             DC
Sbjct  384   DC  385


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 119/277 (43%), Gaps = 42/277 (15%)
 Frame = +1

Query  361   APLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASN  540
             APLVI+  G SG +PD +  AY  A +      ++ CDVQ+TKDG+ IC   I L + + 
Sbjct  351   APLVISHNGASGDYPDCTDLAYQKAVVDGAD--VIDCDVQVTKDGIPICMSSIDLMDVTT  408

Query  541   VATLFKDKQSTYL-----VNGVPT--TAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ  699
             VA+     Q+  +     V GV T    W  I  N K +      Q   SR+ R +    
Sbjct  409   VASSQFASQAGVISDIKAVAGVYTFNLTWEDIANNLKPMISNPFGQISLSRNPR-NRNAG  467

Query  700   QILTVED--VFNKVQP-PGLWLNVQHDSFYSQ-----------HNLSMRTFVLSVSRRVV  837
             + + + D   F K +   G+ + V+H SF ++             +    +    +++V+
Sbjct  468   KFMRLSDFLAFAKGEDLSGIMITVEHASFMAEKLGFGVVDAVIKAVDDSGYSKQTAKKVM  527

Query  838   INYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASG  1017
             I   +S  +   K +A         LV++    DE       +      +LA IK FA  
Sbjct  528   IQSTNSSTLVKFKQLAKY------NLVYKI---DEVVKDAAPS------SLADIKKFADA  572

Query  1018  ILVPKSYIWPVDKSSSYL-QPTTSLVLDAHKVGLEVY  1125
             + V    ++P  +SS++L   T  LV      GL VY
Sbjct  573   VSVSTKSVYP--ESSNFLINQTNPLVKSLQSAGLPVY  607



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   440 bits (1131),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/372 (60%), Positives = 280/372 (75%), Gaps = 12/372 (3%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
              A +GST     W+TLSGDAP VIA+GGFSGLFPDSS  AYSFA   S  +   WCDV+L
Sbjct  25    AAQKGST-----WKTLSGDAPAVIAKGGFSGLFPDSSDPAYSFAA--SNQDSAQWCDVRL  77

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGV  663
             TKDGVGIC PDIK+DN + ++ LF   + TYLVNGV TT WF +D+N   LT V L + +
Sbjct  78    TKDGVGICLPDIKMDNCTTISDLFPKGKKTYLVNGVSTTGWFSVDYNSIDLTNVTLLRAI  137

Query  664   YSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVIN  843
              SR++RFDG+   ++ VE   ++ + P  WLNVQHDSFYSQ NLSMR+++LS+S++  ++
Sbjct  138   LSRTNRFDGS-FTLVQVEVALSQYKAPA-WLNVQHDSFYSQFNLSMRSYILSMSKQYTVD  195

Query  844   YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGIL  1023
             YISSPEV+FLKS+  R+  R TKLV RFL     EPSTNQTYGS+L+NL+SIKTFASGIL
Sbjct  196   YISSPEVSFLKSLVGRVG-RKTKLVLRFLDEGLVEPSTNQTYGSILKNLSSIKTFASGIL  254

Query  1024  VPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFI  1203
             VPK YIWPV  + +YLQP+TS+V DAHK GLE+YA+DFA+D   +++YSYDP+AEYL FI
Sbjct  255   VPKHYIWPV-TADNYLQPSTSVVDDAHKAGLEIYAADFANDFALSYNYSYDPLAEYLGFI  313

Query  1204  DNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYS  1383
             DNG + VDG+L+DFPITP  AI C+S++   + +     LVIS +GASGDYP CTD AY 
Sbjct  314   DNGAFCVDGLLTDFPITPLEAIGCFSNLNNTKADHGAP-LVISHNGASGDYPDCTDLAYQ  372

Query  1384  KAVSDGVDIIDC  1419
             KAV DG D+IDC
Sbjct  373   KAVQDGADVIDC  384



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   436 bits (1121),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/362 (59%), Positives = 271/362 (75%), Gaps = 3/362 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S WQTL+G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I WCDV+LTKDGVGIC P
Sbjct  42    SAWQTLTGNAPVVIAKGGFSGIFPDSSDLAYKLTYLVGSSDTISWCDVRLTKDGVGICLP  101

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             ++ ++N +N+  ++   +  YLVNGVPT+ WF +D++   L+ V L Q V SR+ +FD +
Sbjct  102   ELTINNGTNIQMVYPQGKKNYLVNGVPTSGWFSVDYSINDLSQVLLTQEVLSRTDKFDAS  161

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                ILTVEDV  + +PP LWLN+QHD FY+QHNLSMR++VLS+++RV++NY+SS EV FL
Sbjct  162   -SFILTVEDVQKQAKPPALWLNIQHDMFYTQHNLSMRSYVLSLAKRVILNYVSSAEVVFL  220

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
              S+A       TK +FRF+     EPSTNQTYGSLL+NL  IKTFASGILVPK YI+PV 
Sbjct  221   SSVARTFKGTKTKFIFRFIDEAAIEPSTNQTYGSLLKNLTFIKTFASGILVPKQYIYPV-  279

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              S  YLQP TS VLDAHK GLEV+AS FA+D   +++YSYDP+AEYLSF+DNG +SVDGV
Sbjct  280   TSDFYLQPHTSFVLDAHKEGLEVFASGFANDAIISYNYSYDPLAEYLSFVDNGIFSVDGV  339

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             L+DFP T S AI C+SH++    ++  + LVIS +GASG YP CTD AY +AV DGVD I
Sbjct  340   LTDFPKTASEAIGCFSHIQ-ANNSEHGKPLVISHNGASGTYPDCTDLAYQQAVKDGVDFI  398

Query  1414  DC  1419
             DC
Sbjct  399   DC  400



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   434 bits (1117),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 278/373 (75%), Gaps = 10/373 (3%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             VA  GST     W+TLSG AP V+A+GGFSGLFPDSS  AY F G++S  +  +WCDV+L
Sbjct  31    VAQNGST-----WKTLSGKAPAVVAKGGFSGLFPDSSDYAYQFVGISSSPDTTVWCDVRL  85

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQG  660
             TKDG GIC P I +DN + +A++F   + TY VNGV T  WF +D+    L   V+L+Q 
Sbjct  86    TKDGAGICLPSINMDNCTIIASVFPQGKKTYKVNGVSTAGWFSVDYTSTVLLQNVSLKQS  145

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             V SR+  +DG   QI  VE++F   + P +WLNVQHDSFYSQ  LSMR+++LS+S++ ++
Sbjct  146   VLSRTPAYDGL-FQINPVENIFTLYKAPAVWLNVQHDSFYSQFKLSMRSYILSLSKQFIV  204

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPEVNFL SI+ R++ + TKLVFRFL     EPSTNQTYGS+L+NL  +KTFASGI
Sbjct  205   DYISSPEVNFLTSISGRVSKK-TKLVFRFLDERSIEPSTNQTYGSMLKNLTFVKTFASGI  263

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPKSYIWPV    +YL P TS+V DAHK GLE+YA+DFA+D+  +++YS+DP+AEYL F
Sbjct  264   LVPKSYIWPV-TPDNYLLPYTSVVDDAHKAGLEIYAADFANDLTISYNYSFDPLAEYLFF  322

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             IDNG +SVDGVL+DFPITPS A+ C+S++   + +     LVIS +GASGDYP CTD AY
Sbjct  323   IDNGAFSVDGVLTDFPITPSEAVGCFSNLNTSKIDHAKP-LVISHNGASGDYPDCTDQAY  381

Query  1381  SKAVSDGVDIIDC  1419
              KAV+DG D+IDC
Sbjct  382   EKAVADGADVIDC  394



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   434 bits (1117),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 212/362 (59%), Positives = 269/362 (74%), Gaps = 4/362 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TLSG AP+++A+GGFSGLFP+SS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  35    STWKTLSGKAPVIVAKGGFSGLFPESSLYAYQILGSLSSPDTVMWCDVRLTKDGGGICLP  94

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
              I +DN + +A  F   + TY VNGV T  WF +D+    L  V+L+Q V SR+  +DG 
Sbjct  95    SIDMDNCTTIANFFPQGKKTYNVNGVSTVGWFSVDYTSTDLLNVSLKQSVLSRTGVYDGI  154

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                I+ VE+V+ +  P  +WLNVQ DSFYSQ  LSMR+++LS+ +  V++YISSPEVNFL
Sbjct  155   -FPIIPVENVYTQFNPVAVWLNVQQDSFYSQFKLSMRSYILSLLKNFVVDYISSPEVNFL  213

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
              SI+ R++ + TKLVFRFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV 
Sbjct  214   TSISGRVSKK-TKLVFRFLDERSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV-  271

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
                +YL P TS+V DAHK GLE+YA+DFA+D   +++YSYDP+AEYLSFIDNG +SVDGV
Sbjct  272   TPDNYLLPYTSVVDDAHKAGLEIYAADFANDFTISYNYSYDPLAEYLSFIDNGAFSVDGV  331

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             LSDFPITPS A+DC+S++   + +     LVIS +GASGDYP CTD AY KAV+DG D+I
Sbjct  332   LSDFPITPSEAVDCFSNLNNSKIDHAKP-LVISHNGASGDYPDCTDQAYEKAVADGADVI  390

Query  1414  DC  1419
             DC
Sbjct  391   DC  392



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   445 bits (1144),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 280/389 (72%), Gaps = 14/389 (4%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L A Q  +  S S+WQTLSG+APLVI RGGFSGL PDSS +AY+ A  TS+ +V++WC
Sbjct  49    IQLFAPQIDAQRSRSRWQTLSGEAPLVIDRGGFSGLLPDSSLDAYNLAIQTSVADVVLWC  108

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             DVQLTKDGVGICFPD+ L NASN+  ++ + Q +Y VNGV T  WF ID   + L  V L
Sbjct  109   DVQLTKDGVGICFPDLNLFNASNIEDVYPNGQKSYPVNGVTTQGWFTIDSTLRDLQNVTL  168

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMRTFVLSVSR  828
              +G++SRS +FDG    I T++ V  +++P  G WLNVQHD+FY QHNLSM +F+L  SR
Sbjct  169   SRGIFSRSDKFDGNLYPISTIQSVTEQMKPEGGFWLNVQHDAFYKQHNLSMSSFILXASR  228

Query  829   RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTF  1008
              V +++ISSPEVNF K IA R        VF+FLG ++ EP+TNQTYG +L NL  +KT+
Sbjct  229   TVSMDFISSPEVNFFKKIAGRFKRNGPSFVFQFLGKEDFEPTTNQTYGFILSNLTFVKTY  288

Query  1009  ASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAE  1188
             ASGILVPKSYI+ +D    YL P TSLV DAHK GLEVY S FA+DV  A++YSYDPV+E
Sbjct  289   ASGILVPKSYIFQLD-DKQYLIPHTSLVQDAHKAGLEVYVSGFANDVDIAYNYSYDPVSE  347

Query  1189  YLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-----------RKGQKNQVPEFLVISF  1335
             YLSF+DNG++SVDGVLSDFP+T S +IDC+S++           R    +   EFLVIS 
Sbjct  348   YLSFVDNGDFSVDGVLSDFPLTASASIDCFSYIGRNPTKPLINQRTNPVHASVEFLVISK  407

Query  1336  DGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             DGASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  408   DGASGDYPRCTNLAYVKAIKDGADVIDCS  436



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   432 bits (1112),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/357 (59%), Positives = 268/357 (75%), Gaps = 3/357 (1%)
 Frame = +1

Query  349   LSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLD  528
             + G+AP+VIA+GGFSG+FPDSS  AY    L   ++ I+WCDV+LTKDGVG+C P++ ++
Sbjct  10    IEGNAPVVIAKGGFSGIFPDSSDLAYKLTYLAGSSDTILWCDVRLTKDGVGVCLPELTIN  69

Query  529   NASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQIL  708
             N +N+  ++   +  Y VNGVPT+ WF +D++   L+ V L QGV SR++RFD +   IL
Sbjct  70    NGTNIDVVYPQGKKNYPVNGVPTSGWFSVDYSINDLSPVLLMQGVLSRTNRFDAS-SVIL  128

Query  709   TVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIAS  888
             TVEDV  +V+PP LWLN+QHD FY+QHNLSMR+++LS+S+RV++NY+SS EV FL SI  
Sbjct  129   TVEDVQKQVKPPALWLNIQHDMFYTQHNLSMRSYLLSLSKRVILNYVSSAEVVFLSSITR  188

Query  889   RINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSY  1068
                   TK +FRFL     EPSTNQTYGSL +NL  IKTFASGILVPK YIWPV  S  Y
Sbjct  189   TFKATKTKFIFRFLDKAAIEPSTNQTYGSLSKNLTFIKTFASGILVPKQYIWPV-TSDLY  247

Query  1069  LQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFP  1248
             LQP TS VLDAHK GLEV+AS FA+D   +++YSYDP+AEYLSFIDNG +SVDGVL+DFP
Sbjct  248   LQPHTSFVLDAHKEGLEVFASGFANDALISYNYSYDPLAEYLSFIDNGIFSVDGVLTDFP  307

Query  1249  ITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
              T S AI C+SH+ K   ++  + LVIS +GASG YP CTD AY +AV DGVD+IDC
Sbjct  308   KTASEAIGCFSHI-KANYSEHGKPLVISHNGASGIYPDCTDLAYQQAVKDGVDVIDC  363



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   432 bits (1111),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 277/385 (72%), Gaps = 5/385 (1%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7     LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NV +WCDVQLTKDGVGICFP++KLDNA++++  +  K   YLVNGV T  WF +D+NF +
Sbjct  67    NVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPGKAKDYLVNGVSTRGWFSVDYNFGE  126

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP--GLWLNVQHDSFYSQHNLSMRT  807
             L  V++ QGVYSR+++FDG    ILTVE V   ++ P  GLWLN QH SF+ Q NLS+  
Sbjct  127   LANVSVVQGVYSRTNKFDGNKLPILTVEQVVKLIKSPSTGLWLNFQHASFFKQQNLSVEN  186

Query  808   FVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             F+ S+  R V +NYISSP+V+FL+ + S  +   T  +FR L   + EP+TNQTYG LL+
Sbjct  187   FLQSLPGRSVPVNYISSPDVDFLRRVKSSFSSGPTSFIFRILEQSKIEPTTNQTYGELLK  246

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NLA IKTF+SGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD  +DVPF+++
Sbjct  247   NLALIKTFSSGILVPKGYIWPVD-SDHYLQPHTPLVTDAHREGLQVFVSDLTNDVPFSYN  305

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             +SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI+C+S + +  K QV + LVI+  GA
Sbjct  306   FSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAINCFSGLGENAKRQV-DTLVITKYGA  364

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGD P CTD AY++A SDG D++DC
Sbjct  365   SGDNPACTDLAYNQAKSDGADVLDC  389



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   432 bits (1110),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 277/385 (72%), Gaps = 5/385 (1%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L +L    +LVA   S      W+TL G  PLVIARGGFSG+FPDSS  AYS    T   
Sbjct  7     LAILILQYSLVALVSSAGPRGGWKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTLDTCGP  66

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  K   YLVN V T  WF +D+N  +
Sbjct  67    NVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPGKAKDYLVNEVSTRGWFSVDYNLAE  126

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP--GLWLNVQHDSFYSQHNLSMRT  807
             L  V++ QGVYSR+++FDG    I +VEDV   ++ P  GLWLN+QHDSF+ Q NLS+  
Sbjct  127   LANVSVVQGVYSRTNKFDGNKLPIRSVEDVAKLIKSPSTGLWLNIQHDSFFKQQNLSVEN  186

Query  808   FVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             F+ S+ ++ V +NYISSP+V+FL+ + S  +   T  +FRFL   + EP+TNQTYG LL+
Sbjct  187   FLQSLPAKSVPVNYISSPDVDFLRRVKSSFSSGPTGFIFRFLEQSKLEPTTNQTYGELLK  246

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  IKTFASGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD  +DVPF+++
Sbjct  247   NLMLIKTFASGILVPKGYIWPVD-SGLYLQPHTPLVTDAHREGLQVFVSDLTNDVPFSYN  305

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             +SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI+C+S + K  K QV + LVI+  GA
Sbjct  306   FSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAINCFSGLGKNAKKQV-DTLVITKYGA  364

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGD P CTD AY++A SDG D++DC
Sbjct  365   SGDNPACTDLAYNQAKSDGADVLDC  389


 Score = 58.9 bits (141),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 81/316 (26%), Positives = 147/316 (47%), Gaps = 47/316 (15%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI + G SG  P  +  AY+ A   S    ++ C VQ++KDG+  C   I L  ++ VA
Sbjct  357   LVITKYGASGDNPACTDLAYNQA--KSDGADVLDCPVQMSKDGIPFCLSSIDLSESTTVA  414

Query  547   -TLFKDKQSTYLVNGVPTTAWFPIDFNF-------KQLT---LVNLQQGVYSRSSRFDGT  693
              T  K++ +T     +P   +    + F       K LT   L   ++ + SR+ +    
Sbjct  415   DTQLKNRATT-----IPEIKYRSGIYTFSLTWDEIKTLTPSILNPYEKYILSRNPKSKNL  469

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ-HNLSMRTFVLSV-------SRRVVINYI  849
               +++T+ D  +  +   + +++++ ++ ++  NL +   VL         S +V+I   
Sbjct  470   -GKLITLSDFLSLTEGSRILISIENAAYLAEKQNLRVTDAVLDALQKAKPRSHKVMIQST  528

Query  850   SSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVP  1029
              S  +   K   S+   RV K+       DE         G+    +  IKTFA  +++ 
Sbjct  529   HSSVLKIFKD-KSKFE-RVYKV-------DE------NIGGAADSAIEDIKTFADAVVIG  573

Query  1030  KSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFID  1206
             K+ ++P  +SS++L   T++V       L V+   F+++ V  A+DY  DP  E  SF+ 
Sbjct  574   KASVFP--ESSAFLVNFTNIVARLKSFKLPVFVETFSNEFVSQAWDYYSDPSIEINSFVI  631

Query  1207  NGNYSVDGVLSDFPIT  1254
                  V+G+++DFP T
Sbjct  632   GTK--VNGIITDFPKT  645



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   432 bits (1110),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/385 (56%), Positives = 277/385 (72%), Gaps = 5/385 (1%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L +L    +LVA   S    S W+TL G  P+VIARGGFSG+FPDSS  AY  A  T   
Sbjct  7     LAILILQYSLVALVSSAGPPSGWKTLQGSPPMVIARGGFSGIFPDSSSLAYGLALDTCGP  66

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NV +WCDVQLTKDGVGICFP++KLDNA++++  +  K   YLVNGV T  WF +D+NF +
Sbjct  67    NVTLWCDVQLTKDGVGICFPELKLDNATDISIAYPGKAKDYLVNGVSTRGWFSVDYNFGE  126

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP--GLWLNVQHDSFYSQHNLSMRT  807
             L  V++ QGVYSR+++FDG    ILTVE V   ++ P  GLWLN QH SF+ Q NLS+  
Sbjct  127   LANVSVVQGVYSRTNKFDGNKLPILTVEQVAKLIKSPSTGLWLNFQHASFFKQQNLSVEN  186

Query  808   FVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             F+ S+  R V +NYISSP+V+FL+ + S  +   T  +FR L   + EP+TNQTYG LL+
Sbjct  187   FLQSLPGRSVPVNYISSPDVDFLRRVKSSFSSGPTSFIFRILEQSKIEPTTNQTYGELLK  246

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NLA IKTF+SGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD  +DVPF+++
Sbjct  247   NLALIKTFSSGILVPKGYIWPVD-SDHYLQPHTPLVTDAHREGLQVFVSDLTNDVPFSYN  305

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             +SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI+C+S + +  K QV + LVI+  GA
Sbjct  306   FSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAINCFSGLGENAKRQV-DTLVITKYGA  364

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGD P CTD AY++A SDG D++DC
Sbjct  365   SGDNPACTDLAYNQAKSDGADVLDC  389



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   432 bits (1110),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 212/364 (58%), Positives = 275/364 (76%), Gaps = 16/364 (4%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22    SSSWQTLSGKPPAVIARGGFSGMFPDSSSQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  511   PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  690
             P++ LDN S+V T++ + +             F +DF +K+L+ V L +GV SR + FD 
Sbjct  82    PNLNLDNGSDVMTIYPNYKER-----------FSVDFTWKELSDVKLARGVLSRPNIFDD  130

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                 ILT+E+V  K+   GLWLN+Q  +FY+QHNLSMR  VLS+SRR+ +N+ISSPE++F
Sbjct  131   L-SSILTIEEV-AKLTASGLWLNIQDSAFYAQHNLSMRNSVLSLSRRLKVNFISSPEISF  188

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             LKS+ + + P VTKL+F+FL  D  EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWP+
Sbjct  189   LKSMKNSVKPTVTKLIFKFLKQDHIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYIWPI  248

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             D S+ YLQP TSLV DAHK GL+V+AS+FA+D   A++YSYDP AEYLSFIDNGN+SVDG
Sbjct  249   D-SALYLQPHTSLVTDAHKEGLQVFASEFANDFVIAYNYSYDPTAEYLSFIDNGNFSVDG  307

Query  1231  VLSDFPITPSGAIDCYSHM-RKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
              LSDFP+TP  AI+C+SH+  KG K Q  +  ++S +GASGD+PGCTD AY +A SDG D
Sbjct  308   FLSDFPVTPYRAINCFSHVDTKGAKKQA-KITILSKNGASGDFPGCTDLAYERAASDGAD  366

Query  1408  IIDC  1419
             I+DC
Sbjct  367   ILDC  370



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   432 bits (1110),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 215/371 (58%), Positives = 274/371 (74%), Gaps = 9/371 (2%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             A +GST     W+TLSG AP++IA+GGFSGLFPDSS  AY F  + S  +  + CDV+LT
Sbjct  27    AQKGST-----WKTLSGKAPVIIAKGGFSGLFPDSSDLAYQFVPIASSPDTALLCDVRLT  81

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDG GIC P+IK+DN + ++ +F   +STY VNGV TT WF +DF    L  V L+Q ++
Sbjct  82    KDGAGICLPNIKMDNCTFISDVFPQGKSTYNVNGVSTTGWFSVDFTSTDLQNVTLRQSIF  141

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SR S FDG+  QI+ VE V +  + P +WLNVQHDSFYSQ  LSMR+++LS+S++ + +Y
Sbjct  142   SRPSYFDGS-MQIVPVEAVLSVFKAPAVWLNVQHDSFYSQFKLSMRSYILSLSKQYIADY  200

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPEVNFL SI+ R++ R TKLVFRFL     EPSTNQTYGS+L+NL  +KTFASGILV
Sbjct  201   ISSPEVNFLTSISGRVSKR-TKLVFRFLDERSIEPSTNQTYGSMLKNLTFVKTFASGILV  259

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK+YIWPV    +YL   TS+  DAHK GLE+YA+DFA+D   +++YSYDP+AEYL FID
Sbjct  260   PKNYIWPV-TPDNYLLSYTSVAADAHKAGLEIYAADFANDFTISYNYSYDPLAEYLYFID  318

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             N  +SVDGVL+DFPITPS A+ C+S++   + +     LVIS +GASGDYP CTD AY K
Sbjct  319   NDAFSVDGVLTDFPITPSEAVGCFSNLNNSKTDHAKP-LVISHNGASGDYPDCTDQAYQK  377

Query  1387  AVSDGVDIIDC  1419
             AV DG D+IDC
Sbjct  378   AVDDGADVIDC  388



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Arabidopsis lyrata subsp. lyrata]
Length=719

 Score =   431 bits (1108),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/363 (57%), Positives = 271/363 (75%), Gaps = 14/363 (4%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             +S W+TLSG  P VIARGGFSG+FPDSS  AY    +T+   V++WCD+QLTKDGVGICF
Sbjct  22    SSSWKTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPEVMLWCDLQLTKDGVGICF  81

Query  511   PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  690
             P++ L N SNV +++ + +             F +DF +K+L+ V L QGV SR   FD 
Sbjct  82    PNLNLHNGSNVISIYPNYKER-----------FSVDFTWKELSDVKLAQGVISRPEIFDD  130

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                 IL +E+V  K+   GLWLN+Q  +FY+QHNLSMR  V+S+SRR+++N+ISSPE++F
Sbjct  131   V-SSILPIEEV-AKLTASGLWLNIQDSAFYTQHNLSMRNSVISLSRRLIVNFISSPEISF  188

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             LKS+ + + P VTKL+F+FL  D+ EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWPV
Sbjct  189   LKSMKNSVKPTVTKLIFKFLKQDDIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYIWPV  248

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             D S+ YLQP TSLV DAHK GL+V+AS+FA+D   A++YSYDP AEYLSFIDNGN+SVDG
Sbjct  249   D-SALYLQPHTSLVTDAHKEGLQVFASEFANDFVIAYNYSYDPTAEYLSFIDNGNFSVDG  307

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
              LSDFP+TP  AI+C+SH+   +  +  +  +IS +GASGD+PGCTD AY +A +DG DI
Sbjct  308   FLSDFPVTPYRAINCFSHLDTKKAKEQAKITIISKNGASGDFPGCTDLAYQRAATDGADI  367

Query  1411  IDC  1419
             +DC
Sbjct  368   LDC  370


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 142/314 (45%), Gaps = 31/314 (10%)
 Frame = +1

Query  370   VIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV-A  546
             +I++ G SG FP  +  AY  A        I+ C+VQ++KD +  C   I L N++NV  
Sbjct  339   IISKNGASGDFPGCTDLAYQRAATDGAD--ILDCNVQMSKDKIPFCMSSIDLINSTNVIE  396

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-----TLVNLQQ--GVYSRSSRFDGTPQQI  705
             T F++  S         +  +       Q+     T+ NL++  G++ R+ R     + +
Sbjct  397   TSFRNLSSVASEIQPQRSGIYTFSLTMSQIQTLKPTISNLERDSGLF-RNPRNKKAGKFL  455

Query  706   LTVEDVF---NKVQPPGLWLNVQHDSFYSQHN-LSMRTFVLSVSRRVVINYISSPEVNFL  873
                E +F   +     G+ + V++ ++  +H  +S+   VL   +R      ++ + N  
Sbjct  456   TLSEFLFLPNHYSSLLGILIEVENAAYLVEHQGISVVDAVLDELKR------ATNQQNKT  509

Query  874   KSIASRINPRVTKLVFRF-----LGNDETEPSTNQTYGSLLQN-LASIKTFASGILVPKS  1035
              +    I      ++ +F     + +DE      +  G +  + +  IK FA  I++ K 
Sbjct  510   SARTILIQSTDKSVLMKFKEKNKMNHDELVYRVEENIGDVADSAIKDIKNFAGSIVISKK  569

Query  1036  YIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNG  1212
              ++P     +  Q  T++V      GL VY   F+++ V  AFD+  DP  E  SF+   
Sbjct  570   SVFPYVGFITLTQ-GTNVVSKLKSSGLRVYVERFSNEFVTQAFDFYEDPTLEIDSFVR--  626

Query  1213  NYSVDGVLSDFPIT  1254
             +  +DG+++DFP T
Sbjct  627   DIQIDGIITDFPAT  640



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   441 bits (1133),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 279/385 (72%), Gaps = 5/385 (1%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL  450
             LL     + L AAQ  +  STS WQTLSG+APLVIARGGFSGLFPDSS  A+ FA   S+
Sbjct  1     LLYGVVLLQLFAAQINAQRSTSTWQTLSGEAPLVIARGGFSGLFPDSSLAAFQFAMQASV  60

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
               VI+WCDVQLTKD VGICFPD+ L NASN+  ++  ++ +Y VNGV T  WFPIDF+  
Sbjct  61    DEVILWCDVQLTKDEVGICFPDLNLANASNIQDVYSTRRKSYPVNGVTTQGWFPIDFSLT  120

Query  631   QL--TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
             +L   L +L +G+ SRS +FD     I T++DV  ++ P   WLNV HD+FY Q N SM 
Sbjct  121   ELQNVLFSLIRGILSRSEKFDENGFAISTIQDVNTQLLPKDFWLNVPHDAFYEQQNYSMS  180

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             +F+LS +R V I++ISSPEV F + IA R        VF+FLG ++ EP+TN+TYGS+  
Sbjct  181   SFLLSAARTVSIDFISSPEVGFFRKIAGRYGRNGPSFVFQFLGKEDFEPTTNRTYGSIFN  240

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  +KTFASGILVPKSYI  +D    YL P TSLV DAHK GL++YAS FA+DV  A++
Sbjct  241   NLTYVKTFASGILVPKSYILQLD-DKHYLLPPTSLVQDAHKAGLKLYASGFANDVDIAYN  299

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YS+DPV+EYLSF+DNG +SVDGVLSDFP+T S ++DC+SH+ +    QV +FLVIS +GA
Sbjct  300   YSWDPVSEYLSFVDNGVFSVDGVLSDFPLTASASVDCFSHVGRNATKQV-DFLVISKNGA  358

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGDYPGCT+ AY KA+ DG ++IDC
Sbjct  359   SGDYPGCTNLAYEKAIRDGAEVIDC  383



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   441 bits (1134),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 286/392 (73%), Gaps = 20/392 (5%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L A Q  +  S S+WQTLSG+AP VIARGGFSGL PDSS +AY+ A  TS+ +V++WC
Sbjct  30    IQLFAPQIDAQRSRSRWQTLSGEAPRVIARGGFSGLLPDSSIDAYNLAIQTSVADVVLWC  89

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             DVQLTKDGVGICFPD+ L NAS V  ++ + Q++Y V+GV T  WF ID   K L  V+L
Sbjct  90    DVQLTKDGVGICFPDLNLANASTVQFVYTNGQNSYPVHGVTTQGWFAIDSTLKDLQNVSL  149

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPP-GLWLNVQHDSFYSQHNLSMRTFVLSVSR  828
              +G+ SRS +FDG    ILT+++V  +++P  G WL+VQHD+FY QHNLSM +F++SVSR
Sbjct  150   IRGILSRSDKFDGNGYTILTIQNVTEQIKPQGGFWLHVQHDAFYEQHNLSMSSFLVSVSR  209

Query  829   RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTF  1008
              V I++ISSPEVNF K I  R        VF+FLG ++ EP+TN+TYGS+L NL  +KTF
Sbjct  210   TVSIDFISSPEVNFFKKITGRFKLNGPSFVFQFLGKEDFEPTTNRTYGSILSNLTFVKTF  269

Query  1009  ASGILVPKSYIWPV-DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  1185
             AS ILVPKSYI+P+ DK   YL P TSLV DAHK GLEVY S FA+DV  A++YSYDPV+
Sbjct  270   ASKILVPKSYIFPLGDK--QYLLPPTSLVQDAHKAGLEVYVSGFANDVDLAYNYSYDPVS  327

Query  1186  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP-------------EFLV  1326
             EYLSF+DNG++SVDG+LSDFP+T S +IDC+S++  G+    P             +FLV
Sbjct  328   EYLSFVDNGDFSVDGMLSDFPLTASASIDCFSYI--GRNPTKPLINQGTDPVHASVDFLV  385

Query  1327  ISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             IS DGASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  386   ISKDGASGDYPRCTNLAYEKAIKDGADVIDCS  417



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   427 bits (1098),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/366 (58%), Positives = 266/366 (73%), Gaps = 14/366 (4%)
 Frame = +1

Query  322   TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  501
             T S S WQTLSG+ P+VIARGGFSGLFPDSS  AY    LT+  +V +WCD+QLTKDGVG
Sbjct  19    TASASSWQTLSGNPPVVIARGGFSGLFPDSSEYAYELVNLTTSEDVTLWCDLQLTKDGVG  78

Query  502   ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  681
             ICFP++ LDN S+V  ++ + +             F +DF +K+L+ V L Q + SR + 
Sbjct  79    ICFPNLNLDNGSDVVDVYPNHKEI-----------FSVDFTWKELSNVTLVQNIVSRQAI  127

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD     IL  E+V  K+   GLWLN+QH  FY+QHNLSMR  V+S+SRR+ I +ISSPE
Sbjct  128   FDHV-SSILPTEEV-AKIGTSGLWLNIQHSDFYAQHNLSMRNSVVSLSRRMKIKFISSPE  185

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             ++FL+++   +N  VTKL+FRFL  D  +P TNQ+YGSL +NL+ IKTF+SGILVPKSYI
Sbjct  186   ISFLRNMKKDVNTTVTKLIFRFLNQDRIDPFTNQSYGSLAKNLSYIKTFSSGILVPKSYI  245

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WP+  S  YLQP TS V DAHK GL+V+ASDFA+D  FA++YSYDP AEYLSFIDNGN+S
Sbjct  246   WPLG-SDLYLQPHTSFVTDAHKEGLQVFASDFANDFVFAYNYSYDPTAEYLSFIDNGNFS  304

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDG LSDFP+TP  AI C+SH+   +  +     +IS DGASGD+ GCTD AY KAVSDG
Sbjct  305   VDGFLSDFPLTPYRAISCFSHLDTKKAKEQANVTIISKDGASGDFAGCTDLAYEKAVSDG  364

Query  1402  VDIIDC  1419
             VDI+DC
Sbjct  365   VDILDC  370



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   427 bits (1098),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 271/366 (74%), Gaps = 20/366 (5%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22    SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  511   PDIKLDNASNVATL---FKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  681
             P++KLDN SNV  +   +K++              F +DF +K+L+ V L QGV SR   
Sbjct  82    PNLKLDNGSNVIRIDPHYKER--------------FSVDFTWKELSDVKLAQGVVSRPYI  127

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD     IL +E+V  K+   GLWLN+Q  +FY++HNLSMR  V+S+SRR+ +N+ISSP 
Sbjct  128   FDDV-SSILAIEEV-AKLTASGLWLNIQDSAFYAKHNLSMRNSVVSLSRRLKVNFISSPG  185

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             ++FLKS+ + + P VTKL+FRFL  +  EP TNQ+YGSL +NL+ I+TF+SGILVPKSYI
Sbjct  186   ISFLKSMKNSVKPTVTKLIFRFLKQEHIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYI  245

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WPVD S+ YLQP TSLV DAHK GL+V+AS+FA+D   A++YSYDP AEYLSFIDNGN+S
Sbjct  246   WPVD-SALYLQPHTSLVTDAHKEGLQVFASEFANDFVIAYNYSYDPTAEYLSFIDNGNFS  304

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDG LSDFP+TP  AI+C+SH+   +  +  +  +IS +GASGD+PGCTD AY +A SDG
Sbjct  305   VDGFLSDFPVTPYRAINCFSHVDPKRAKEQAKITIISKNGASGDFPGCTDLAYQRAASDG  364

Query  1402  VDIIDC  1419
              DI+DC
Sbjct  365   ADILDC  370


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 81/317 (26%), Positives = 143/317 (45%), Gaps = 37/317 (12%)
 Frame = +1

Query  370   VIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV-A  546
             +I++ G SG FP  +  AY  A   S    I+ C+VQ++KD +  C     L N++NV  
Sbjct  339   IISKNGASGDFPGCTDLAYQRAA--SDGADILDCNVQMSKDKIPFCMSSFDLINSTNVIE  396

Query  547   TLFKDKQSTY-----LVNGVPTTAWFPIDFNFKQLTLVNLQQ--GVYSRSSRFDGTPQQI  705
             T F++  S         +G+ T +         + T+ NL++  G++ R+ R +   + +
Sbjct  397   TSFRNLSSVVSEINPRRSGIYTFSLTMSKIQTLKPTISNLEKDSGLF-RNPRNNKAGKFL  455

Query  706   LTVEDVF--NKVQP-PGLWLNVQHDSFYSQHN-LSMRTFVLSVSRRVVIN---------Y  846
                E +F  N+     GL + V++ ++  +H  +S+   VL   +R              
Sbjct  456   TLSEFLFLPNRYSSLLGLLIEVENAAYLVEHQGISVVDAVLDELKRATTQQNKTSARTIL  515

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             I S + + L     +      +LV+R   N            S +++   IK FA  I++
Sbjct  516   IQSTDKSVLMKFKEKNKMNHDELVYRVDDN------IRDVADSAIKD---IKNFAGSIVI  566

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
              K  ++P  K    L+  T++       GL VY   F+++ V  AFD+  DP  E  SF+
Sbjct  567   SKKSVFPY-KGFIILEKETNIASKLKSNGLRVYVERFSNECVTHAFDFYDDPTLEIDSFV  625

Query  1204  DNGNYSVDGVLSDFPIT  1254
                +  +DG+++DFP T
Sbjct  626   --RDVQIDGIITDFPAT  640



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   427 bits (1099),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 215/371 (58%), Positives = 273/371 (74%), Gaps = 10/371 (3%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             A +GST     W+TLSGD P +IA+GGFSGLFPDSS NAY FA ++  + V  WCDV+LT
Sbjct  26    AQKGST-----WKTLSGDPPAIIAKGGFSGLFPDSSENAYLFATISQDSAV--WCDVRLT  78

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVY  666
             KDG GIC PDI++++ ++++  F   + TY VNGV  T WF +D+    L  V L+Q V 
Sbjct  79    KDGSGICLPDIQMESCTSISNAFPKGKKTYNVNGVSVTGWFSVDYKDTDLGKVFLRQSVS  138

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRS R+DG    I+ VE V  + + P +WLN+QHDSFYSQ NLSMR+++LS+S++  ++Y
Sbjct  139   SRSERYDGGGLLIVPVEAVIAQFKAPAVWLNLQHDSFYSQFNLSMRSYILSLSKQYTVDY  198

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPEV  LKS+  R++ + TKLVFRFL     EPSTNQTYGS+L+NL  IKTFASGILV
Sbjct  199   ISSPEVTILKSLLGRVSKK-TKLVFRFLDEGTAEPSTNQTYGSMLKNLTFIKTFASGILV  257

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK YI PV  + +YL+P TS+V DAH  GLE+YA+DFA+D  F+++YSYDP+AEYLSFID
Sbjct  258   PKHYILPV-TADNYLKPHTSVVDDAHTAGLEIYAADFANDFTFSYNYSYDPLAEYLSFID  316

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             NG +SVDGV++DFP TPS AIDC+ H   G        LVIS +GASGDYP CTD AY K
Sbjct  317   NGAFSVDGVVTDFPSTPSTAIDCF-HNLNGSNRDHGAPLVISHNGASGDYPDCTDLAYQK  375

Query  1387  AVSDGVDIIDC  1419
             AV+DG D+IDC
Sbjct  376   AVADGADVIDC  386



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   427 bits (1097),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 271/366 (74%), Gaps = 20/366 (5%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             +S WQTLSG  P VIARGGFSG+FPDSS  AY    +T+  +V++WCD+QLTKDGVGICF
Sbjct  22    SSSWQTLSGKPPAVIARGGFSGMFPDSSIQAYQLVNITTSPDVMLWCDLQLTKDGVGICF  81

Query  511   PDIKLDNASNVATL---FKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  681
             P++KLDN SNV  +   +K++              F +DF +K+L+ V L QGV SR   
Sbjct  82    PNLKLDNGSNVIRIDPHYKER--------------FSVDFTWKELSDVKLAQGVVSRPYI  127

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD     IL +E+V  K+   GLWLN+Q  +FY++HNLSMR  V+S+SRR+ +N+ISSP 
Sbjct  128   FDDV-SSILAIEEV-AKLTASGLWLNIQDSAFYAKHNLSMRNSVVSLSRRLKVNFISSPG  185

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             ++FLKS+ + + P VTKL+FRFL  +  EP TNQ+YGSL +NL+ I+TF+SGILVPKSYI
Sbjct  186   ISFLKSMKNSVKPTVTKLIFRFLKQEHIEPFTNQSYGSLAKNLSYIRTFSSGILVPKSYI  245

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WPVD S+ YLQP TSLV DAHK GL+V+AS+FA+D   A++YSYDP AEYLSFIDNGN+S
Sbjct  246   WPVD-SALYLQPHTSLVTDAHKEGLQVFASEFANDFVIAYNYSYDPTAEYLSFIDNGNFS  304

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDG LSDFP+TP  AI+C+SH+   +  +  +  +IS +GASGD+PGCTD AY +A SDG
Sbjct  305   VDGFLSDFPVTPYRAINCFSHVDPKRAKEQAKITIISKNGASGDFPGCTDLAYQRAASDG  364

Query  1402  VDIIDC  1419
              DI+DC
Sbjct  365   ADILDC  370


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 141/317 (44%), Gaps = 37/317 (12%)
 Frame = +1

Query  370   VIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV-A  546
             +I++ G SG FP  +  AY  A   S    I+ C+VQ++KD +  C     L N++NV  
Sbjct  339   IISKNGASGDFPGCTDLAYQRAA--SDGADILDCNVQMSKDKIPFCMSSFDLINSTNVIE  396

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-----TLVNLQQ--GVYSRSSRFDGTPQQI  705
             T F++  S         +  +       Q+     T+ NL++  G++ R+ R +   + +
Sbjct  397   TSFRNLSSVVSEINPRRSGIYTFSLTMSQIQTLKPTISNLEKDSGLF-RNPRNNKAGKFL  455

Query  706   LTVEDVF--NKVQP-PGLWLNVQHDSFYSQHN-LSMRTFVLSVSRRVVIN---------Y  846
                E +F  N+     GL + V++ ++  +H  +S+   VL   +R              
Sbjct  456   TLSEFLFLPNRYSSLLGLLIEVENAAYLVEHQGISVVDAVLDELKRATTQQNKTSARTIL  515

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             I S + + L     +      +LV+R   N            S +++   IK FA  I++
Sbjct  516   IQSTDKSVLMKFKEKNKMNHDELVYRVDDN------IRDVADSAIKD---IKNFAGSIVI  566

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
              K  ++P  K    L+  T++       GL VY   F+++ V  AFD+  DP  E  SF+
Sbjct  567   SKKSVFPY-KGFIILEKETNIASKLKSNGLRVYVERFSNECVTHAFDFYDDPTLEIDSFV  625

Query  1204  DNGNYSVDGVLSDFPIT  1254
                +  +DG+++DFP T
Sbjct  626   --RDVQIDGIITDFPAT  640



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   423 bits (1088),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/355 (60%), Positives = 262/355 (74%), Gaps = 4/355 (1%)
 Frame = +1

Query  355   GDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNA  534
             G+AP+V+ARGGFSGLFPDSS  AY      SL +V++WCDVQLTKDG GIC PDI L   
Sbjct  1     GNAPVVVARGGFSGLFPDSSNLAYQDVVQVSLPSVVVWCDVQLTKDGAGICLPDISLQQE  60

Query  535   SNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTV  714
             +++ +++    ++YL+NGV    W  +DF   QL  V L Q   SR+  FD     ILTV
Sbjct  61    TDINSVYGTNNASYLINGVTKQGWLSLDFTLAQLNNVTLVQQNLSRAPYFDDA-LPILTV  119

Query  715   EDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRI  894
             ++V N    PGLWLNVQHD+F+S+H LSMR+F++SVSR V+INYISSPE+ FL S+ASR+
Sbjct  120   QEVVNIANAPGLWLNVQHDAFFSEHKLSMRSFIISVSRDVIINYISSPEIGFLHSVASRL  179

Query  895   NPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQ  1074
                 TKLVFRFLG D+ EP+TN+TY SLL NL  I TFASGILVPK+YIWPV+ SS YL 
Sbjct  180   T-NSTKLVFRFLGPDDVEPTTNETYSSLLSNLTLIGTFASGILVPKTYIWPVN-SSRYLL  237

Query  1075  PTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPIT  1254
               TSLV DAHK GLEVYASDFA+D    F++ YDPV+EYLS+ DNG +SVDGV+SDFPIT
Sbjct  238   NYTSLVSDAHKAGLEVYASDFANDGDLPFNFYYDPVSEYLSYFDNGVFSVDGVISDFPIT  297

Query  1255  PSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             PS AI C+SH+ +    +V   LVIS +GASG YPGCTD AY +A +DG D++DC
Sbjct  298   PSAAIGCFSHLGRNAAIEV-NILVISNEGASGIYPGCTDKAYEQAAADGADVLDC  351



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   423 bits (1087),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 267/377 (71%), Gaps = 42/377 (11%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L+AAQ  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13    IQLLAAQTDAQGSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF IDF+ K L  VNL
Sbjct  73    DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWFTIDFSLKDLNKVNL  132

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRR  831
              +G+ SRS RFDG    ILTV+DV  +++P GLWLNVQH++FY+QHNLSM TF+ + S+ 
Sbjct  133   IRGILSRSERFDGNGYSILTVQDVNTELKPQGLWLNVQHEAFYAQHNLSMTTFLTTASKT  192

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFA  1011
             ++I++ISSPEVNF K IA R                         +G             
Sbjct  193   IIIDFISSPEVNFFKKIAGR-------------------------FGR------------  215

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEY  1191
               ILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DYSYDPV+EY
Sbjct  216   --ILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDYSYDPVSEY  272

Query  1192  LSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTD  1371
             LSF+DNGN+SVDGVLSDFPI+ S +++C+SHM +    QV +FLVIS +GASGDYPGCTD
Sbjct  273   LSFVDNGNFSVDGVLSDFPISASASVECFSHMGRNATKQV-DFLVISKNGASGDYPGCTD  331

Query  1372  XAYSKAVSDGVDIIDCT  1422
              AY+KA+ DG D+IDC+
Sbjct  332   LAYAKAIKDGADVIDCS  348



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   422 bits (1086),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/366 (57%), Positives = 262/366 (72%), Gaps = 14/366 (4%)
 Frame = +1

Query  322   TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  501
             T S+S WQTL G  P+V+ARGGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG G
Sbjct  19    TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  502   ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  681
             ICFP++ LDNASNV  ++ + +            W  + F +K+L+ V L+QGV+SR   
Sbjct  79    ICFPNLNLDNASNVKDVYPNHKE-----------WLSVGFTWKELSTVTLEQGVFSRLQI  127

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD     IL +E+V  K+   GLWLN+QH  FY+QHNLSMR FVLS+S  + IN+ISSP+
Sbjct  128   FDDV-SNILRIEEV-AKLGTSGLWLNIQHSDFYTQHNLSMRNFVLSISSHMKINFISSPD  185

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             ++FLKS+   + P  TKL+FRFL  D+ +P TNQ+Y SL +NL  IKTF+SGILVPKSYI
Sbjct  186   ISFLKSVKKDVKPTKTKLIFRFLSQDQIDPFTNQSYASLAKNLTFIKTFSSGILVPKSYI  245

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WPV  S  YLQP TSLV DAH+ GL+V+AS+FA+D   A++YSYDP  EYL FIDNGN+S
Sbjct  246   WPV-SSDLYLQPHTSLVTDAHRQGLQVFASEFANDAVSAYNYSYDPTNEYLYFIDNGNFS  304

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDG LSDFP+TP  AI+C+SH+ K +  +     +IS DGASGD+ G TD AY KAV DG
Sbjct  305   VDGFLSDFPLTPYRAINCFSHLDKKKATKQANITIISKDGASGDFSGGTDLAYEKAVRDG  364

Query  1402  VDIIDC  1419
             VD IDC
Sbjct  365   VDFIDC  370


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 4/111 (4%)
 Frame = +1

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  1164
             +  IK+FA  I++ K  + P  +  + L+  T +V      GL VY   F+++ +   +D
Sbjct  545   IKDIKSFAGSIVISKKSVVPYSEGIARLEKETDVVPRLRSSGLRVYVETFSNEFITQPYD  604

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAID--CYSHMRKGQKNQV  1311
             +  DP  E   F+  G+  VDG+++DFP T S      CYS M + +  ++
Sbjct  605   FFSDPTVEIDYFV-RGDPEVDGIITDFPATTSRYTKNPCYSKMEQIRTGEL  654



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   422 bits (1086),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/366 (57%), Positives = 262/366 (72%), Gaps = 14/366 (4%)
 Frame = +1

Query  322   TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  501
             T S+S WQTL G  P+V+ARGGFSGL PDSS NAY    LT+  +V +WCD+QLTKDG G
Sbjct  19    TASSSSWQTLHGKPPVVVARGGFSGLLPDSSENAYKMVKLTTSPDVTLWCDLQLTKDGAG  78

Query  502   ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  681
             ICFP++ LDNASNV  ++ + +            W  + F +K+L+ V L+QGV+SR   
Sbjct  79    ICFPNLNLDNASNVKDVYPNHKE-----------WLSVGFTWKELSTVTLEQGVFSRLQI  127

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD     IL +E+V  K+   GLWLN+QH  FY+QHNLSMR FVLS+S  + IN+ISSP+
Sbjct  128   FDDV-SNILRIEEV-AKLGTSGLWLNIQHSDFYTQHNLSMRNFVLSISSHMKINFISSPD  185

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             ++FLKS+   + P  TKL+FRFL  D+ +P TNQ+Y SL +NL  IKTF+SGILVPKSYI
Sbjct  186   ISFLKSVKKDVKPTKTKLIFRFLSQDQIDPFTNQSYASLAKNLTFIKTFSSGILVPKSYI  245

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WPV  S  YLQP TSLV DAH+ GL+V+AS+FA+D   A++YSYDP  EYL FIDNGN+S
Sbjct  246   WPV-SSDLYLQPHTSLVTDAHRQGLQVFASEFANDAVSAYNYSYDPTNEYLYFIDNGNFS  304

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDG LSDFP+TP  AI+C+SH+ K +  +     +IS DGASGD+ G TD AY KAV DG
Sbjct  305   VDGFLSDFPLTPYRAINCFSHLDKKKATKQANITIISKDGASGDFSGGTDLAYEKAVRDG  364

Query  1402  VDIIDC  1419
             VD IDC
Sbjct  365   VDFIDC  370


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 4/111 (4%)
 Frame = +1

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  1164
             +  IK+FA  I++ K  + P  +  + L+  T +V      GL VY   F+++ +   +D
Sbjct  545   IKDIKSFAGSIVISKKSVVPYSEGIARLEKETDIVPRLRSSGLRVYVETFSNEFITQPYD  604

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAID--CYSHMRKGQKNQV  1311
             +  DP  E   F+  G+  VDG+++DFP T S      CYS M + +  ++
Sbjct  605   FFSDPTVEIDYFV-RGDPEVDGIITDFPATTSRYTKNPCYSKMEQIRTGEL  654



>ref|XP_004973845.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Setaria italica]
Length=679

 Score =   420 bits (1080),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 201/384 (52%), Positives = 276/384 (72%), Gaps = 6/384 (2%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTNST---SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V ++A   +       S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA + S
Sbjct  19    LLCCGCVMVLAGAAAAQGPRLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIAS  78

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
                  +WCDVQLTKDGVG+C  DI ++N +NVA  ++ ++ TY+++GV    WF +DF  
Sbjct  79    APGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQARKRTYVIDGVRKNGWFALDFTK  138

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
              +L  V+L Q ++SR+ RFD     IL+V D+ + V+ P +WLNVQHD+FY +H L+MR 
Sbjct  139   DELQSVSLTQAIWSRTYRFDSVGYSILSVTDLLSIVKQPSVWLNVQHDTFYKEHGLNMRN  198

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             ++LS+ +RV ++YISSPE+ FL++I+  ++ R TKLVF FL     + S NQTYGSLL N
Sbjct  199   YILSIQKRVSVDYISSPELGFLQNISGTVH-RKTKLVFSFLDKSLLDHSINQTYGSLLSN  257

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  IK+ ASGI+VPK+YIWPV K  +YLQP+TS+V +AH  GLE+YASDFA+D    ++Y
Sbjct  258   LTLIKSIASGIMVPKTYIWPVTK-DNYLQPSTSIVAEAHNAGLEIYASDFANDRIIPYNY  316

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             SYDP+AEYL+FI +G +SVDGVLS+ PIT S AI C++++   +     E LVIS +GAS
Sbjct  317   SYDPLAEYLNFISDGGFSVDGVLSEHPITASEAIGCFANLNSSETGH-GEPLVISHNGAS  375

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDC  1419
             GDYP CTD AY+ A++DG D+IDC
Sbjct  376   GDYPDCTDLAYNSAINDGADVIDC  399



>ref|XP_006647435.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=747

 Score =   422 bits (1085),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 213/363 (59%), Positives = 268/363 (74%), Gaps = 11/363 (3%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TLSG  PLVIA+GGFSGLFPDSS  AY      S     +WCDVQLTKDG GIC P
Sbjct  32    STWKTLSGGPPLVIAKGGFSGLFPDSSDFAYG-----SAPGAALWCDVQLTKDGAGICLP  86

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  690
             DI ++N + +++       TY VNGVP   WFP+D+    L   V L+Q + SR+ +FDG
Sbjct  87    DINMNNCTGISSFDPKGIKTYNVNGVPVKGWFPMDYKSADLLQQVFLKQPILSRTDKFDG  146

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                 I+ VEDV +K + P +WLNVQHDSFYSQ NL+MR+++LSVS++  ++YISSPEVNF
Sbjct  147   L--AIVPVEDVLSKYKTPAVWLNVQHDSFYSQFNLNMRSYILSVSKQFAVDYISSPEVNF  204

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             L S+  R++ + TKLVFRFL     EPSTNQTYGSLL+NL  IKT ASG+LVPK YI PV
Sbjct  205   LNSLLGRVSKK-TKLVFRFLDEQTVEPSTNQTYGSLLKNLTFIKTIASGVLVPKHYILPV  263

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
              K + YLQP TS+V DAHK GLE+YA+DFA+D  F+++YSYDP+AEYLSFIDNG +S+DG
Sbjct  264   TKDN-YLQPHTSVVDDAHKAGLEIYAADFANDFSFSYNYSYDPLAEYLSFIDNGAFSIDG  322

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
             VL+DFPIT S AI C++++   + +   + LVIS +GASGDYP CTD AY KAV+DG D+
Sbjct  323   VLTDFPITSSEAIGCFTNLNNSKIDH-GKPLVISHNGASGDYPDCTDLAYQKAVADGADV  381

Query  1411  IDC  1419
             IDC
Sbjct  382   IDC  384



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   418 bits (1074),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 257/327 (79%), Gaps = 4/327 (1%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             A+GS  +T  W TL+G  PLVIARGG SG+FPDSS  AY  A   SL N+I+WCDVQLTK
Sbjct  27    ARGSHRTT--WNTLTGSPPLVIARGGSSGIFPDSSEYAYELAAQISLKNLIVWCDVQLTK  84

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  666
             DG GIC  +IKL+NA+++  +F+++  TY VNGV T+A+F +D+   +L + V L QG +
Sbjct  85    DGEGICISNIKLENATDIDKIFENRSKTYSVNGVQTSAYFAVDYTLTELRSNVLLIQGDF  144

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             +R+  FD    +ILTV ++       G WLN+Q+D+FY+QHNLSM+ FVLSVSR V ++Y
Sbjct  145   ARNPNFDDN-FEILTVNEMITITPASGPWLNIQYDAFYAQHNLSMKNFVLSVSRTVNVSY  203

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPE  FL+SI + INPR+TK+VFRFL  DE +PSTN+TYGSLL+NLASIKTFASGILV
Sbjct  204   ISSPEAGFLRSIKAHINPRITKVVFRFLEKDEVDPSTNRTYGSLLKNLASIKTFASGILV  263

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK YIWPVD +  YL P TSLV DAHKVGLEV+ASD  +D+P +++YSYDPVAEYL+FID
Sbjct  264   PKGYIWPVDPTGLYLLPHTSLVSDAHKVGLEVFASDILNDIPISYNYSYDPVAEYLNFID  323

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHM  1287
             NGN+SVDGVLSDFP+TPS AIDC++H+
Sbjct  324   NGNFSVDGVLSDFPLTPSEAIDCFAHI  350



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   419 bits (1078),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 264/363 (73%), Gaps = 14/363 (4%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             +S WQTLSG  P+VIARGGFSG+FPDSS  AY  A +T+ T+V +WCD+QLTKDGVGICF
Sbjct  22    SSSWQTLSGKPPVVIARGGFSGIFPDSSIQAYQLASITTSTDVTLWCDLQLTKDGVGICF  81

Query  511   PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDG  690
             P++ LDN SNV  ++ + + +           F IDF  K+L+ V   Q V SRS+ FD 
Sbjct  82    PNLNLDNGSNVMNVYPNYKES-----------FSIDFTKKELSRVGCAQSVPSRSNIFDD  130

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
                 I T+ DV  +    GLWLNVQ  +FYSQHN++MR FV+S+S+RV   +ISSPE+ F
Sbjct  131   A-YPICTINDV-AETAASGLWLNVQDSAFYSQHNMNMRNFVVSISKRVRFKFISSPEITF  188

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             LKS+ +     VTKL+FRFL  D+ EP TNQ+YGSL +NL+ I+TF+SGILVPKSYIWPV
Sbjct  189   LKSMKNSAKRTVTKLIFRFLNQDQIEPFTNQSYGSLSKNLSYIRTFSSGILVPKSYIWPV  248

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
             D S  YLQP TSLV DAHK GL+V+AS+FA+D   A++YSYDP AEYLSFIDNGN+SVDG
Sbjct  249   D-SYLYLQPHTSLVTDAHKEGLQVFASEFANDFVIAYNYSYDPTAEYLSFIDNGNFSVDG  307

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
              LSDFP+TP  AI+C+SH+   +     +  +IS +GASG +PGCTD AY +A  DGVDI
Sbjct  308   FLSDFPVTPYRAINCFSHVDTKKAEDQAKVTIISKNGASGYFPGCTDLAYQRAADDGVDI  367

Query  1411  IDC  1419
             +DC
Sbjct  368   LDC  370



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   422 bits (1086),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 269/364 (74%), Gaps = 20/364 (5%)
 Frame = +1

Query  328   STSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGIC  507
             S S WQTLSG  P+VIARGGFSG+FPDSS  AY    +T+  N+ +WCD+QLTKDGVGIC
Sbjct  151   SASSWQTLSGKPPVVIARGGFSGVFPDSSSKAYELVSVTTSLNLALWCDLQLTKDGVGIC  210

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFD  687
             FP++ L N S+V  ++ +K             WF +DF +K L+ VNL Q V SRS  FD
Sbjct  211   FPNLNLYNDSDVKDVYPNKNE-----------WFSVDFTWKDLSDVNLVQNVKSRSGVFD  259

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             G+  QILTVE +  ++  PGLWLN+Q+ +FY QHNLSMR +V+S+S+RV  ++ISSPE++
Sbjct  260   GS-YQILTVE-IVAELGAPGLWLNIQNSAFYRQHNLSMRNYVVSLSKRV--DFISSPEIS  315

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FLKS+       VTKL+FRFL  D+ EP TNQTY SL +NL+ IKTF+SGILVPKSYIWP
Sbjct  316   FLKSMKKD----VTKLIFRFLNQDQIEPFTNQTYSSLSKNLSYIKTFSSGILVPKSYIWP  371

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V  S  YL+P TSLV +AH+ GL+V+AS+FA+D  FA++YSYDP AEYLSFID+GN+SVD
Sbjct  372   VG-SDLYLKPHTSLVTEAHRQGLQVFASEFANDFVFAYNYSYDPTAEYLSFIDSGNFSVD  430

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             G LSDFP+TP  AI C+SH+   +  +     +IS DGASGD+PGCTD AY KAV DGVD
Sbjct  431   GFLSDFPVTPYRAISCFSHLDTKEDEEPAVVTIISNDGASGDFPGCTDLAYEKAVKDGVD  490

Query  1408  IIDC  1419
             I+DC
Sbjct  491   ILDC  494



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   420 bits (1079),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 276/377 (73%), Gaps = 6/377 (2%)
 Frame = +1

Query  301   LVAAQGSTNS----TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  468
             +V++Q   NS    TS W TLSG  PLVIA+GGFSGLFPDSS  +Y F+ +    + I W
Sbjct  32    VVSSQSLKNSNLTATSPWLTLSGGTPLVIAKGGFSGLFPDSSSFSYKFSYVAGSPDTISW  91

Query  469   CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  648
             CDV+LTKDG G+C PDI LDN +N+  ++ + +  Y+VNGVPT+ WF +D++ + L+ V+
Sbjct  92    CDVRLTKDGNGVCLPDIVLDNCTNIKLVYPEGKMNYIVNGVPTSGWFSVDYDIQNLSQVS  151

Query  649   LQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSR  828
             L Q + SRS++FD +   ILTVED+  +V+P  LWLN+QHD FY Q NL MR ++L +S+
Sbjct  152   LAQAILSRSNKFDASLFPILTVEDLVAQVKPAKLWLNIQHDIFYRQLNLDMRRYLLYLSK  211

Query  829   RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTF  1008
               + +Y+SSPEV FL SI  R     TKL+FRFLG D  EPSTN TYGSLL+NL  +KTF
Sbjct  212   HDIPSYVSSPEVGFLSSIVGRFRTSKTKLIFRFLGEDTIEPSTNVTYGSLLKNLTFVKTF  271

Query  1009  ASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAE  1188
             ASGIL+PK YIWPV  SS YL+  TS+V+DAH+ GLEV+AS+FA+D  F+++YSYDP+AE
Sbjct  272   ASGILIPKYYIWPV-TSSGYLESYTSVVMDAHREGLEVFASEFANDALFSYNYSYDPLAE  330

Query  1189  YLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCT  1368
              LSFIDNG +SVDGV++DFPIT S AI CYSH+     +   + L+IS +GASG YP CT
Sbjct  331   VLSFIDNGIFSVDGVVTDFPITASEAIGCYSHINMSNSDH-GKPLIISHNGASGVYPDCT  389

Query  1369  DXAYSKAVSDGVDIIDC  1419
             D +Y +A++DG D IDC
Sbjct  390   DLSYQQAITDGADYIDC  406



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   419 bits (1078),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 201/384 (52%), Positives = 276/384 (72%), Gaps = 6/384 (2%)
 Frame = +1

Query  277   LLLCSAVTLVAAQGSTNST---SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             LL C  V ++A   +       S ++TL GDAP V+A+GGFSG+FPDSS +AYSFA + S
Sbjct  19    LLCCGCVMVLAGAAAAQGPRLPSAYKTLRGDAPRVVAKGGFSGVFPDSSSDAYSFALIAS  78

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
                  +WCDVQLTKDGVG+C  DI ++N +NVA  ++ ++ TY+++GV    WF +DF  
Sbjct  79    APGTTLWCDVQLTKDGVGVCLRDINMNNCTNVAHTYQARKRTYVIDGVRKNGWFALDFTK  138

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
              +L  V+L Q ++SR+ RFD     IL+V D+ + V+ P +WLNVQHD+FY +H L+MR 
Sbjct  139   DELQSVSLTQAIWSRTYRFDSVGYSILSVTDLLSIVKQPSVWLNVQHDTFYKEHGLNMRN  198

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             ++LS+ +RV ++YISSPE+ FL++I+  ++ R TKLVF FL     + S NQTYGSLL N
Sbjct  199   YILSIQKRVSVDYISSPELGFLQNISGTVH-RKTKLVFSFLDKSLLDHSINQTYGSLLSN  257

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  IK+ ASGI+VPK+YIWPV K  +YLQP+TS+V +AH  GLE+YASDFA+D    ++Y
Sbjct  258   LTLIKSIASGIMVPKTYIWPVTK-DNYLQPSTSIVAEAHNAGLEIYASDFANDRIIPYNY  316

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             SYDP+AEYL+FI +G +SVDGVLS+ PIT S AI C++++   +     E LVIS +GAS
Sbjct  317   SYDPLAEYLNFISDGGFSVDGVLSEHPITASEAIGCFANLNSSETGH-GEPLVISHNGAS  375

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDC  1419
             GDYP CTD AY+ A++DG D+IDC
Sbjct  376   GDYPDCTDLAYNSAINDGADVIDC  399



>ref|XP_006856834.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Amborella 
trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   418 bits (1075),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/368 (57%), Positives = 269/368 (73%), Gaps = 4/368 (1%)
 Frame = +1

Query  319   STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV  498
             S NST  W+TL+G+AP+VIARGGFSGLFPDSS  A+ F    +L   I WCDVQLTKDG 
Sbjct  29    SRNSTRIWRTLTGNAPVVIARGGFSGLFPDSSTFAFDFPNSLNLPRPISWCDVQLTKDGK  88

Query  499   GICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRS  675
             G+C P + LDN +N+  +++  + TY VNG   T WF IDF  +QL   V L QG+++R+
Sbjct  89    GVCLPSLLLDNCTNIQEIYQTGKKTYTVNGEILTGWFSIDFTIEQLVNNVTLIQGIFTRT  148

Query  676   SRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISS  855
             + FD T   IL VE V  + Q PG WLN+QHD F+ QHNLSMR++V+SVSR++V++YISS
Sbjct  149   NAFDAT-GSILPVEYVGTQTQAPGFWLNIQHDIFFRQHNLSMRSYVISVSRQMVVDYISS  207

Query  856   PEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKS  1035
             P+V FL SI +R     TKLVFRFL  D  EP TNQ+YGSLL+NL  +KTFASGILVPK 
Sbjct  208   PDVAFLSSIGARFKGSKTKLVFRFLEVDAVEPLTNQSYGSLLKNLTFVKTFASGILVPKD  267

Query  1036  YIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGN  1215
             YIWP + S +YL+P +++V DAHK GLE YA  F++DVP + +YSYDP+AE L++IDNG 
Sbjct  268   YIWPTN-SDNYLEPHSAVVRDAHKEGLEAYAYGFSNDVPLSHNYSYDPLAECLNYIDNGE  326

Query  1216  YSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVS  1395
             +SVDGVL+DFP+T S A+ C+SH+     ++  + LVIS +GASG Y   TD AY +AVS
Sbjct  327   FSVDGVLTDFPVTASEAVGCFSHVNPNTSDK-GKPLVISHNGASGIYADSTDLAYRQAVS  385

Query  1396  DGVDIIDC  1419
             DG D+IDC
Sbjct  386   DGADVIDC  393



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   417 bits (1071),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 207/363 (57%), Positives = 265/363 (73%), Gaps = 5/363 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  33    STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDG  690
              I +DN + +  +F + + TY VNGV T  WF +D+    L   V L+Q V SR+  +DG
Sbjct  93    SINMDNCTMIDNVFPEGKKTYNVNGVSTVGWFSVDYTSTDLLPNVTLKQSVLSRTPVYDG  152

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
             +   I +VE+VF       +WLNVQ DSFYSQ  LSMR ++LS+S++ + +YISSPEVNF
Sbjct  153   S-MLINSVENVFTSFNASAVWLNVQQDSFYSQFKLSMRNYILSLSKQFITDYISSPEVNF  211

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             L SI+ R++ + TKLVFRFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV
Sbjct  212   LTSISGRVSKK-TKLVFRFLDEGSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV  270

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
                 +YL P TS+V DAHK GLE+YA+DFA+D   +++YS+DP+AEYLSFI N  +SVDG
Sbjct  271   -TPDNYLLPYTSVVDDAHKAGLEIYAADFANDFTISYNYSFDPLAEYLSFIGNSAFSVDG  329

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
             VL+DFPITPS A+ C+S++   + +     LVIS +GASGDYP CTD AY KAV+DG D+
Sbjct  330   VLTDFPITPSEAVGCFSNLNNSKIDHAKP-LVISHNGASGDYPDCTDQAYEKAVADGADV  388

Query  1411  IDC  1419
             IDC
Sbjct  389   IDC  391



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   415 bits (1066),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 212/385 (55%), Positives = 269/385 (70%), Gaps = 18/385 (5%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L +L    +LVA   S      W+TL G  PLVIARGGFSG+FPDSS  AYS    T   
Sbjct  7     LAILILQYSLVALVSSAGPRGGWKTLQGSPPLVIARGGFSGIFPDSSSLAYSLTLDTCGP  66

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             NV +WCDVQLTKDGVGICFP++KLDNAS+++  +  K   YLVNGV T  WF +D+N  +
Sbjct  67    NVTLWCDVQLTKDGVGICFPELKLDNASDISIAYPGKAKDYLVNGVSTRGWFSVDYNLAE  126

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPP--GLWLNVQHDSFYSQHNLSMRT  807
             L  V++ QGVYSR+++FDG    I +VEDV   ++ P  GLWLN+QHDSF+ Q NLS+  
Sbjct  127   LANVSVVQGVYSRTNKFDGNKLPIRSVEDVAKLIKSPSTGLWLNIQHDSFFKQQNLSVEN  186

Query  808   FVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
             F+ S+ ++ V +NYISSP+V+FL+ + S  +   T  +FRFL   + EP+TNQTYG LL+
Sbjct  187   FLQSLPAKSVPVNYISSPDVDFLRRVKSSFSSGPTGFIFRFLEQSKLEPTTNQTYGELLK  246

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  IKTFASGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD  +DVPF+++
Sbjct  247   NLMLIKTFASGILVPKGYIWPVD-SGLYLQPHTPLVTDAHREGLQVFVSDLTNDVPFSYN  305

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             +SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI               + LVI+  GA
Sbjct  306   FSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAI--------------MDTLVITKYGA  351

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGD P CTD AY++A SDG D++DC
Sbjct  352   SGDNPACTDLAYNQAKSDGADVLDC  376


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 81/316 (26%), Positives = 147/316 (47%), Gaps = 47/316 (15%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI + G SG  P  +  AY+ A   S    ++ C VQ++KDG+  C   I L  ++ VA
Sbjct  344   LVITKYGASGDNPACTDLAYNQA--KSDGADVLDCPVQMSKDGIPFCLSSIDLSESTTVA  401

Query  547   -TLFKDKQSTYLVNGVPTTAWFPIDFNF-------KQLT---LVNLQQGVYSRSSRFDGT  693
              T  K++ +T     +P   +    + F       K LT   L   ++ + SR+ +    
Sbjct  402   DTQLKNRATT-----IPEIKYRSGIYTFSLTWDEIKTLTPSILNPYEKYILSRNPKSKNL  456

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQ-HNLSMRTFVLSV-------SRRVVINYI  849
               +++T+ D  +  +   + +++++ ++ ++  NL +   VL         S +V+I   
Sbjct  457   -GKLITLSDFLSLTEGSRILISIENAAYLAEKQNLRVTDAVLDALQKAKPRSHKVMIQST  515

Query  850   SSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVP  1029
              S  +   K   S+   RV K+       DE         G+    +  IKTFA  +++ 
Sbjct  516   HSSVLKIFKD-KSKFE-RVYKV-------DE------NIGGAADSAIEDIKTFADAVVIG  560

Query  1030  KSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFID  1206
             K+ ++P  +SS++L   T++V       L V+   F+++ V  A+DY  DP  E  SF+ 
Sbjct  561   KASVFP--ESSAFLVNFTNIVARLKSFKLPVFVETFSNEFVSQAWDYYSDPSIEINSFVI  618

Query  1207  NGNYSVDGVLSDFPIT  1254
                  V+G+++DFP T
Sbjct  619   GTK--VNGIITDFPKT  632



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   412 bits (1058),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/377 (55%), Positives = 266/377 (71%), Gaps = 42/377 (11%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L+A Q  +  S SKWQTL+G +P VIARGGFSGLFPDSS +AY+FA LTS+ +V++WC
Sbjct  13    IQLLAVQTDAQRSKSKWQTLTGFSPRVIARGGFSGLFPDSSIDAYNFAMLTSVEDVVLWC  72

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNL  651
             D+QLTKDG GICFP + + NASN+   + ++ +TYLVNGV T  WF IDF+ K L  VNL
Sbjct  73    DLQLTKDGAGICFPGLTMSNASNIEAAYPNRTNTYLVNGVSTQGWFTIDFSLKDLNKVNL  132

Query  652   QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRR  831
              +G+ SRS RFDG    ILTV+DV  +++P GLWLNVQH++FY+QHNLSM TF+ + S+ 
Sbjct  133   IRGILSRSERFDGNGYSILTVQDVNTELKPQGLWLNVQHEAFYAQHNLSMTTFLTTTSKT  192

Query  832   VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFA  1011
             ++I++ISSPEVNF K IA R                         +G             
Sbjct  193   IIIDFISSPEVNFFKKIAGR-------------------------FGR------------  215

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEY  1191
               ILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S FA+DV  A DYSYDPV+EY
Sbjct  216   --ILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGFANDVDIAHDYSYDPVSEY  272

Query  1192  LSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTD  1371
             LSF+DNGN+SVDGVLSDFPI+ S +++C+SHM +    QV +FLVIS +GASGDYPGCTD
Sbjct  273   LSFVDNGNFSVDGVLSDFPISASASVECFSHMGRNATKQV-DFLVISKNGASGDYPGCTD  331

Query  1372  XAYSKAVSDGVDIIDCT  1422
              AY+KA+ DG D+IDC+
Sbjct  332   LAYAKAIKDGADVIDCS  348



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   409 bits (1051),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 251/329 (76%), Gaps = 5/329 (2%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
             V+AQ S  +T  W TLSG+ PLVIARGGFSG+FPDSS +AY F    SL NVI+WCDVQL
Sbjct  27    VSAQVSNATT--WDTLSGNPPLVIARGGFSGIFPDSSESAYIFGVTASLKNVIVWCDVQL  84

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQG  660
             TKD  GIC P++KL+NA+++A   K K  +Y VNGV T  +F  D+  K+L + V L QG
Sbjct  85    TKDSQGICVPNVKLENATDIAQNNKYKSKSYQVNGVQTDGYFSADYTLKELRSNVFLVQG  144

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
              YSR +   G   +ILTV+DV     P GLWLN+QHD+FY+QHNLSM+ F+  V   V +
Sbjct  145   DYSRPTL--GGVFEILTVKDVVKTTFPQGLWLNIQHDAFYTQHNLSMKNFIRFVYTTVNV  202

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
             +YISSPE  FLKSI + INP++TKLVFRFLG +E +PST QTYGSLLQNL  IKTFASGI
Sbjct  203   SYISSPEAGFLKSIKTDINPKITKLVFRFLGKEEVDPSTKQTYGSLLQNLTFIKTFASGI  262

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPVD +S YLQP TSLV DAHKVGLEV+AS F +D+P +++YSYDP  E+LSF
Sbjct  263   LVPKDYIWPVDPTSHYLQPHTSLVSDAHKVGLEVFASTFQNDIPISYNYSYDPFFEHLSF  322

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHM  1287
             I+NGN+SVDGVLSDFP+T S AIDC+ HM
Sbjct  323   IENGNFSVDGVLSDFPLTSSAAIDCFVHM  351



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   407 bits (1047),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 267/366 (73%), Gaps = 8/366 (2%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S ++TL GDAPLVIA+GGFSG+FPDSS+ A+SFA L S  +  +WCDVQLTKDGVGIC  
Sbjct  42    SSYKTLRGDAPLVIAKGGFSGVFPDSSYYAFSFALLASAPDTSLWCDVQLTKDGVGICLR  101

Query  514   DIKLDNASNVATLF---KDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSR  681
             DI + N +N A ++     K++ Y+++GVP T +F +DF   ++ T ++L QG+YSR+ R
Sbjct  102   DINMSNCTNAAQVYPVKNKKEAKYVIDGVPKTGYFSLDFTLSEIQTTLSLTQGIYSRTER  161

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD T   IL+V D  + V+PP +WLNVQ D FY QH L+MR++++S+ + V + YISSPE
Sbjct  162   FD-TMYSILSVTDFQSNVKPPSVWLNVQRDIFYKQHGLNMRSYIVSILKSVPVKYISSPE  220

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             + FLKSI+ R   R TKLVFRF  N  ++PSTNQTY SL +NL  IKT ASGI+VPK YI
Sbjct  221   LGFLKSISKRAG-RRTKLVFRFPDNFLSDPSTNQTYSSLSKNLTFIKTIASGIMVPKIYI  279

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WPV  + +YLQP TS V DAH  GLE+YASDFA+D    ++YSYDP+ EYLSFI +G +S
Sbjct  280   WPV-TNDNYLQPPTSFVQDAHSAGLEIYASDFANDRIIPYNYSYDPLQEYLSFISDGGFS  338

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDGVL+D+PIT S AI C++ +   + +   + L+IS +GASGDYP CTD AY  A+ DG
Sbjct  339   VDGVLTDYPITASEAIGCFADLNASKADH-GKPLIISHNGASGDYPDCTDLAYQNAIKDG  397

Query  1402  VDIIDC  1419
              D+IDC
Sbjct  398   ADVIDC  403



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   405 bits (1042),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/393 (53%), Positives = 278/393 (71%), Gaps = 11/393 (3%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1     MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F   Q TY +NG     W
Sbjct  54    QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPKSQKTYTINGENVQGW  113

Query  607   FPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             F +D+   QL   V L Q +YSR S FDGT   + TV+D    ++PPG WLNVQ+D+FY+
Sbjct  114   FALDYTSDQLFNNVTLTQSIYSRPSLFDGT-LPLSTVDDAIG-IKPPGFWLNVQYDAFYA  171

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
              + LS+ +++   +R + I+YISSPE+ FLK++   IN   TKL+FRFL  D  EP+T Q
Sbjct  172   ANKLSVSSYIQKTTRFMGISYISSPEIGFLKNMNKIINKAKTKLIFRFLDADAVEPTTKQ  231

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
              Y S+L++L+SIK+ ASGILVPK YIWP+ K    L P+ S+V DAHK GLEVYAS FA+
Sbjct  232   PYSSILKDLSSIKSIASGILVPKEYIWPLSKDQYLLTPS-SVVADAHKQGLEVYASGFAN  290

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D+P +++YSYDP AEYL F+DN ++SVDGVL+DFP T S AI C +H +   +    + L
Sbjct  291   DMPGSYNYSYDPTAEYLQFVDNSDFSVDGVLTDFPPTASEAIACLAHNKNATRPSKGKIL  350

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             VIS +GASG YPG TD AY +AV DG DIIDC+
Sbjct  351   VISHNGASGVYPGSTDLAYQQAVDDGADIIDCS  383


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 76/317 (24%), Positives = 136/317 (43%), Gaps = 44/317 (14%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI+  G SG++P S+  AY  A        I+ C VQ++KDGV  C     L  +SN  
Sbjct  350   LVISHNGASGVYPGSTDLAYQQA--VDDGADIIDCSVQMSKDGVAFCLNSADLLGSSNAM  407

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ-----QILT  711
             T F  + ST +    P +  F  D  + ++  +  Q      +S     P      + +T
Sbjct  408   TSFMSR-STMVSEIQPKSGIFSFDLTWSEIQTLTPQLTSPLPNSGLARNPANKNQGKFIT  466

Query  712   VEDV--FNKVQP-PGLWLNVQHDSFYSQHN-----------LSMRTFVLSVSRRVVINYI  849
             + D   F K +   G+ +++++ ++ +              LS  TF    +++V+I   
Sbjct  467   LSDFLDFAKAKAVSGILIDIENAAYLASKKGLSIIDAVTAALSNATFDKQATQQVMIQSD  526

Query  850   SSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSL-LQNLASIKTFASGILV  1026
              +  ++  K++     P   +++           S  +  G +  Q +  IK FA  + +
Sbjct  527   DTSVLSKFKNV-----PGYKRVL-----------SIKEIIGDVPKQTVEEIKKFADAVNL  570

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
             P+S I   +   +    T    L  H   +  Y S   ++ V  AFD+  DPV E  +++
Sbjct  571   PRSSIVTTNGGFTTTFTTVVDEL--HAANISAYVSVLRNEYVAIAFDFFSDPVVELATYV  628

Query  1204  DNGNYSVDGVLSDFPIT  1254
               G   +DGV++D+P T
Sbjct  629   --GRLGIDGVVTDYPKT  643



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   405 bits (1041),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/393 (53%), Positives = 278/393 (71%), Gaps = 11/393 (3%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             M +   +F+LL+L ++     AQ +++ T  WQTL+GD P+VIARGGFSGLFP+SS  A+
Sbjct  1     MIRCLVLFSLLILSTS-----AQKTSSQT--WQTLNGDEPVVIARGGFSGLFPESSQFAH  53

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A  TSL+NVI++C++QLTKD VGIC  DI+LDN++N+A +F   Q TY +NG     W
Sbjct  54    QIALSTSLSNVILYCNLQLTKDSVGICQTDIRLDNSTNIAAVFPKSQKTYTINGENVQGW  113

Query  607   FPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             F +D+   QL   V L Q +YSR S FDGT   + TV+D    ++PPG WLNVQ+D+FY+
Sbjct  114   FALDYTSDQLFNNVTLTQSIYSRPSLFDGT-LPLSTVDDAIG-IKPPGFWLNVQYDAFYA  171

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
              + LS+ +++   +R + I+YISSPE+ FLK++   IN   TKL+FRFL  D  EP+T Q
Sbjct  172   ANKLSVSSYIQKTTRFMGISYISSPEIGFLKNMNKIINKAKTKLIFRFLDADAVEPTTKQ  231

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
              Y S+L++L+SIK+ ASGILVPK YIWP+ K    L P+ S+V DAHK GLEVYAS FA+
Sbjct  232   PYSSILKDLSSIKSIASGILVPKEYIWPLSKDQYLLTPS-SVVADAHKQGLEVYASGFAN  290

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D+P +++YSYDP AEYL F+DN ++SVDGVL+DFP T S AI C +H +   +    + L
Sbjct  291   DMPGSYNYSYDPTAEYLQFVDNSDFSVDGVLTDFPPTASEAIACLAHNKNATRPSKGKIL  350

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             VIS +GASG YPG TD AY +AV DG DIIDC+
Sbjct  351   VISHNGASGVYPGSTDLAYQQAVDDGADIIDCS  383


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 76/317 (24%), Positives = 136/317 (43%), Gaps = 44/317 (14%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI+  G SG++P S+  AY  A        I+ C VQ++KDGV  C     L  +SN  
Sbjct  350   LVISHNGASGVYPGSTDLAYQQAVDDGAD--IIDCSVQMSKDGVAFCLNSADLLGSSNAM  407

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ-----QILT  711
             T F  + ST +    P +  F  D  + ++  +  Q      +S     P      + +T
Sbjct  408   TSFMSR-STMVSEIQPKSGIFSFDLTWSEIQTLTPQLTSPLPNSGLARNPANKNQGKFIT  466

Query  712   VEDV--FNKVQP-PGLWLNVQHDSFYSQHN-----------LSMRTFVLSVSRRVVINYI  849
             + D   F K +   G+ +++++ ++ +              LS  TF    +++V+I   
Sbjct  467   LSDFLDFAKAKAVSGILIDIENAAYLASKKGLSIIDAVTAALSNATFDKQATQQVMIQSD  526

Query  850   SSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSL-LQNLASIKTFASGILV  1026
              +  ++  K++     P   +++           S  +  G +  Q +  IK FA  + +
Sbjct  527   DTSVLSKFKNV-----PGYKRVL-----------SIKEIIGDVPKQTVEEIKKFADAVNL  570

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
             P+S I   +   +    T    L  H   +  Y S   ++ V  AFD+  DPV E  +++
Sbjct  571   PRSSIVTTNGGFTTTFTTVVDEL--HAANISAYVSVLRNEYVAIAFDFFSDPVVELATYV  628

Query  1204  DNGNYSVDGVLSDFPIT  1254
               G   +DGV++D+P T
Sbjct  629   --GRLGIDGVVTDYPKT  643



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   405 bits (1042),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 258/361 (71%), Gaps = 1/361 (0%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             ++TLSG+ PLVIA+GGFSG+FPDSS NA++FA  ++ +   +WCDVQLTKDGVGIC  D+
Sbjct  50    YKTLSGNPPLVIAKGGFSGVFPDSSSNAFTFALTSTSSATTLWCDVQLTKDGVGICLRDL  109

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ  699
              ++N +++   +   + TY+VNG     WFPID+    L  V L Q ++SR  +FD    
Sbjct  110   LMNNCTSIDQTYPQGKKTYIVNGKKQDGWFPIDYTMSSLQSVILTQAIWSRPDKFDFAYL  169

Query  700   QILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKS  879
              IL V ++ + V+P  LWLN++HD FY QH L+M  ++LS+S+   + YISSPE+ FL+S
Sbjct  170   PILPVTNLTSLVKPSSLWLNIEHDIFYRQHGLNMTKYILSISKNAAVKYISSPELGFLRS  229

Query  880   IASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKS  1059
             I  R+N R TKLVFRF     ++PS+NQTYGSLL NL  IKT ASGI+VPK YIWPV  +
Sbjct  230   ILGRVN-RKTKLVFRFPDAASSDPSSNQTYGSLLSNLTFIKTVASGIIVPKEYIWPVAPN  288

Query  1060  SSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLS  1239
             ++Y+QP+ S+V DAH  GLE+YASDFA+D    ++YSYDPV EYL F+ NGN+SVDGVL+
Sbjct  289   NNYIQPSKSIVGDAHNAGLEIYASDFANDRIIPYNYSYDPVEEYLHFVGNGNFSVDGVLT  348

Query  1240  DFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             + P+T + AI C++++    K      L+IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  349   EHPVTAAMAIGCFTNLNVSSKTDHGNPLIISHNGASGDYPDCTDLAYQKAVDDGADVIDC  408

Query  1420  T  1422
             T
Sbjct  409   T  409



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score =   404 bits (1038),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 261/366 (71%), Gaps = 15/366 (4%)
 Frame = +1

Query  322   TNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVG  501
             T S S WQTLSG  P+V+ARGGFSG+FP SS +AY    L +   V +WCD+QLTKDGVG
Sbjct  22    TASASSWQTLSGKPPVVVARGGFSGMFPYSSKDAYELVKLIT-PGVTLWCDLQLTKDGVG  80

Query  502   ICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSR  681
             ICFP + LDNAS+V  +  + +            WF  DF +KQL  V+L Q + SR+  
Sbjct  81    ICFPSLNLDNASDVKNILPNNKE-----------WFSSDFTWKQLFNVSLVQNINSRTEI  129

Query  682   FDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPE  861
             FD     I T+E+V N+     LWLN+Q  +FY+QHNLSMR  V+S+S+R+  N+ISSPE
Sbjct  130   FD-VNDPIWTIEEVANR-GASSLWLNIQDSAFYAQHNLSMRNTVVSLSKRIKFNFISSPE  187

Query  862   VNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYI  1041
             ++FL+S+ + + PRVTKL+F+FL  D+ +P TN++YGSL +NL+ I+TF+SGILVPKSYI
Sbjct  188   ISFLQSMKNSVKPRVTKLIFKFLDQDQIDPFTNKSYGSLAKNLSYIRTFSSGILVPKSYI  247

Query  1042  WPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYS  1221
             WPV  S  YL+P TSLV DAHK GL+V+AS+FA+D    ++YSYDP AEYLSFIDNGN+S
Sbjct  248   WPV-SSDHYLRPHTSLVTDAHKEGLQVFASEFANDFLIPYNYSYDPTAEYLSFIDNGNFS  306

Query  1222  VDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDG  1401
             VDG LSDFP+TP  AI C+SH+ K +        +IS +GASGD+P CTD AY +A  DG
Sbjct  307   VDGFLSDFPVTPYRAISCFSHLDKKKATDDANITIISNNGASGDFPDCTDLAYQRAAIDG  366

Query  1402  VDIIDC  1419
              DI+DC
Sbjct  367   ADILDC  372



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   402 bits (1032),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 264/390 (68%), Gaps = 30/390 (8%)
 Frame = +1

Query  268   FNLLLLCSAV--TLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             ++ +LLC  V   L +AQ  +  S S+WQTLSGDAPLVIARGGFSGL PDSS +AYS A 
Sbjct  16    YSTVLLCGVVLIQLFSAQIDAQRSRSRWQTLSGDAPLVIARGGFSGLLPDSSLDAYSLAT  75

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKD-KQSTYLVNGVPTTAWFPI  615
              TS+ +V++WCDVQLTKDGVGICFPD+ L NAS +  ++ + K  +Y VNGV    WF I
Sbjct  76    QTSVADVVLWCDVQLTKDGVGICFPDLNLANASTIDLVYPNHKPKSYPVNGVTRQGWFTI  135

Query  616   DFNFKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPG-LWLNVQHDSFYSQHN  792
             DF+   L  V+L +G+ SRS +FDG    I T+++V  ++ P G  WLNVQHD+FY Q N
Sbjct  136   DFSLGDLQNVSLIRGILSRSDKFDGNGYAISTIQNVAEQISPQGGFWLNVQHDAFYEQQN  195

Query  793   LSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYG  972
             LSM +F+LS S  V I +ISSPEVNF   IA          VF+FL  ++ EP+TNQTYG
Sbjct  196   LSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSFVFQFLEKEDFEPTTNQTYG  255

Query  973   SLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVP  1152
             S+L NL  +KTFASGILVPKSYI P++    YL P TSLV DAHK               
Sbjct  256   SILSNLTFVKTFASGILVPKSYILPLN-DKRYLLPHTSLVQDAHKA--------------  300

Query  1153  FAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVIS  1332
                      V+EYLSF+DNGN+SVDG+LSDFP+T S +IDC+SH+ +     V +FLVIS
Sbjct  301   ---------VSEYLSFVDNGNFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-DFLVIS  350

Query  1333  FDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
              +GASGDYPGCTD AY  A+ DG D+IDC+
Sbjct  351   KNGASGDYPGCTDLAYENAIKDGADVIDCS  380



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   402 bits (1034),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 208/385 (54%), Positives = 264/385 (69%), Gaps = 37/385 (10%)
 Frame = +1

Query  280   LLCSAVTLV---AAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
             +L S+V L+   AAQ  + +S S WQTLSGDAPLVIARGGFSGLFPDSS  AY FA  TS
Sbjct  6     VLLSSVVLIQLFAAQIDAKSSRSPWQTLSGDAPLVIARGGFSGLFPDSSSVAYKFAKQTS  65

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
                                            VA +F ++Q +Y VNGV T  WF IDF+ 
Sbjct  66    -------------------------------VADVFPNRQKSYPVNGVTTQGWFTIDFSL  94

Query  628   KQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRT  807
             + L    L +G++SRS +FDG    ILTV+DV  +++P   WLNVQHD+FY+QHNLS+ +
Sbjct  95    RDLKNAFLIRGIFSRSEKFDGNGYSILTVQDVSMQIKPESFWLNVQHDAFYAQHNLSISS  154

Query  808   FVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQN  987
             F++S SR V I+YISSPE+NF   +  R        VF+FLG +E EP+T +TYGS+L N
Sbjct  155   FLISASRTVSIDYISSPELNFFSKVKGRFGRNEPSFVFQFLGKEEFEPTTKRTYGSILSN  214

Query  988   LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDY  1167
             L  +KTFASGILVPKSYI P+D    YL P T LV DAHK GL++Y S FA+DV  A++Y
Sbjct  215   LTYVKTFASGILVPKSYILPLD-DKQYLLPPTFLVQDAHKAGLQLYVSGFANDVDIAYNY  273

Query  1168  SYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGAS  1347
             S+DPV+EYLSF+DNG +SVDGVLSDFPIT S +IDC+SH+ +  + Q+ +FLVI+ +GAS
Sbjct  274   SFDPVSEYLSFVDNGYFSVDGVLSDFPITASASIDCFSHIGRNARKQM-DFLVITKNGAS  332

Query  1348  GDYPGCTDXAYSKAVSDGVDIIDCT  1422
             GDYPGCTD AY KA+ DG D+IDC+
Sbjct  333   GDYPGCTDLAYEKAIQDGADVIDCS  357



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/372 (52%), Positives = 270/372 (73%), Gaps = 4/372 (1%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             AQ +  ++ KW TLSG+ P+V+ARGGFSGLFP+SS  A   A  T +++V+++C++QLTK
Sbjct  17    AQKAPETSPKWLTLSGEQPIVVARGGFSGLFPESSSFANQIAVSTGMSDVVVFCNLQLTK  76

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVY  666
             DG+G+C PDI++DN++ +++++   Q +Y VNG     WF +DF   +L   V L Q ++
Sbjct  77    DGIGVCLPDIRIDNSTTISSIYPKGQKSYNVNGQNLRGWFTLDFTSDELLNNVTLTQNIF  136

Query  667   SRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             SRSS FDG    I TVEDV   V+PP  WL+  +DSFY+Q+ LS   ++   ++ ++INY
Sbjct  137   SRSSLFDGQ-LPISTVEDV-TGVKPPQFWLSAPYDSFYNQNKLSPAAYIEQSAKHMIINY  194

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             +SSPE+ FLK++  ++N   TKL+F+FLG ++ EP+TNQ Y S+LQNL ++K+FASGILV
Sbjct  195   LSSPEIGFLKTMGGKVNKLKTKLIFQFLGPEQVEPTTNQKYSSILQNLTTVKSFASGILV  254

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PK YIWPV  SS YL   TSLV DAHK GLEVYAS F++DVP +++YSYDP AEY+ ++D
Sbjct  255   PKEYIWPV-SSSGYLGKPTSLVADAHKQGLEVYASGFSNDVPTSYNYSYDPTAEYIQYVD  313

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             N  +SVDGVL+DFP T S AI C++H + G K +    L+IS +GASG YPG TD AY +
Sbjct  314   NSQFSVDGVLTDFPPTASEAIACFAHNKNGDKPRKGSALIISNNGASGIYPGSTDLAYQQ  373

Query  1387  AVSDGVDIIDCT  1422
             AV DG DIIDC+
Sbjct  374   AVDDGADIIDCS  385


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 144/333 (43%), Gaps = 47/333 (14%)
 Frame = +1

Query  352   SGDAP-----LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  516
             +GD P     L+I+  G SG++P S+  AY  A        I+ C VQL+KDGV  C   
Sbjct  342   NGDKPRKGSALIISNNGASGIYPGSTDLAYQQA--VDDGADIIDCSVQLSKDGVPFCLAS  399

Query  517   IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTP  696
               L   +     F DK+ T +    P    F     + ++  +  Q      +S     P
Sbjct  400   ADLAGDTTAMMPFIDKKDT-IPEIQPEIGVFSFALTWSEIQTLKPQLVSPFANSSILRNP  458

Query  697   Q-----QILTVEDV--FNKVQP-PGLWLNVQHDSFYSQHN-----------LSMRTFVLS  819
                   + +T+ +   F K +   G+ +N+++ ++ +              L+  TF   
Sbjct  459   ANKNLGKFVTLTEFLDFAKAKAVSGILINIENAAYLASKQGLDIVGAVATALTNATFDKQ  518

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
              +++V+I    +  ++  K + +    RV ++  +    D  +PS ++           I
Sbjct  519   STQQVLIQSDDTSVLSKFKDVPTY--KRVLRIKEKI--GDAPKPSVDE-----------I  563

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYD  1176
             K +A  + VP+S I  V  S  +    T++V + H   L VY ++  ++ V  AFDY  D
Sbjct  564   KKYADAVTVPRSAIIKV--SDFFTVALTNVVKEMHAANLSVYVNELRNEYVTLAFDYFSD  621

Query  1177  PVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDC  1275
             P+ E  +++      VDG ++D+P T S  + C
Sbjct  622   PIVEIATYVQ--VVEVDGFMTDYPGTASKYMRC  652



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   401 bits (1030),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/361 (53%), Positives = 259/361 (72%), Gaps = 2/361 (1%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             ++TLSG+AP+VIA GGFSG+FPDSS NAY FA  ++  + ++WC+VQLTKDGVGIC  D+
Sbjct  46    YKTLSGNAPIVIAEGGFSGVFPDSSKNAYVFALSSTSGDTVLWCNVQLTKDGVGICLRDL  105

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ  699
              +DN ++++  ++  +  YLVNG     WFPID+    L  V L Q ++SR+ +FD    
Sbjct  106   LMDNCTSISQAYRAGKKAYLVNGEEKKGWFPIDYTMSSLQSVILTQAIWSRTDKFDFAFL  165

Query  700   QILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKS  879
              IL V +V +  +P  +WLN++HD FY QH L+M  ++LS+ +   + YISSPE+ FL+S
Sbjct  166   PILPVTNVIDLAKPSSVWLNIEHDIFYRQHGLNMTKYILSIPKGGSVQYISSPELGFLQS  225

Query  880   IASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKS  1059
             I+ R+N R TKLVFRFL    ++PS+NQTYGSLL NL  IKT ASGI+VPK YIWPV  +
Sbjct  226   ISGRVN-RKTKLVFRFLDATSSDPSSNQTYGSLLSNLTFIKTVASGIMVPKEYIWPV-TT  283

Query  1060  SSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLS  1239
             ++Y+QP  S+V DAH  GLE+YASDFA+D    ++YSYDP+ EYL F+ + N+SVDGVLS
Sbjct  284   NNYIQPAKSIVRDAHSAGLEIYASDFANDRIIPYNYSYDPLEEYLHFVGSDNFSVDGVLS  343

Query  1240  DFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             +FP+T + AI C++++    K      L+IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  344   EFPLTAAAAIGCFTNLNVSSKTDHGSPLIISHNGASGDYPDCTDLAYQKAVDDGADVIDC  403

Query  1420  T  1422
             +
Sbjct  404   S  404



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   398 bits (1022),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/386 (53%), Positives = 265/386 (69%), Gaps = 6/386 (2%)
 Frame = +1

Query  268   FNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTS  447
              N+LL    V L  A  +  S +KWQTLSG+AP VIARGGFSGLFP+SS  AY FA  TS
Sbjct  3     LNVLLFI--VLLHGAAAAVVSPTKWQTLSGNAPAVIARGGFSGLFPESSQFAYQFAQSTS  60

Query  448   LTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNF  627
             L NV+++CD+QLTKDG GIC  D++LDN++ ++ +F   ++TY VNG P   WF IDF  
Sbjct  61    LKNVVLYCDLQLTKDGAGICHSDLRLDNSTTISAVFPKGRTTYSVNGRPVQGWFSIDFTS  120

Query  628   KQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
              QL   V L Q ++SR S FDG    +  VEDV   + P  LW+NVQ+ +F+ +H+L   
Sbjct  121   DQLYNNVTLIQSIFSRPSVFDGN-LPVSMVEDVAG-LHPYQLWVNVQYSTFFKEHDLDAV  178

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
              ++ SVSR  +I+ ISSPE+ FLKS++       TKL+FRF+  D+ EPST +TY +LL 
Sbjct  179   DYIRSVSRETIIDCISSPEIGFLKSLSGLPGRHKTKLIFRFMEVDDVEPSTKKTYQALLN  238

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             +L +IK+FASGILVPKSYIWPV+K   YL+  TSLV DAH VGLEVYA DFA+D P +++
Sbjct  239   DLVTIKSFASGILVPKSYIWPVNK-DQYLEAHTSLVTDAHGVGLEVYAYDFANDAPASYN  297

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YSYDP  EYL FI N N+SVDGVL+DFP T S A+ C +H            L+I+ +GA
Sbjct  298   YSYDPTVEYLQFISNSNFSVDGVLTDFPSTASEAVACLAHNENKPIPTEGRPLIITHNGA  357

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             SG + GCTD AY +AV DG D++DC+
Sbjct  358   SGMFAGCTDVAYQRAVEDGADVLDCS  383



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   397 bits (1019),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 200/372 (54%), Positives = 271/372 (73%), Gaps = 5/372 (1%)
 Frame = +1

Query  310   AQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTK  489
             AQG     S ++TL+GD PLVIA+GGFSG+FPDSS +A++FA L S  +  +WCDVQLTK
Sbjct  42    AQG-IRRPSSYKTLTGDVPLVIAKGGFSGVFPDSSQDAFAFALLASAPDTSLWCDVQLTK  100

Query  490   DGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYS  669
             DGVGIC PDI + N +++A ++  ++S Y+V+G P T WFP+DFNF +   V L Q ++S
Sbjct  101   DGVGICLPDINMQNCTDIAQVYSARKSKYVVHGAPKTGWFPVDFNFSEFQGVILTQRIWS  160

Query  670   RSSRFDGTPQQILTVEDVFNKVQP-PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINY  846
             R+ +FD     IL V D+ +   P P +WLNVQHD FY +H L+MR+++LS+ +R+ + Y
Sbjct  161   RTDKFDYVQYGILAVTDLQSIATPAPSVWLNVQHDIFYREHGLNMRSYILSILKRMSVKY  220

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
             ISSPE+ FL+SI+ R+  + TKLVFRF     T+PSTN+TY S+L NLA IK  ASGI+V
Sbjct  221   ISSPELGFLQSISGRVGGK-TKLVFRFPETPLTDPSTNKTYRSMLSNLALIKATASGIMV  279

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFID  1206
             PKSYIWPV  + +YL P TS+V +AH  GLE+YASDFA+D    ++YSYDP+ EYLSFI 
Sbjct  280   PKSYIWPV-TNDNYLLPPTSIVRNAHNAGLEIYASDFANDRIIPYNYSYDPLQEYLSFIS  338

Query  1207  NGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSK  1386
             +G++SVDGVL+++PIT S AI C++ +     +   + L+IS +GASGDYP CTD AY  
Sbjct  339   DGDFSVDGVLTEYPITASEAIGCFTTLNASTADH-GKPLIISHNGASGDYPDCTDLAYQY  397

Query  1387  AVSDGVDIIDCT  1422
             A+ DG D+IDCT
Sbjct  398   AIKDGADMIDCT  409



>ref|XP_004979884.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=1128

 Score =   405 bits (1041),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 197/385 (51%), Positives = 267/385 (69%), Gaps = 9/385 (2%)
 Frame = +1

Query  280   LLCSAVTLVAAQGSTNSTSKW-----QTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             LLC    +V A G+  +   W     +TLSGDAP V+A+GGFSG+FPDSS +AYSF  + 
Sbjct  19    LLCCGCVMVLA-GAAAAQGPWLPYAYKTLSGDAPRVVAKGGFSGVFPDSSSDAYSFTLMA  77

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             S     +WCDVQLTKDGVG+C  DI +DN +NVA  +  ++ TY+++GV    WF +DF 
Sbjct  78    SAAGTTLWCDVQLTKDGVGVCLRDINMDNCTNVAQAYPARKRTYVIDGVRKNGWFALDFT  137

Query  625   FKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMR  804
               +L  V L Q ++SR+  FD     IL+V D+ + V+ P +WLNVQHD+FY +H L+MR
Sbjct  138   KDELQSVILTQAIWSRTYSFDSVGYSILSVTDLLSIVKQPSVWLNVQHDTFYKEHGLNMR  197

Query  805   TFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQ  984
              ++ S+ +RV ++YISSPE+ FL++I+  +  + TKLVF FL     + S N+TYGSLL 
Sbjct  198   NYIFSIQKRVSVDYISSPELGFLQNISGTVRGK-TKLVFSFLDKSLLDHSINRTYGSLLS  256

Query  985   NLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFD  1164
             NL  IK+ A GI+VPK+YIWPV K  +YLQP+TS+V +AH  GLE+YASDFA+D    ++
Sbjct  257   NLTLIKSIAFGIMVPKTYIWPVTK-DNYLQPSTSIVAEAHNAGLEIYASDFANDRIIPYN  315

Query  1165  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGA  1344
             YSYDP+AEYL+FI +G +SVDGVLS+ P T S AI C + +   + +   E LVIS +GA
Sbjct  316   YSYDPLAEYLNFISDGGFSVDGVLSEHPFTASEAIGCLASLNSSKTDH-GEPLVISHNGA  374

Query  1345  SGDYPGCTDXAYSKAVSDGVDIIDC  1419
             SGDYP CTD AY  A++DG D+IDC
Sbjct  375   SGDYPDCTDLAYHSAINDGADVIDC  399



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   396 bits (1018),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 267/369 (72%), Gaps = 5/369 (1%)
 Frame = +1

Query  313   QGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKD  492
             QG    T+ ++TL GDAPLVIA+GGFSG+FPDSS  A++FA L S  +  +WCDVQLTKD
Sbjct  38    QGIRRPTA-YKTLRGDAPLVIAQGGFSGVFPDSSQAAFAFALLASAPDTSVWCDVQLTKD  96

Query  493   GVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSR  672
             GVG+C  DI + N +N A ++  K+  Y+++GVP T +F +DFN+ ++    L QG YSR
Sbjct  97    GVGVCLRDINMANCTNAALVYPAKKKKYVIDGVPKTGYFSLDFNYSEVQTTYLTQGFYSR  156

Query  673   SSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYIS  852
             + RFD     I +V D+ + ++PP +WLNVQ D FY+QH L+MR +++S+ + V + YIS
Sbjct  157   TDRFDSI-YTIFSVTDLQSYIKPPSVWLNVQRDIFYTQHGLNMRRYIVSILKSVSVKYIS  215

Query  853   SPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPK  1032
             SPE+ FLKSI+ R+  R TKLVFRF  N  ++PS NQTY  L +NL  IKT ASGI+VPK
Sbjct  216   SPELGFLKSISKRVGSR-TKLVFRFPDNFMSDPSINQTYSLLSKNLTFIKTIASGIMVPK  274

Query  1033  SYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNG  1212
             SYIWPV  + +YLQP TS V DAH  GLE+YASDFA+D    ++YSYDP+ EYLSFI +G
Sbjct  275   SYIWPV-TNDNYLQPPTSFVQDAHSAGLEIYASDFANDRIIPYNYSYDPLQEYLSFISDG  333

Query  1213  NYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAV  1392
              +SVDGVL+D+PIT S AI C++H+ + + +   + L+IS +GASGDYP CTD AY  A+
Sbjct  334   GFSVDGVLTDYPITASEAIGCFTHLNESKADH-GKPLIISHNGASGDYPDCTDLAYLNAI  392

Query  1393  SDGVDIIDC  1419
              DG D+IDC
Sbjct  393   KDGADVIDC  401



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   391 bits (1004),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 257/362 (71%), Gaps = 4/362 (1%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48    WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTP  696
             +LDN++ ++T+F  + +TY VNG     WF +DF   +L + V   Q ++SR S FDG  
Sbjct  108   RLDNSTTISTVFPKRDATYSVNGQSLKGWFSLDFTMDELISNVTTIQNIFSRPSLFDGN-  166

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               + +V+D+ +   P   WLN+Q+  FY +H L    F+L+   ++  +YISSPE++FLK
Sbjct  167   LPVSSVQDI-SGFHPSRFWLNLQYGMFYKEHKLDPAKFILTALEKMDFDYISSPEIDFLK  225

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             S+  ++    TKL+FRF   +E EPSTNQTY S+L+NLA+IK+FASGILVPKSYIWPV K
Sbjct  226   SLNGKLGQAKTKLIFRFQDEEEVEPSTNQTYSSILKNLATIKSFASGILVPKSYIWPVSK  285

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
                YL+  T+LV DAHK+GLEV+A +FA+D P +++YS+DP AEYL FID+ N+SVDGVL
Sbjct  286   DM-YLESATTLVTDAHKLGLEVHAYNFANDQPVSYNYSFDPTAEYLQFIDHSNFSVDGVL  344

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  1416
             +DFP T S A+ C +H +    +     L+I+ +GASG + GCTD AY +AV DG DIID
Sbjct  345   TDFPSTASAAVACLAHNKDSAASNKKRSLIITRNGASGVFAGCTDLAYQQAVKDGADIID  404

Query  1417  CT  1422
             C+
Sbjct  405   CS  406



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   395 bits (1015),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 257/362 (71%), Gaps = 4/362 (1%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W+TLSG+APLVIARGG+SG+FP+SS  AY FA  TSL   ++ CD+QL+KDG GIC  ++
Sbjct  36    WKTLSGNAPLVIARGGYSGIFPESSQFAYQFALATSLKETVLLCDLQLSKDGAGICHSNL  95

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDGTP  696
             KLDN++ ++T F  + +TY VNG     WF +DF   +L   V   Q ++SR S FDG  
Sbjct  96    KLDNSTTISTAFPKRDTTYSVNGQSLHGWFSVDFTSDELLGNVTTIQNIFSRPSIFDGN-  154

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               +  V+D+     P   WLNVQ+D FY +H L    FVL+ S +VV +YISSP + FLK
Sbjct  155   LPLSMVQDI-TGFHPSQFWLNVQYDMFYKEHKLDPAKFVLTASEKVVFDYISSPGIGFLK  213

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             S++ ++    TKL+FRFL  D  EPSTNQTY S+L+NL++IK+FASGILVPKSYIWPV+K
Sbjct  214   SLSGKLGKAKTKLIFRFLDADAVEPSTNQTYSSILKNLSTIKSFASGILVPKSYIWPVNK  273

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
              + YL+P+T+LV DAH +GLEVYAS+FA+D P +++YS+DP AEYL F DN N+SVDGV 
Sbjct  274   DN-YLEPSTTLVTDAHNLGLEVYASNFANDQPASYNYSFDPTAEYLQFTDNPNFSVDGVF  332

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  1416
             +DFP T S AI C +H +     +    L+I+ +GASG + GCTD AY +AV DG DIID
Sbjct  333   TDFPSTASAAIACLAHNKDNAAAKKKRPLIITRNGASGVFAGCTDLAYQQAVKDGADIID  392

Query  1417  CT  1422
             C+
Sbjct  393   CS  394



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   393 bits (1009),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/381 (54%), Positives = 264/381 (69%), Gaps = 10/381 (3%)
 Frame = +1

Query  295   VTLVAAQG--STNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMW  468
             + L+ AQ   +  +   W TL+G+ P VIARGGFSGLFPDSS  AY F G  SL + I++
Sbjct  12    IGLITAQKPPANPAPPSWLTLNGERPAVIARGGFSGLFPDSSRFAYDFVGQVSLPDSILY  71

Query  469   CDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN  648
             CD+QLTKDGVG C  ++KLDN++N+A LF   Q +Y VNG     WF ID+    L L N
Sbjct  72    CDLQLTKDGVGFCQSELKLDNSTNIALLFPKGQKSYNVNGKDVRGWFAIDYLADAL-LPN  130

Query  649   L--QQGVYSRSSRFDGTPQQILTVEDVFNKVQPPG-LWLNVQHDSFYSQHNLSMRTFVLS  819
             L   Q V +R + FDG P  +L VEDV +  +PP  +WLNVQ+D FY+   +S   ++  
Sbjct  131   LTSAQNVLTRPNAFDGQP--LLLVEDVTSISKPPPRVWLNVQYDLFYNLQKISPALYLED  188

Query  820   VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASI  999
             + R   INYISSPE+ FLKSIA++++   TKLV RFL  +  EP+T Q YG +L+NLA+I
Sbjct  189   L-RFAGINYISSPEIGFLKSIAAKVDKVRTKLVLRFLEPEAVEPTTKQAYGEILKNLAAI  247

Query  1000  KTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDP  1179
             K +ASGILVPK+YIWP++K   YL P T+LV DAHK GLEVYAS FA+D P +F+YSYDP
Sbjct  248   KPYASGILVPKTYIWPINKEM-YLMPPTTLVNDAHKEGLEVYASGFANDSPGSFNYSYDP  306

Query  1180  VAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYP  1359
              AEYL FIDNG +SVDGVL+DF  T S AI C +H +   + Q    L+IS +GASGDY 
Sbjct  307   TAEYLQFIDNGQFSVDGVLTDFAPTASEAIACLAHNKNASRPQKGHPLIISHNGASGDYT  366

Query  1360  GCTDXAYSKAVSDGVDIIDCT  1422
             GCTD AY KAV+DG D+IDC+
Sbjct  367   GCTDLAYDKAVTDGADVIDCS  387



>ref|XP_006829998.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Amborella 
trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score =   393 bits (1009),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 263/364 (72%), Gaps = 4/364 (1%)
 Frame = +1

Query  337   KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  516
             KW TLSG+AP VIARGGFSGLFP+SS  A SFA   SL+NV++ C++QLTKDG GIC  D
Sbjct  28    KWATLSGNAPEVIARGGFSGLFPESSDFANSFALSVSLSNVVLLCELQLTKDGRGICRSD  87

Query  517   IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGT  693
             ++LDN++N+A ++   + TY+VNG P   WF IDF  +QL   V L Q ++SR S FD  
Sbjct  88    LRLDNSTNIADVYPHNKKTYIVNGKPLQGWFAIDFLERQLFNKVTLIQNIFSRPSIFDNV  147

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                I  VEDV     PP  WL+VQ+D+FY+Q+ L M ++V+S+S+  ++ ++SSPEV  L
Sbjct  148   -LPIAAVEDVQRMRPPPRFWLSVQYDTFYTQNKLDMASYVISLSKTSILEFVSSPEVGLL  206

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             K+I  ++    TKL+F+FL  ++ EPST +TY SLL+NL+SIK FASG+LVPK+YIW V+
Sbjct  207   KNINGKLKGGKTKLIFQFLKPEDIEPSTKKTYASLLENLSSIKAFASGVLVPKNYIWAVN  266

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              S  YL+  T+LV DAHKVGLEVYAS FA+D P +++YSYDPVAEYL FID  ++SVDGV
Sbjct  267   -SDLYLKSPTTLVKDAHKVGLEVYASGFANDFPASYNYSYDPVAEYLQFIDKSDFSVDGV  325

Query  1234  LSDFPITPSGAIDCYSHMRK-GQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDI  1410
             L+DFP T S A+ C +   K    + + + L+I+ +GASG Y GCTD AY +AV DG DI
Sbjct  326   LTDFPSTASEAVGCLARSEKSATPSALEKPLIITHNGASGVYAGCTDLAYKQAVKDGADI  385

Query  1411  IDCT  1422
             IDC+
Sbjct  386   IDCS  389



>ref|XP_010443532.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=546

 Score =   385 bits (990),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 254/363 (70%), Gaps = 6/363 (2%)
 Frame = +1

Query  337   KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  516
             KW TL+G  P V+ARGGFSGLFP+SS  A   A  TS   + M C++Q+TKDGVG+C  D
Sbjct  32    KWLTLNGLEPAVVARGGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMTKDGVGLCLSD  91

Query  517   IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGT  693
             I+LDNA+ ++TLF   Q TY VNG     WF ID++ + + + V+L Q ++SR S FDG 
Sbjct  92    IRLDNATTISTLFPKAQKTYKVNGQDLKGWFVIDYDAETIFSNVSLIQNIFSRPSIFDGQ  151

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                +  VEDV    +PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FL
Sbjct  152   -MPVSAVEDVLG-TKPPKFWLSVQYDAFYMEHKLSAAEYLRSLQFR-GINVISSPEIGFL  208

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             KSI        TKL+F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD
Sbjct  209   KSIGMDAGRAKTKLIFEFKDPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD  268

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              ++ YL+P T+ V DAHK GLEVYAS FA+D+  +F+YS+DP AEYL F+DNG +SVDG+
Sbjct  269   -TAKYLKPATTFVADAHKAGLEVYASGFANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGI  327

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             ++DFP T S AI C+SH +KG   +V   LVIS +GASGDYPGCTD AY KAV+DG D+I
Sbjct  328   ITDFPPTASQAITCFSH-QKGNLPKVGNALVISHNGASGDYPGCTDLAYEKAVNDGADVI  386

Query  1414  DCT  1422
             DC+
Sbjct  387   DCS  389



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   391 bits (1004),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 257/362 (71%), Gaps = 4/362 (1%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W+TLSG+APLVIARGGFSG+FP+SS  AY FA  TSL   ++ CD+QLTKDG GIC  D+
Sbjct  48    WKTLSGNAPLVIARGGFSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGAGICRSDL  107

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTP  696
             +LDN++ ++T+F  + +TY VNG     WF +DF   +L + V   Q ++SR S FDG  
Sbjct  108   RLDNSTTISTVFPKRDATYSVNGQSLKGWFSLDFTMDELISNVTTIQNIFSRPSLFDGN-  166

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               + +V+D+ +   P   WLN+Q+  FY +H L    F+L+   ++  +YISSPE++FLK
Sbjct  167   LPVSSVQDI-SGFHPSRFWLNLQYGMFYKEHKLDPAKFILTALEKMDFDYISSPEIDFLK  225

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             S+  ++    TKL+FRF   +E EPSTNQTY S+L+NLA+IK+FASGILVPKSYIWPV K
Sbjct  226   SLNGKLGQAKTKLIFRFQDEEEVEPSTNQTYSSILKNLATIKSFASGILVPKSYIWPVSK  285

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
                YL+  T+LV DAHK+GLEV+A +FA+D P +++YS+DP AEYL FID+ N+SVDGVL
Sbjct  286   DM-YLESATTLVTDAHKLGLEVHAYNFANDQPVSYNYSFDPTAEYLQFIDHSNFSVDGVL  344

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  1416
             +DFP T S A+ C +H +    +     L+I+ +GASG + GCTD AY +AV DG DIID
Sbjct  345   TDFPSTASAAVACLAHNKDSAASNKKRSLIITRNGASGVFAGCTDLAYQQAVKDGADIID  404

Query  1417  CT  1422
             C+
Sbjct  405   CS  406



>ref|XP_010485211.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=431

 Score =   380 bits (975),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 252/362 (70%), Gaps = 6/362 (2%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W TL+G  P V+ARGGFSGLFP+SS  A   A  TS   + M C++Q++KDGVG+C  DI
Sbjct  33    WLTLTGQEPAVVARGGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMSKDGVGLCLSDI  92

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTP  696
             +LDNA+ ++TLF   Q TY VNG     WF +D++   + + V+L Q ++SR S FDG  
Sbjct  93    RLDNATTISTLFPKAQKTYKVNGQDLKGWFVLDYDADTIFSNVSLVQNIFSRPSIFDGQ-  151

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               +  VEDV    +PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FLK
Sbjct  152   MPVSAVEDVLG-TKPPKFWLSVQYDAFYMEHKLSAAEYLRSLRFR-GINVISSPEIGFLK  209

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             SI        TKL+F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD 
Sbjct  210   SIGMDAGRAKTKLIFEFKDPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-  268

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
             ++ YL+P T+ V DAHK GLEVYAS FA+D+  +F+YS+DP AEYL F+DNG +SVDG++
Sbjct  269   TAKYLKPATTFVADAHKAGLEVYASGFANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGII  328

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  1416
             +DFP T S AI C+SH +KG   +V   LVI+ +GASGDYPGCTD AY KAV+DG D+ID
Sbjct  329   TDFPPTASQAITCFSH-QKGNLPKVGNALVITHNGASGDYPGCTDLAYEKAVNDGADVID  387

Query  1417  CT  1422
             C+
Sbjct  388   CS  389



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 264/393 (67%), Gaps = 17/393 (4%)
 Frame = +1

Query  247   MWKLRSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             M++    F+LL+  S     +    T+S +KW+TL+GD P+VIARGGFSG+FPDSS  A 
Sbjct  1     MFRCLLFFSLLIHSSLAQKSSGGSGTSSPTKWKTLNGDKPVVIARGGFSGIFPDSSEFAV  60

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
               A  +S+ +V+++CD+QLTKDG+GIC PDIKLDN +++A +F   + TY VNG     W
Sbjct  61    DMATTSSMGDVVLYCDLQLTKDGIGICQPDIKLDNTTDIAMVFPKGEKTYTVNGQDLKGW  120

Query  607   FPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             F +D+   +L   V L Q V SR S FDG    +  V+D+  +     LWLNVQ+D FY+
Sbjct  121   FAVDYTSDELFNNVTLVQNVLSRPSLFDGA-MSVQAVDDIVGRKTVNLLWLNVQYDGFYN  179

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             +H  S  T+V  V R   ++Y+SSPE+ FLK++  ++N   TKL+FRFL  D  EPSTNQ
Sbjct  180   EHKHSPATYVQKVVRYYPVDYLSSPEIGFLKAMKGKVNKARTKLIFRFLAEDAVEPSTNQ  239

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
             TYGS+L+NL SIK FASGILVPK YI+PV  +  YL   TSLV DAHK GLEVYAS FA+
Sbjct  240   TYGSILKNLESIKAFASGILVPKEYIYPV-GTDKYLGAPTSLVADAHKQGLEVYASGFAN  298

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D P +F+YSYDP +EYL FIDN  +SVDG+L+DFP T S  I               + L
Sbjct  299   DNPASFNYSYDPTSEYLQFIDNSEFSVDGLLTDFPPTASETIG--------------KAL  344

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +IS +GASG+YPGCTD AY +A+ DG DIIDC+
Sbjct  345   IISHNGASGNYPGCTDLAYQQAIDDGSDIIDCS  377


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 69/317 (22%), Positives = 132/317 (42%), Gaps = 43/317 (14%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             L+I+  G SG +P  +  AY  A      + I+ C VQ++KDGV  C     L   +   
Sbjct  344   LIISHNGASGNYPGCTDLAYQQA--IDDGSDIIDCSVQMSKDGVAFCLDSADLSGDTTAM  401

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQ-GVYSRSSRFDGTPQ-----QIL  708
               F   QST +      +  F  D  + ++  +  Q    +   + F   P      + +
Sbjct  402   PTFM-SQSTVIPEIQQNSGIFSFDLTWSEIQSLKPQLVSPFGSDAGFQRNPANKNKGKFV  460

Query  709   TVEDVFNKVQPP---GLWLNVQHDSFYSQHN-----------LSMRTFVLSVSRRVVINY  846
             T+ +     +     G+ +N+++ ++ +              LS  T     +++V+I  
Sbjct  461   TLSEFLELAKSKAVSGVLINIENAAYLASKKGLGIVDTVSKALSNATLDKQSTQQVLIQS  520

Query  847   ISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILV  1026
               S  ++  K++++       K V          P          Q +  IK +A  + V
Sbjct  521   DDSSVLSQFKNVSTY------KRVLTIEEKISDAPK---------QPVEEIKKYADAVTV  565

Query  1027  PKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFI  1203
              +  I P+  S S+L   TS++ + H   + VY S   ++ +  AFDY  DP+ E  +++
Sbjct  566   TRPTIMPI--SESFLLSNTSVIDEMHAANISVYVSVLRNEYISLAFDYFADPILELATYV  623

Query  1204  DNGNYSVDGVLSDFPIT  1254
                 + VDG+++++P T
Sbjct  624   --AGFGVDGIITEYPAT  638



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   388 bits (996),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 263/394 (67%), Gaps = 7/394 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLL-LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M +    F+L + LC A     A  +   T KW TL+G  P V+ARGGFSGLFP+SS  A
Sbjct  1     MLRFIIFFSLFIHLCVAAPKTPASAAAVPTKKWLTLNGQEPAVVARGGFSGLFPESSAPA  60

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
                A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ +++LF   Q TY VNG     
Sbjct  61    NDMAISTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISSLFPKAQKTYKVNGQDLKG  120

Query  604   WFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFY  780
             WF +D++   + + V+L Q ++SR S FDG    +  VEDV    +PP  WL+VQ+D+FY
Sbjct  121   WFVLDYDADTIFSNVSLVQNIFSRPSIFDGQ-MPVSAVEDVLG-TKPPKFWLSVQYDAFY  178

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
              +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+TN
Sbjct  179   MEHKLSAAEYLRSLRFR-GINVISSPEIGFLKSIGMDAGRAKTKLIFEFKEPEAIEPTTN  237

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             + Y  L QNLA+IK FASG+LVPK YIWP+D S++YL+P T+ V DAHK GLEVYAS FA
Sbjct  238   KKYSELQQNLAAIKAFASGVLVPKDYIWPLD-SANYLKPATTFVADAHKAGLEVYASGFA  296

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +D+  +F+YSYDP AEYL F+DNG +SVDGV++DFP T S +I C SH +KG   +    
Sbjct  297   NDMRTSFNYSYDPSAEYLQFVDNGQFSVDGVITDFPPTASQSITCLSH-QKGNLPKAGHA  355

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             LVI+ +GASGDYPGCTD AY KAV +G D+IDC+
Sbjct  356   LVITHNGASGDYPGCTDLAYQKAVDEGADVIDCS  389


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/313 (25%), Positives = 137/313 (44%), Gaps = 36/313 (12%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI   G SG +P  +  AY  A +    +VI  C VQ++KDG+  C     L  ++   
Sbjct  356   LVITHNGASGDYPGCTDLAYQKA-VDEGADVID-CSVQMSKDGIAFCHDAADLTASTTAM  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ-----QILT  711
             T F  + +T +    PT   F  D  + ++  V  Q      ++ F   P      + +T
Sbjct  414   TTFMSR-ATSVPEIQPTNGIFSFDLTWAEIQSVKPQIESPFTATGFQRNPANKNAGKFIT  472

Query  712   VEDV--FNKVQP-PGLWLNVQHDSFY-SQHNLSMRTFVLSVSRRVVIN-------YISSP  858
             + +   F+K +   G+ +N+++ ++  S+  L +   V S   +  ++        I S 
Sbjct  473   LAEFLDFSKAKAVAGVLINIENAAYLASKKGLGVVDAVKSALAKSTLDKQSTQKVLIQSD  532

Query  859   EVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSY  1038
             + + L S  + + P    L          +PS ++           IK +A  + + ++ 
Sbjct  533   DTSVLASFEA-VPPYTRVLSIEKEIGGAPKPSVDE-----------IKKYADAVNLMRTS  580

Query  1039  IWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGN  1215
             +  V  S S+    T++V + HK  + VY S   ++ +  AFDY  DP  E  +FI    
Sbjct  581   L--VTVSQSFATGKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVELATFI--AG  636

Query  1216  YSVDGVLSDFPIT  1254
               VDGV+++FP T
Sbjct  637   SGVDGVITEFPAT  649



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   387 bits (993),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/363 (54%), Positives = 254/363 (70%), Gaps = 6/363 (2%)
 Frame = +1

Query  337   KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  516
             KW TL+G  P V+ARGGFSGLFP+SS  A   A  TS   + M C++Q+TKDGVG+C  D
Sbjct  32    KWLTLNGLEPAVVARGGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMTKDGVGLCLSD  91

Query  517   IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGT  693
             I+LDNA+ ++TLF   Q TY VNG     WF ID++ + + + V+L Q ++SR S FDG 
Sbjct  92    IRLDNATTISTLFAKAQKTYKVNGQDLKGWFVIDYDAETIFSNVSLIQNIFSRPSIFDGQ  151

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                +  VEDV    +PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FL
Sbjct  152   -MPVSAVEDVLG-TKPPKFWLSVQYDAFYMEHKLSAAEYLRSLQFR-GINVISSPEIGFL  208

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             KSI        TKL+F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWPVD
Sbjct  209   KSIGMDAGRAKTKLIFEFKEPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPVD  268

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              ++ YL+P T+ V DAHK GLEVYAS FA+D+  +F+YS+DP AEYL F+DNG +SVDG+
Sbjct  269   -TAKYLKPATTFVADAHKAGLEVYASGFANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGI  327

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             ++DFP T S AI C+SH +KG   ++   LVI+ +GASGDYPGCTD AY KAVSDG D+I
Sbjct  328   ITDFPPTASQAISCFSH-QKGNLPKIGNALVITHNGASGDYPGCTDLAYEKAVSDGADVI  386

Query  1414  DCT  1422
             DC+
Sbjct  387   DCS  389


 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 81/316 (26%), Positives = 137/316 (43%), Gaps = 42/316 (13%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI   G SG +P  +  AY  A   S    ++ C VQ++KDG+  C     L  ++   
Sbjct  356   LVITHNGASGDYPGCTDLAYEKA--VSDGADVIDCSVQMSKDGIAFCHDSADLTASTTAM  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQQ-------I  705
             T F  + +T +    PT   F  D  + ++  V  Q G    S+ F   P          
Sbjct  414   TTFMSR-ATSVPEVQPTNGIFSFDLTWAEIQSVKPQIGNPFTSTGFVRNPANKNVGKFTT  472

Query  706   LTVEDVFNKVQP-PGLWLNVQHDSFYSQHN-----------LSMRTFVLSVSRRVVINYI  849
             LT    F+K +  PG+ +N+++ ++ +              L+  T     ++RV+I   
Sbjct  473   LTEFLEFSKAKKVPGVMINIENAAYLASKKGLGVVDAVKSALANSTLDKQSTQRVLIQ--  530

Query  850   SSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVP  1029
              S + + L S  + + P    L       D  +PS ++           IK  A  + + 
Sbjct  531   -SDDSSVLASFEA-VPPYTRVLSIDKEIGDAPKPSIDE-----------IKKHADAVNLK  577

Query  1030  KSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFID  1206
             ++ ++ V  S S++   T++V + HK  + VY S   ++ +  AFDY  DP  E  +FI 
Sbjct  578   RTSLFTV--SQSFVTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTVELATFI-  634

Query  1207  NGNYSVDGVLSDFPIT  1254
                  VDGV+++FP T
Sbjct  635   -AGSGVDGVITEFPAT  649



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   387 bits (993),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 262/394 (66%), Gaps = 7/394 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M +   IF+L +  C       A        KW TLSG  P V+ARGGFSGLFP+SS  A
Sbjct  1     MLRFIIIFSLFIHSCVGAPRTPAAAVAVPGKKWLTLSGQEPAVVARGGFSGLFPESSAPA  60

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
                A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ ++TLF   Q TY VNG     
Sbjct  61    NDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISTLFPKAQKTYKVNGQDLKG  120

Query  604   WFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFY  780
             WF ID++ + + + V+L Q ++SR S FDG    +  VEDV    +PP  WL+VQ+D+FY
Sbjct  121   WFVIDYDAETIFSNVSLIQNIFSRPSIFDGQ-MPVSAVEDVLG-TKPPKFWLSVQYDAFY  178

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
              +H LS   ++ S+  R  I+ ISSPE+ FLKSI        TKL+F F   +  EP+TN
Sbjct  179   MEHKLSAAEYLRSLQFR-GISVISSPEIGFLKSIGMDAGRAKTKLIFEFKNPEAIEPTTN  237

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             + Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS FA
Sbjct  238   KKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGFA  296

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH +KG   +V   
Sbjct  297   NDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCFSH-QKGNLPKVGNA  355

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             LV + +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  356   LVTTHNGASGDYPGCTDLAYEKAVNDGADVIDCS  389


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 79/308 (26%), Positives = 141/308 (46%), Gaps = 26/308 (8%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LV    G SG +P  +  AY  A +    +VI  C VQ++KDG+  C     L  ++   
Sbjct  356   LVTTHNGASGDYPGCTDLAYEKA-VNDGADVID-CSVQMSKDGIAFCHDSADLTASTTAM  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ-----QILT  711
             T F  + +T +    PT   F  D  + ++  V  Q G    S+ F   P      +  T
Sbjct  414   TTFMSR-ATSVPEVQPTNGIFSFDLTWAEIQSVKPQIGNPFTSTGFLRNPANKNVGKFTT  472

Query  712   VEDV--FNKVQP-PGLWLNVQHDSFY-SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKS  879
             + +   F+K +  PG+ +N+++ ++  S+  L +   V S      ++  S+ +V  ++S
Sbjct  473   LAEFLEFSKAKAVPGVLINIENAAYLASKKGLGVIDAVKSALTNSTLDKQSTQKV-LIQS  531

Query  880   IASRINPRVTKL--VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
               S +      +    R L  D+      +  G+   ++  IK  A  + + ++ ++ V 
Sbjct  532   DDSSVLASFEAVPPYTRVLSIDK------EIGGAPKPSVDEIKKHAEAVNLKRTSLFTV-  584

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
              S S++   T++V + HK  + VY S   ++ +  AFDY  DP  E  +FI      VDG
Sbjct  585   -SQSFVTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTVELATFI--AGSGVDG  641

Query  1231  VLSDFPIT  1254
             V+++FP T
Sbjct  642   VITEFPAT  649



>emb|CDY11831.1| BnaC03g12570D [Brassica napus]
Length=566

 Score =   380 bits (977),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 203/393 (52%), Positives = 267/393 (68%), Gaps = 9/393 (2%)
 Frame = +1

Query  256   LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             LRS  IF+L L  C A     A  +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2     LRSFIIFSLFLHSCVAAPKTPAAVAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62    AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  607   FPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             F +D++   + + V+L Q ++SR S FDG    I  VEDV    +PP  WL+VQ+DSFY 
Sbjct  122   FALDYSADTIFSNVSLVQNIFSRPSIFDGQ-MPISAVEDVLG-TKPPKFWLSVQYDSFYM  179

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             +H LS   ++ ++  R  I +ISSPE+ FLKSI        TKL+F F   +  EP+TN+
Sbjct  180   EHKLSAAEYLKTLRFR-GITFISSPEIAFLKSIGMDAGMSKTKLIFEFKDPEAIEPTTNK  238

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
              Y  +L +LA+IK FASG+LVPK YIWP+D S++YL+P ++ V DAHK GLEVYAS FA+
Sbjct  239   KYSEILLDLAAIKAFASGVLVPKDYIWPLD-SANYLKPASTFVADAHKAGLEVYASGFAN  297

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D+  +F+YSYDP AEYL F+DNG +SVDG ++DFP T S AI C SH ++G   +    L
Sbjct  298   DLRTSFNYSYDPSAEYLQFVDNGQFSVDGFITDFPPTASQAISCLSH-QQGNLPKANHAL  356

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             VI+ +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  357   VITHNGASGDYPGCTDMAYQKAVNDGADVIDCS  389



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   386 bits (991),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 264/394 (67%), Gaps = 7/394 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M +   +F+LLL  C A     +  +     KW TL+G  P V+ARGGFSGLFP+SS +A
Sbjct  1     MLRFFILFSLLLHSCVAAPKKPSAAAAVPAKKWLTLNGQEPAVVARGGFSGLFPESSASA  60

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
                A  TS   + M C++Q+TKDGVG+C  DI LDNA+ ++TLF   Q TY VNG     
Sbjct  61    NDLAISTSSPGLTMLCNLQMTKDGVGLCLSDITLDNATTISTLFPKAQKTYKVNGQDLKG  120

Query  604   WFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFY  780
             WF +D++   + + V+L Q ++SR S FDG    +  VEDV    +PP  WL+VQ+DSFY
Sbjct  121   WFVLDYSADTIFSNVSLVQNIFSRPSIFDGQ-MPVSAVEDVLG-AKPPKFWLSVQYDSFY  178

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
              +H LS   ++ S+  R  IN+ISSPE+ FLKSI        TKL+F F   +  EP+TN
Sbjct  179   MEHKLSTAEYLRSLGLR-GINFISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAIEPTTN  237

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             + Y  L QNLA+IK FASGILVPK YIWP+D S+ Y++P +++V DAHK GLE+YAS FA
Sbjct  238   KKYSELQQNLAAIKAFASGILVPKDYIWPID-SAKYIKPASTIVADAHKAGLEIYASGFA  296

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +D+  +F+YSYDP  EYL F+DNG +SVDGV++DFP T S AI C+SH +KG   +    
Sbjct  297   NDMITSFNYSYDPSTEYLQFVDNGQFSVDGVITDFPPTASQAITCFSH-QKGNLPKAGHA  355

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  356   LVITHNGASGDYPGCTDLAYQKAVDDGADVIDCS  389


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 142/314 (45%), Gaps = 37/314 (12%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI   G SG +P  +  AY  A +    +VI  C VQ++KDG+  C     L  ++N  
Sbjct  356   LVITHNGASGDYPGCTDLAYQKA-VDDGADVID-CSVQMSKDGIAFCLDSADLTKSTNAM  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ-QGVYSRSSRFDGTPQ-----QIL  708
             T F  + +T +    PT A F  D  + ++  +  Q +  +  S  F   P      + +
Sbjct  414   TTFMSR-ATSVPEIQPTNAIFSFDLTWAEIQSLKPQIESPFLTSGGFQRNPANKNAGKFM  472

Query  709   TVEDVFNKVQPP---GLWLNVQHDSFY-SQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
             ++ D     +     G+ +NVQ+ ++  S+  L +   V S      ++  S+ +V    
Sbjct  473   SLVDFLELSKAKAVTGVLINVQNAAYLASKKGLGVVDAVKSALTNSTLDKQSTQKVMIQS  532

Query  877   SIASRIN-----PRVTKL--VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKS  1035
               +S +      P  T++  + + +G D  +PS  +           IK  A  + + ++
Sbjct  533   DDSSVLASFEAVPPFTRVLSIDKEIG-DAPKPSVEE-----------IKKHADAVNLKRT  580

Query  1036  YIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNG  1212
              +  V  S+S+    T++V + HK  + VY S   ++ V   FDY  DP  E  +FI  G
Sbjct  581   SL--VTVSNSFATGKTNVVEEMHKGNISVYVSVLRNEFVSIVFDYFSDPTVELATFI-AG  637

Query  1213  NYSVDGVLSDFPIT  1254
             N  VDGV+++FP T
Sbjct  638   N-GVDGVITEFPAT  650



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   386 bits (991),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 256/365 (70%), Gaps = 6/365 (2%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             +KW+TLSG+APLVIARGGFSG+FP+SS  AY FA  +SL   ++ CD+QLTKDG GIC  
Sbjct  44    AKWKTLSGNAPLVIARGGFSGIFPESSQFAYQFALASSLKETVLLCDLQLTKDGAGICLS  103

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDG  690
             D+KLDN++ ++++F  + +TY VNG     WF +DF   +L + V   Q ++SR S FDG
Sbjct  104   DLKLDNSTTISSVFPKRDTTYSVNGQSLKGWFSVDFTTDELISNVTTIQNIFSRPSLFDG  163

Query  691   T-PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
               P  +L     F+  Q    WLNVQ+D FY +H L    F+L+ S ++  +YISSPE+ 
Sbjct  164   NLPVSLLQEISGFHPYQ---FWLNVQYDMFYKEHKLDPAKFILTASEKMDFDYISSPEIG  220

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FLKS+  +     TKL+FRFL  D  EPSTNQTY S+L++L +IK+FASGILVPKSYIWP
Sbjct  221   FLKSLNGKFGKAKTKLIFRFLDADAVEPSTNQTYSSILKSLTAIKSFASGILVPKSYIWP  280

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V+K   YL+  T+LV DAH +GLEV+A +FA+D P +++YS+DP AEYL FID+ ++SVD
Sbjct  281   VNKDK-YLESATTLVTDAHNLGLEVHAYNFANDQPASYNYSFDPTAEYLQFIDHSDFSVD  339

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVL+DFP T S A+ C +H +    +     L+I+ +GASG + GCTD AY +AV DG D
Sbjct  340   GVLTDFPSTASTAVACLAHNKDNAASNKKRPLIITRNGASGVFAGCTDLAYQQAVEDGAD  399

Query  1408  IIDCT  1422
             IIDC+
Sbjct  400   IIDCS  404



>ref|XP_010928375.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL7-like [Elaeis guineensis]
Length=768

 Score =   384 bits (987),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 251/366 (69%), Gaps = 10/366 (3%)
 Frame = +1

Query  346   TLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGV------GIC  507
             TLSG+APLVIARGG+SG+FP+SS  AY FA  TSL   ++ CD+QLTKDG       GIC
Sbjct  40    TLSGNAPLVIARGGYSGIFPESSQFAYQFALATSLKETVLLCDLQLTKDGXXXXXXXGIC  99

Query  508   FPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLT-LVNLQQGVYSRSSRF  684
               D+KLDN++ ++T F  + +TY VNG     WF +DF   +L   V   Q ++SR S F
Sbjct  100   RSDLKLDNSTTISTAFPKRGTTYSVNGQSVHGWFSVDFTSDELLGNVTTIQNIFSRPSIF  159

Query  685   DGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEV  864
             DG     L++    ++  P   WLNVQ+D FY +H L    F+L+ S  VV +YISSPE+
Sbjct  160   DG--NLPLSMVQEISRFHPSQFWLNVQYDMFYKEHKLDPAKFILTASENVVFDYISSPEI  217

Query  865   NFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIW  1044
              FLKS+  ++    TKL+FRFL  D  EPSTNQTY  +L+NLA+IK+FASGILVPKSY+W
Sbjct  218   GFLKSLNGKLGKAKTKLIFRFLAADAVEPSTNQTYSLILKNLATIKSFASGILVPKSYVW  277

Query  1045  PVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSV  1224
             P +K   YL+P+T+LV DAH +GLEVYA +FA+D P +++YS+DP AEYL FIDN N+SV
Sbjct  278   PANKDK-YLEPSTTLVTDAHNLGLEVYAFNFANDQPASYNYSFDPTAEYLQFIDNPNFSV  336

Query  1225  DGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGV  1404
             DGV +DFP T S AI C +H +     Q    L+I+ +GASG + GCTD AY +AV DG 
Sbjct  337   DGVFTDFPSTASAAIACLAHNKDNAAAQKKRPLIITRNGASGVFAGCTDLAYQQAVKDGA  396

Query  1405  DIIDCT  1422
             DIIDC+
Sbjct  397   DIIDCS  402


 Score = 52.4 bits (124),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 133/322 (41%), Gaps = 52/322 (16%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  543
             PL+I R G SG+F   +  AY  A        I+ C VQ++KDGV  C     L   +  
Sbjct  368   PLIITRNGASGVFAGCTDLAYQQAVKDGAD--IIDCSVQMSKDGVAFCLDSADLMGDTTA  425

Query  544   ATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-----------LTLVNLQQGVYSRSSRFDG  690
                F  + S  +         F  D  + +           L+  NL   V + +++  G
Sbjct  426   MDSFMSR-SALVPEIQKNNGIFSFDLTWSEIESLKPVLANPLSSANL---VRNPAAKNMG  481

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFY-SQHNLSMRTFVLS----------VSRRVV  837
                 + T  D        G+ +N++H  +  S+  L + T V S          ++++V+
Sbjct  482   KLMTLATFLDFAKNSTVSGILINIEHAPYLASKKGLDIVTAVSSALINASYDKQITQKVL  541

Query  838   INYISSPEVNFLKSIASRINPRVTKLVFRFLG--NDETEPSTNQTYGSLLQNLASIKTFA  1011
             I    +  ++  K+ +S       K VF+     +D  +P+ ++           IK FA
Sbjct  542   IQSDDTSVLSMFKNNSSY------KRVFKVEETISDSPKPAVDE-----------IKQFA  584

Query  1012  SGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAE  1188
               + + K+ +  +  S+S+L   T +    H   L VY S   ++ V   FD   DP+ E
Sbjct  585   DAVNIAKTSL--IASSNSFLTSFTPVTDKMHAANLSVYVSGLRNEFVSIPFDCFSDPMVE  642

Query  1189  YLSFIDNGNYSVDGVLSDFPIT  1254
               ++      +VDG++++FP T
Sbjct  643   IATYA--AGLAVDGIVTEFPAT  662



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score =   382 bits (982),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 251/362 (69%), Gaps = 6/362 (2%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W TL+G  P V+ARGG SGLFP+S   A   A  +S   + + C++Q+T DG GIC PDI
Sbjct  33    WLTLNGQEPGVVARGGISGLFPESCALANDLAISSSSPGLTILCNLQMTNDGAGICLPDI  92

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTP  696
             +LDNA+ ++TLF   Q TY VNG     WF +D++   + + V+L Q +YSR S FDG  
Sbjct  93    RLDNATTISTLFPKGQKTYKVNGQDLKGWFALDYSADTIFSNVSLVQNIYSRPSIFDGE-  151

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               I  VEDV   ++PP  WL+VQ+D+FY +H LS   ++ S+  R  I +ISSPE+ FLK
Sbjct  152   LPISAVEDVLG-IKPPKFWLSVQNDAFYMEHKLSPAEYLRSLGFRG-ITFISSPEIGFLK  209

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             SI        TKL+F F   +  EP+TN+ Y  +LQNLA+IK FASG+LVPK YIWP+D 
Sbjct  210   SIGRDAVMSKTKLIFEFKDPEAMEPTTNKKYSEILQNLAAIKAFASGVLVPKGYIWPID-  268

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
             ++ YL+P T+LV DAHK GLEVYAS FA+D+P +F+YSYDP AEYL F+DNG +SVDGV+
Sbjct  269   TAKYLKPATTLVADAHKAGLEVYASGFANDMPASFNYSYDPSAEYLQFVDNGQFSVDGVV  328

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  1416
             +DFP T S AI C+SH +KG   +    LVI+ +GASGDYPGCTD AY KAV DG D+ID
Sbjct  329   TDFPPTASQAISCFSH-QKGNLPKAGHALVITHNGASGDYPGCTDLAYQKAVEDGADVID  387

Query  1417  CT  1422
             C+
Sbjct  388   CS  389



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score =   395 bits (1015),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 264/362 (73%), Gaps = 4/362 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S ++TL GDAPLVIA+GGFSG+FPDSS  A++FA L S  +  +WCDVQLTKDGVGIC  
Sbjct  45    SAYKTLRGDAPLVIAQGGFSGVFPDSSQAAFAFALLASAPDTSVWCDVQLTKDGVGICLR  104

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGT  693
             DI + N +N AT +  K+  Y+++GVP T  F +DF + ++    L QG YSR+ RFD  
Sbjct  105   DINMANCTNAATAYPAKKKKYVIDGVPKTGHFSLDFTYSEVQNTYLTQGFYSRTDRFDSI  164

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                I +V D+ + ++PP +WLNVQHD FYSQH L+MR +++S+ + V + YISSPE+ FL
Sbjct  165   -YNIFSVTDLQSHIKPPSVWLNVQHDVFYSQHGLNMRRYIVSILKSVSVKYISSPEIGFL  223

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             KSI+ R+  R TKLVFRF  N  ++PSTNQTY SL +NL  IKT ASGI+VPKSYIW V 
Sbjct  224   KSISKRVRGR-TKLVFRFPDNFLSDPSTNQTYSSLSKNLTFIKTIASGIMVPKSYIWQV-  281

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              + +YL P TS V DAH+ GLE+YASDFA+D    ++YSYDP+ EYLSFI +G +SVDGV
Sbjct  282   TNDNYLLPPTSFVQDAHRAGLEIYASDFANDRIIPYNYSYDPLQEYLSFISDGGFSVDGV  341

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             L+D+PIT S AI C++++ + + +   + L+IS +GASGDYP CTD AY  A+ DG D+I
Sbjct  342   LTDYPITASEAIGCFANLNESKADH-GKPLIISHNGASGDYPDCTDLAYQNAIKDGADVI  400

Query  1414  DC  1419
             DC
Sbjct  401   DC  402



>tpg|DAA47913.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=607

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 260/383 (68%), Gaps = 9/383 (2%)
 Frame = +1

Query  286   CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  456
             C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35    CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  457   VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  636
               MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF  DF   +L
Sbjct  94    TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWFVPDFTSAEL  153

Query  637   TL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
                V L Q ++SR+ R DG    I+TV DV + V    +WLNVQH  FY Q +L M +++
Sbjct  154   LQSVYLTQAIWSRTERMDGI-YPIVTVPDVQSIVNTSPIWLNVQHPIFYKQRDLDMSSYI  212

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
              S+ + V ++YISSPE+ FL++I++R+  R TKLVF FL     + S NQTYGSL +NL 
Sbjct  213   HSIRKLVRMDYISSPEIGFLRNISARVRRR-TKLVFSFLDKKLLDHSVNQTYGSLARNLT  271

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              +++ ASGILVPK YIWPV  + +YL P+TS+V +AH+ GLE+YAS F +D    F+YSY
Sbjct  272   FVRSVASGILVPKDYIWPV-TADNYLLPSTSIVTEAHEAGLEIYASGFVNDKAVPFNYSY  330

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP-EFLVISFDGASG  1350
             DP+AEYL+F+ +G +SVDGVLSD+PIT S AI C++++   + + V  + LVIS +GASG
Sbjct  331   DPLAEYLNFVGDGGFSVDGVLSDYPITASEAIGCFANLNSSKTDHVTGKPLVISHNGASG  390

Query  1351  DYPGCTDXAYSKAVSDGVDIIDC  1419
             DYP CTD AY  AV DG D+IDC
Sbjct  391   DYPDCTDLAYHSAVDDGADVIDC  413



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   382 bits (980),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/389 (50%), Positives = 265/389 (68%), Gaps = 5/389 (1%)
 Frame = +1

Query  259   RSIFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAG  438
             R  F + L   +          +   KW TL+GD PLVIARGGFSG+FP+SS  AY FA 
Sbjct  3     RCFFFIFLFIHSALAQKHVEDPSQNQKWLTLNGDRPLVIARGGFSGVFPESSQFAYQFAL  62

Query  439   LTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPID  618
              TS+++V+++CD+QLTKDG GIC  +++LDN++ ++  + + + TY VNG   + WF +D
Sbjct  63    STSISDVVLFCDLQLTKDGNGICQTELRLDNSTTISAYYPEGEKTYNVNGKNISGWFAVD  122

Query  619   FNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNL  795
             F  ++L   + L Q VYSR+S FD T   I+TVEDV   ++PP  WLNV++D FY QHNL
Sbjct  123   FTVEELFNNITLSQNVYSRASIFDET-LPIMTVEDV-TGLRPPKFWLNVEYDMFYVQHNL  180

Query  796   SMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGS  975
             +   ++    + + I+YISSPE+ FLK++  ++N   TKL+FRFL  D  EP+T Q YGS
Sbjct  181   NAEAYIEEALKHMRIDYISSPEIGFLKNLNGKLNTDTTKLIFRFLEADAVEPTTKQKYGS  240

Query  976   LLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPF  1155
             +L NL  IKTFASGILVPK YIWPV+ +  YL+  T+LV DAHK GL V+A  F +D   
Sbjct  241   ILSNLPEIKTFASGILVPKEYIWPVN-AQKYLEAHTNLVTDAHKQGLLVFACTFKNDGIG  299

Query  1156  AFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISF  1335
             +++YSYDP AEYL F+DN ++SVDGVL+DFP T S AI C +H  K + ++  + LVI+ 
Sbjct  300   SYNYSYDPTAEYLQFVDNPDFSVDGVLTDFPPTASEAIGCLAHNNKTRPDK-GKVLVITH  358

Query  1336  DGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +GASG +  CTD AY +AV DG DIIDC+
Sbjct  359   NGASGVFAPCTDLAYQQAVDDGADIIDCS  387



>emb|CDY43885.1| BnaC09g33580D [Brassica napus]
Length=751

 Score =   381 bits (978),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 249/362 (69%), Gaps = 6/362 (2%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W TL+G  P V+ARGG SGLFP+S   A   A  +S   + + C++Q+T DG GIC PDI
Sbjct  33    WLTLNGQEPGVVARGGISGLFPESCALANDLAISSSSPGLTILCNLQMTNDGAGICLPDI  92

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTP  696
             +LDNA+ + TLF   Q TY VNG     WF +D++   + + V+L Q +YSR S FDG  
Sbjct  93    RLDNATTIPTLFPKGQKTYKVNGQDLKGWFALDYSADTIFSNVSLVQNIYSRPSIFDGQ-  151

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               I  VEDV   ++PP  WL+VQ+D+FY +H LS   ++ S+  R  I +ISSPE+ FLK
Sbjct  152   MPISAVEDVLG-IKPPKFWLSVQNDAFYMEHKLSPAEYLRSLGFRG-ITFISSPEIGFLK  209

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             SI        TKL+F F   +  EP+TN+ Y  +LQNLA+IK FASG+LVPK YIWP+D 
Sbjct  210   SIGRDAVMSKTKLIFEFKDPEAMEPTTNKKYSEILQNLAAIKAFASGVLVPKGYIWPID-  268

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
             S+ YL+P T+LV DAHK GLEVYAS FA+D+P +F+YSYDP AEYL F+DNG +SVDG +
Sbjct  269   SAKYLKPATTLVADAHKAGLEVYASGFANDMPASFNYSYDPSAEYLQFVDNGQFSVDGFI  328

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  1416
             +DFP T S AI C+SH +KG   +    LVI+ +GASGDYPGCTD AY KAV DG D+ID
Sbjct  329   TDFPPTASQAITCFSH-QKGNLPKAGHALVITHNGASGDYPGCTDLAYQKAVEDGADVID  387

Query  1417  CT  1422
             C+
Sbjct  388   CS  389



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   381 bits (978),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 261/394 (66%), Gaps = 7/394 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M +   +F+L L  C A     A  +     KW TL+G  P V+ARGGFSGLFP+SS  A
Sbjct  1     MLRFFILFSLFLHSCVAAPKTPAAAAAVPAKKWLTLNGQEPAVVARGGFSGLFPESSAPA  60

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
                A  TS   + M C++Q+TKDGVG+C  DI+LDNA+ +++LF   Q TY VNG     
Sbjct  61    NDMAVSTSSPGLTMLCNLQMTKDGVGLCLSDIRLDNATTISSLFPKAQKTYKVNGQDLKG  120

Query  604   WFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFY  780
             WF +D++   + + V+L Q ++SR S FDG    +  VEDV    +PP  WL+VQ+D+FY
Sbjct  121   WFVLDYDADTIFSNVSLVQNIFSRPSIFDGQ-MPVSAVEDVLG-TKPPKFWLSVQYDAFY  178

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
              +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+TN
Sbjct  179   MEHKLSAAEYLRSLRFR-GINVISSPEIGFLKSIGMDAGRAKTKLIFEFKEPEAIEPTTN  237

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             + Y  L QNLA+IK FASG+LVPK YIWP+D S+ YL+P T+ V DAHK GLEVYAS FA
Sbjct  238   KKYSELQQNLAAIKAFASGVLVPKDYIWPLD-SAKYLKPATTFVADAHKAGLEVYASGFA  296

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +D+  +F+YSYDP  EYL F+DNG +SVDGV++DFP T S AI C+SH +KG   +    
Sbjct  297   NDMRTSFNYSYDPSTEYLQFVDNGEFSVDGVITDFPPTASQAITCFSH-QKGNLPKAGHA  355

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             LVI+ +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  356   LVITHNGASGDYPGCTDLAYQKAIDDGADVIDCS  389



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score =   380 bits (977),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 194/366 (53%), Positives = 253/366 (69%), Gaps = 12/366 (3%)
 Frame = +1

Query  337   KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  516
             KW TL+G  P V+ARGGFSGLFP+SS  A   A  TS   + M C++Q+TKDGVG+C  D
Sbjct  30    KWLTLNGKEPAVVARGGFSGLFPESSAPANDMAISTSSPGLTMLCNLQMTKDGVGLCLSD  89

Query  517   IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGT  693
             I+LDNA+ ++TLF   Q TY VNG     WF +D++   + + V+L Q ++SR S FDG 
Sbjct  90    IRLDNATTISTLFPKAQKTYKVNGQDLKGWFVLDYDADTIFSNVSLVQNIFSRPSIFDGQ  149

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                +  VEDV    +PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FL
Sbjct  150   -MPVSAVEDVLG-TKPPKFWLSVQYDAFYMEHKLSAADYLRSLRFR-GINVISSPEIGFL  206

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             KSI        TKL+F F   +  EP+TN+ Y  L QNLA+IK FASG+LVPK YIWP+D
Sbjct  207   KSIGMDAGRAKTKLIFEFKDPEAIEPTTNKKYSELQQNLAAIKAFASGVLVPKDYIWPLD  266

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
              ++ YL+P T+ V DAHK GLEVYAS FA+D+  +F+YS+DP AEYL F+DNG +SVDG+
Sbjct  267   -TAKYLKPATTFVADAHKAGLEVYASGFANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGI  325

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPE---FLVISFDGASGDYPGCTDXAYSKAVSDGV  1404
             ++DFP T S AI C SH    QK+ +P+    LVI+ +GASGDYPGCTD AY KAV+DG 
Sbjct  326   ITDFPPTASQAITCLSH----QKDNLPKAGHALVITHNGASGDYPGCTDMAYEKAVNDGA  381

Query  1405  DIIDCT  1422
             D+IDC+
Sbjct  382   DVIDCS  387



>ref|XP_002445920.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
 gb|EES15415.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
Length=885

 Score =   383 bits (984),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 203/387 (52%), Positives = 267/387 (69%), Gaps = 16/387 (4%)
 Frame = +1

Query  286   CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSL--  450
             C  + LV   AAQG     S ++TLSG APLVIA+GGFSG+FPDSS +AYSFA + S   
Sbjct  132   CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVIAKGGFSGVFPDSSQDAYSFAKVASAPG  190

Query  451   TNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFK  630
             T   MWCDVQLTKDGVG+C  DI ++N + V   +  ++ TY+++G+  T WF  DF   
Sbjct  191   TGTAMWCDVQLTKDGVGVCLRDINMNNCTTVGQAYPARKRTYVIDGMHKTGWFVSDFTIA  250

Query  631   QL-TLVNLQQGVYSRSSRFDGTPQQILTVED---VFNKVQPPGLWLNVQHDSFYSQHNLS  798
             +L + V L Q ++SRS RFD     I++V D   + N   P  +WLNVQH  FY QH L 
Sbjct  251   ELQSAVYLTQAIWSRSERFDAI-YPIVSVTDFQYLVNMSSP--VWLNVQHPIFYKQHGLD  307

Query  799   MRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSL  978
             M  ++ S+ + V ++YISSPE+ FLK+I++R+  R TKLV+ FL  +  + S NQTYG L
Sbjct  308   MSRYIFSIRKLVSMDYISSPELGFLKNISARVG-RKTKLVYSFLDKNLLDHSMNQTYGLL  366

Query  979   LQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFA  1158
               NL  IK+ ASGI+VPK YIWPV  S +YL+P+TS+V DAHK GLE+YASDFA+D    
Sbjct  367   STNLTFIKSIASGIMVPKDYIWPV-TSDNYLRPSTSIVTDAHKAGLEIYASDFANDRIIP  425

Query  1159  FDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFD  1338
             ++YSYDP+AEYL+FI +G +SVDGVLSD+PIT S AI C++++   + +   E LVIS +
Sbjct  426   YNYSYDPLAEYLNFISDGGFSVDGVLSDYPITASEAIGCFANLNSSKTDHA-EPLVISHN  484

Query  1339  GASGDYPGCTDXAYSKAVSDGVDIIDC  1419
             GASGDYP CTD AY  A+ DG D+IDC
Sbjct  485   GASGDYPDCTDLAYHSAIDDGADVIDC  511



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score =   379 bits (974),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 261/397 (66%), Gaps = 13/397 (3%)
 Frame = +1

Query  247   MWKLRSIFNLLL-LCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M +    F+L + LC A     A  +     KW TL+G  P V+ARGGFSGLFP+SS +A
Sbjct  1     MLRFIIFFSLFIHLCVAAPQTPAAAAAVPAKKWLTLNGQEPAVVARGGFSGLFPESSASA  60

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
                A  TS   + M C++Q+TKDGVG+C  DI LDNA+ ++++F   Q TY VNG     
Sbjct  61    NDLAIGTSSPGLTMLCNLQMTKDGVGLCLSDIILDNATTISSVFPKAQKTYKVNGQDLKG  120

Query  604   WFPIDFN----FKQLTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHD  771
             WF +D++    F  +TLV   Q ++SR S FDG    +  VEDV    +PP  WL+VQ+D
Sbjct  121   WFVLDYDADTIFNNVTLV---QNIFSRPSIFDGQ-MSVSAVEDVLG-TKPPKFWLSVQYD  175

Query  772   SFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  951
             +FY +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP
Sbjct  176   AFYMEHKLSPAEYLRSLQFR-GINVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAVEP  234

Query  952   STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  1131
             +TN+ Y  + QNLA+IK FASG+LVPK YIWP+D S+ YL+P T+ V DAHK GLEVYAS
Sbjct  235   TTNKKYSEIQQNLAAIKAFASGVLVPKDYIWPID-SAKYLKPATTFVADAHKAGLEVYAS  293

Query  1132  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  1311
              FA+D+  +F+YSYDP AEYL F+DNG +SVDGV++DFP T S +I C+SH + G   + 
Sbjct  294   GFANDLRTSFNYSYDPSAEYLQFVDNGQFSVDGVITDFPPTASQSITCFSH-QNGNLPKA  352

Query  1312  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
                LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  353   GHALVITHNGASGDYPGCTDLAYQKAVDDGADVIDCS  389


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 142/308 (46%), Gaps = 26/308 (8%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI   G SG +P  +  AY  A +    +VI  C VQ++KDG+  C     L  ++   
Sbjct  356   LVITHNGASGDYPGCTDLAYQKA-VDDGADVID-CSVQMSKDGIAFCHDAADLTASTTAM  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ-----QILT  711
             T+F  + +T +    PT   F  D  + ++  V  Q      ++ F   P      + +T
Sbjct  414   TIFMSR-ATSVPEIQPTNGIFSFDLTWAEIQSVKPQIENPFTATGFQRNPANKNAGKFIT  472

Query  712   VEDV--FNKVQP-PGLWLNVQHDSFY-SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKS  879
             + D   F+K +   G+ +N+++ ++  S+  L +   V S   +  ++  S+ +V  ++S
Sbjct  473   LADFLDFSKAKAVTGVMINIENAAYLASKKGLGVVDAVKSALAKSTLDKQSTQKV-LIQS  531

Query  880   IASRINPRVTKL--VFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
               S +      +    R L  D+      +  G+   ++  IK +A  + + ++ +  V 
Sbjct  532   DDSSVLASFEAVPPYTRVLSIDK------EIGGAPKPSVDEIKKYAEAVNLLRTSL--VT  583

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
              S S+    T++V + HK  + VY S   ++ +  AFDY  DP  E  +FI      VDG
Sbjct  584   VSQSFTTGKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTIELATFISGSG--VDG  641

Query  1231  VLSDFPIT  1254
             V+++FP T
Sbjct  642   VITEFPAT  649



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score =   379 bits (972),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 250/365 (68%), Gaps = 12/365 (3%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W TL+G  P V+ARGGFSGLFP+SS +A   A  TS     M C++Q+TKDGVG+C  DI
Sbjct  33    WLTLNGQEPAVVARGGFSGLFPESSISANDLAIGTSSPGFTMLCNLQMTKDGVGLCLSDI  92

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN----FKQLTLVNLQQGVYSRSSRFD  687
             +LDNA+ ++++F   Q TY VNG     WF ID++    F ++TLV   Q ++SR S FD
Sbjct  93    RLDNATTISSVFPKAQKTYKVNGQDLKGWFVIDYDADTIFNKVTLV---QNIFSRPSIFD  149

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             G    +  VEDV    +PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ 
Sbjct  150   GQ-MSVSAVEDVLG-TKPPKFWLSVQYDAFYMEHKLSPAEYLRSLRFR-GINVISSPEIG  206

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FLKSI        TKL+F F   +  EP+TN+ Y  + QNLA+IK FASG+LVPK YIWP
Sbjct  207   FLKSIGMDAGRAKTKLIFEFKDPEAVEPTTNKKYSEIQQNLAAIKAFASGVLVPKDYIWP  266

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             +D S+ YL+P T+ V DAHK GLEVYAS FA+D+  +F+YSYDP AEYL F+DNG +SVD
Sbjct  267   ID-SAKYLKPATTFVADAHKAGLEVYASGFANDLRTSFNYSYDPSAEYLQFVDNGQFSVD  325

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GV++DFP T S +I C+SH + G   +    LVI+ +GASGDYPGCTD AY KA+ DG D
Sbjct  326   GVITDFPPTASQSITCFSH-QNGNLPKAGHALVITHNGASGDYPGCTDLAYQKAIDDGAD  384

Query  1408  IIDCT  1422
             IIDC+
Sbjct  385   IIDCS  389


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 132/307 (43%), Gaps = 24/307 (8%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI   G SG +P  +  AY  A +    ++I  C VQ++KDG+  C     L  ++   
Sbjct  356   LVITHNGASGDYPGCTDLAYQKA-IDDGADIID-CSVQMSKDGIAFCHDAADLSASTTAR  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQQGVYSRSSRFDGTPQ-----QILT  711
             T F  + +T +    PT   F  D  + ++  V  Q      ++ F   P      +  T
Sbjct  414   TTFMSR-ATSVPEIQPTNGIFSFDLTWAEIQSVKPQIENPFTATGFQRNPANKNAGKFTT  472

Query  712   VEDVFNKVQPP---GLWLNVQHDSFY-SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKS  879
             + D     +     G+ +N+Q+ ++  S+  L +   V S      ++  S+ +V     
Sbjct  473   LADFLELGKAKAVTGVLINIQNAAYLASKKGLGVVDVVKSALTNSTLDKQSTQKVLIQSD  532

Query  880   IASRINP-RVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
              +S ++         R L  D+      +T      ++  IK  A  + + ++ +  V  
Sbjct  533   DSSVLSSFEAVPPYTRVLSIDKEIGDAPKT------SIEEIKKHADAVNLLRTSLITV--  584

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
             S S+    T++V + HK  + VY S   ++ +  AFDY  DP  E  +FI      VDGV
Sbjct  585   SQSFATGKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSDPTIELATFI--AGRGVDGV  642

Query  1234  LSDFPIT  1254
             +++FP T
Sbjct  643   ITEFPAT  649



>gb|AFW72078.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=360

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 238/330 (72%), Gaps = 4/330 (1%)
 Frame = +1

Query  334   SKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFP  513
             S W+TLSG AP+++A+GGFSGLFPDSS  AY   G  S  + +MWCDV+LTKDG GIC P
Sbjct  33    STWKTLSGKAPVIVAKGGFSGLFPDSSDFAYRILGTISSPDTVMWCDVRLTKDGDGICLP  92

Query  514   DIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGVYSRSSRFDG  690
              I +DN + +  +F + + TY VNGV T  WF +D+    L   V L+Q V SR+  +DG
Sbjct  93    SINMDNCTMIDNVFPEGKKTYNVNGVSTVGWFSVDYTSTDLLPNVTLKQSVLSRTPVYDG  152

Query  691   TPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNF  870
             +   I +VE+VF       +WLNVQ DSFYSQ  LSMR ++LS+S++ + +YISSPEVNF
Sbjct  153   S-MLINSVENVFTSFNASAVWLNVQQDSFYSQFKLSMRNYILSLSKQFITDYISSPEVNF  211

Query  871   LKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPV  1050
             L SI+ R++ + TKLVFRFL     EPSTNQTYGS+L+NL  +KTFASGILVPKSYIWPV
Sbjct  212   LTSISGRVSKK-TKLVFRFLDEGSIEPSTNQTYGSMLKNLTFVKTFASGILVPKSYIWPV  270

Query  1051  DKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDG  1230
                 +YL P TS+V DAHK GLE+YA+DFA+D   +++YS+DP+AEYLSFI N  +SVDG
Sbjct  271   -TPDNYLLPYTSVVDDAHKAGLEIYAADFANDFTISYNYSFDPLAEYLSFIGNSAFSVDG  329

Query  1231  VLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             VL+DFPITPS A+ C+S++   + +    F
Sbjct  330   VLTDFPITPSEAVGCFSNLNNSKIDHAVLF  359



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   378 bits (971),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 264/389 (68%), Gaps = 9/389 (2%)
 Frame = +1

Query  265   IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             +   LLL S V       S +++ KW TL+G+ P VIARGGFSGLFP+SS  A   A  T
Sbjct  1     MIKYLLLVSFVIHATLANSESASKKWLTLNGERPSVIARGGFSGLFPESSDFANQMALGT  60

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             S+ +V++ C++QLTKDGVGIC  DI+LDN +N+A LF+    TY VNG   T WF +DF 
Sbjct  61    SVHDVVVLCNLQLTKDGVGICQGDIRLDNTTNIAMLFEKGSKTYKVNGQDLTGWFALDFT  120

Query  625   FKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
               QL   V+L Q ++SR S FDG    + TV+DV N   PP  WLNVQ+D+FY+++ LS+
Sbjct  121   ADQLLANVSLVQNIFSRPSAFDGM-LPMSTVDDVRNS-NPPAFWLNVQYDAFYTENKLSV  178

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
               ++   +R   +NYISSPE+ FLK +   +    TKL+F FL    TEP++NQTYGS+L
Sbjct  179   TNYIQKATRLQGVNYISSPEIGFLKRMNGLVKKAKTKLIFVFLDKKATEPTSNQTYGSIL  238

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NLA+IK FASGI+VPK YIWPV+ +++YL   TSLV DAHK+GLEVYAS FA+D   ++
Sbjct  239   GNLATIKKFASGIVVPKDYIWPVN-TANYLDAPTSLVNDAHKLGLEVYASGFANDFTTSY  297

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMR--KGQKNQVPEFLVISF  1335
             +YSYDP AEYL FIDN  +SVDG+++DFP T S A+ C++     K  K Q    L+I+ 
Sbjct  298   NYSYDPSAEYLQFIDNSQFSVDGLITDFPPTASEAVACFAQYPDIKPTKGQA---LIITH  354

Query  1336  DGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +GASG Y G TD AY + + DG DIIDC+
Sbjct  355   NGASGVYAGSTDLAYQQGLEDGADIIDCS  383



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   379 bits (973),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 251/365 (69%), Gaps = 4/365 (1%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             T KW TL+G  PLVIARGGFSGLFP+SS  A   A   SL     +C++QLTKD VGIC 
Sbjct  40    TKKWLTLNGQEPLVIARGGFSGLFPESSTYAIDMAKSQSLPGYAFFCNLQLTKDSVGICL  99

Query  511   PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFD  687
              +I LDN + ++  +   Q TY VNG     WF +DF   QL   V+L Q ++SR S FD
Sbjct  100   SNILLDNTTTISMFYPKDQKTYNVNGKDIRGWFALDFTADQLLNNVSLTQNIFSRPSYFD  159

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             GT   I TVED    ++P   WLNV +D+FYSQH +SM +FV  V R   +NYISSPE+ 
Sbjct  160   GT-LPIATVEDALG-IKPDKFWLNVPYDTFYSQHKISMASFVEKVIRFPSMNYISSPEIG  217

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FLK++++++N   TKL+F+FL  +ETEP+T Q Y +L++NL  IK+ A+GILVPK YIWP
Sbjct  218   FLKTVSAKVNKGRTKLIFQFLDPEETEPTTKQKYSALVKNLEMIKSVAAGILVPKEYIWP  277

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V+K++ YL+  T+LV +AHK GLEV+AS FA+D+   ++YS+DP AEYL F+D  N+SVD
Sbjct  278   VNKNN-YLEAATTLVTEAHKQGLEVHASGFANDIVLPYNYSFDPTAEYLQFVDQPNFSVD  336

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVL+DFP T S  I C++      K +    L+I+ +GASG YPGCTD AY +AV DG D
Sbjct  337   GVLTDFPPTASETIACFAQNNNSTKPKKGLPLIITRNGASGTYPGCTDLAYKQAVDDGAD  396

Query  1408  IIDCT  1422
             IIDC+
Sbjct  397   IIDCS  401


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 89/343 (26%), Positives = 154/343 (45%), Gaps = 39/343 (11%)
 Frame = +1

Query  298   TLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDV  477
             T+     + NST   + L    PL+I R G SG +P  +  AY  A        I+ C V
Sbjct  349   TIACFAQNNNSTKPKKGL----PLIITRNGASGTYPGCTDLAYKQAVDDGAD--IIDCSV  402

Query  478   QLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ-  654
             QL+ DGV  C   I L++ +N  + F  K  T     +P        F+F QL+   +Q 
Sbjct  403   QLSSDGVAFCLDTIDLNSGTNALSQFMTKSET-----IPELQAEAGVFSF-QLSWHEIQS  456

Query  655   -----QGVYSRSSRFDGTPQ-----QILTVEDV--FNKVQP-PGLWLNVQHDSFY-SQHN  792
                  Q  Y    +    P      +++T+ D   F+K +   G+ +N+++ ++  S+  
Sbjct  457   LKPQIQSPYGTKEKVYRNPANKDVGKLVTLSDFLEFSKTKAVTGILINIENAAYLASKAG  516

Query  793   LSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKL-VFRFLGNDETEPSTNQTY  969
             L +   V S       +  S+ +V  +KS  + +  +   +  +R + N + E  ++ T 
Sbjct  517   LDIVKTVTSALSNATFDKQSTQQV-LIKSDDTSVLSKFKDVKTYRRVLNIK-EKISDATK  574

Query  970   GSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-  1146
              S+ +    IK FA  + V K  I  V  S  ++   T++V +     + VY     ++ 
Sbjct  575   ASVDE----IKKFADAVTVTKDSI--VKISDYFISGKTNVVKEMKAANISVYVHWLKNEF  628

Query  1147  VPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDC  1275
             V   FDY  DP+ E  S++   +Y VDG+++DFP T +  + C
Sbjct  629   VSLMFDYFSDPIIEIASYV--LDYQVDGIVTDFPATANKYMRC  669



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   378 bits (971),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 266/389 (68%), Gaps = 10/389 (3%)
 Frame = +1

Query  265   IFNLLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLT  444
             I N+LL+   +    A  S +++ KW TL+G  P VIARGGFSGLFP+SS  A   A  T
Sbjct  2     IKNVLLVFLVIHATLAN-SESASKKWLTLNGRRPSVIARGGFSGLFPESSDFANQMALAT  60

Query  445   SLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFN  624
             SL+ V + C++QLTK+GVGIC  DI+LDN +N+A +F+    TY VNG   T WF IDF 
Sbjct  61    SLSGVAVLCNLQLTKEGVGICQGDIRLDNTTNIAMVFEKGSRTYKVNGQDITGWFAIDFT  120

Query  625   FKQLTL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSM  801
               QL   V+L Q ++SR S FD     I TV+DV +   PP  WLNVQ+D+FY+++ LS+
Sbjct  121   ADQLLANVSLLQNIFSRPSAFDAM-LPISTVDDVRSS-NPPAFWLNVQYDAFYTENKLSV  178

Query  802   RTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLL  981
               ++   +R   +NYISSPE+ FLK I   +N   TKLVF FL  + TEP+T QTYGS+L
Sbjct  179   ANYIQKATRLQGVNYISSPEIGFLKKINGLVNKAKTKLVFVFLDKNATEPTTKQTYGSIL  238

Query  982   QNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAF  1161
              NLA+IK FASGI+VPK YIWPV+ +++YL+  TSLV DAHK+GLEVYAS FA+D   ++
Sbjct  239   GNLATIKAFASGIVVPKDYIWPVN-AANYLEAPTSLVNDAHKLGLEVYASGFANDFTTSY  297

Query  1162  DYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMR--KGQKNQVPEFLVISF  1335
             +YSYDP AEYL FIDN  +SVDG+++DFP T S A+ C++     K  K Q    L+IS 
Sbjct  298   NYSYDPSAEYLQFIDNSQFSVDGLITDFPPTASEAVACFAQYTDIKPTKEQA---LIISH  354

Query  1336  DGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             +GASG Y G TD AY +AV DG +IIDC+
Sbjct  355   NGASGVYAGSTDLAYQQAVEDGANIIDCS  383



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score =   378 bits (970),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 251/365 (69%), Gaps = 12/365 (3%)
 Frame = +1

Query  340   WQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDI  519
             W TL+G  P V+ARGGFSGLFP+SS  A   A  TS   + M C++Q++KDGVG+C  DI
Sbjct  33    WLTLTGQEPAVVARGGFSGLFPESSAPANDMAVSTSSPGLTMLCNLQMSKDGVGLCLSDI  92

Query  520   KLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTP  696
             +LDNA+ ++TLF   Q TY VNG     WF +D++   + + V+L Q ++SR S FDG  
Sbjct  93    RLDNATTISTLFPKAQKTYKVNGQDLKGWFALDYDADTIFSNVSLVQNIFSRPSIFDGQ-  151

Query  697   QQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFLK  876
               +  VEDV    +PP  WL+VQ+D+FY +H LS   ++ S+  R  IN ISSPE+ FLK
Sbjct  152   MPVSAVEDVLG-TKPPKFWLSVQYDAFYMEHKLSAAEYLRSLRFR-GINVISSPEIGFLK  209

Query  877   SIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDK  1056
             SI        TKL+F F      EP+T + Y  L QNLA+IK FASG+LVPK YIWPVD 
Sbjct  210   SIGMDAGRAKTKLIFEFKDPQAIEPTTKKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-  268

Query  1057  SSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVL  1236
             ++ YL+P T+ V DAHK GLEVYAS FA+D+  +F+YS+DP AEYL F+DNG +SVDG++
Sbjct  269   TAKYLKPATTFVADAHKAGLEVYASGFANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGII  328

Query  1237  SDFPITPSGAIDCYSHMRKGQKNQVPE---FLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             +DFP T S AI C+SH    QK+ +P+    LVI+ +GASGDYPGCTD AY KA++DG D
Sbjct  329   TDFPPTASQAITCFSH----QKDNIPKAGHALVITHNGASGDYPGCTDLAYEKAINDGAD  384

Query  1408  IIDCT  1422
             +IDC+
Sbjct  385   VIDCS  389



>ref|XP_008645839.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645847.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645851.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 ref|XP_008645857.1| PREDICTED: uncharacterized protein LOC100384038 isoform X1 [Zea 
mays]
 tpg|DAA47914.1| TPA: hypothetical protein ZEAMMB73_887943 [Zea mays]
Length=745

 Score =   377 bits (969),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 260/383 (68%), Gaps = 9/383 (2%)
 Frame = +1

Query  286   CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  456
             C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35    CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  457   VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  636
               MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF  DF   +L
Sbjct  94    TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWFVPDFTSAEL  153

Query  637   TL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
                V L Q ++SR+ R DG    I+TV DV + V    +WLNVQH  FY Q +L M +++
Sbjct  154   LQSVYLTQAIWSRTERMDGI-YPIVTVPDVQSIVNTSPIWLNVQHPIFYKQRDLDMSSYI  212

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
              S+ + V ++YISSPE+ FL++I++R+  R TKLVF FL     + S NQTYGSL +NL 
Sbjct  213   HSIRKLVRMDYISSPEIGFLRNISARVR-RRTKLVFSFLDKKLLDHSVNQTYGSLARNLT  271

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              +++ ASGILVPK YIWPV  + +YL P+TS+V +AH+ GLE+YAS F +D    F+YSY
Sbjct  272   FVRSVASGILVPKDYIWPV-TADNYLLPSTSIVTEAHEAGLEIYASGFVNDKAVPFNYSY  330

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP-EFLVISFDGASG  1350
             DP+AEYL+F+ +G +SVDGVLSD+PIT S AI C++++   + + V  + LVIS +GASG
Sbjct  331   DPLAEYLNFVGDGGFSVDGVLSDYPITASEAIGCFANLNSSKTDHVTGKPLVISHNGASG  390

Query  1351  DYPGCTDXAYSKAVSDGVDIIDC  1419
             DYP CTD AY  AV DG D+IDC
Sbjct  391   DYPDCTDLAYHSAVDDGADVIDC  413



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   377 bits (969),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 265/393 (67%), Gaps = 9/393 (2%)
 Frame = +1

Query  256   LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2     LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62    AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  607   FPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             F +D++   + + V+L Q ++SR S F+G    I  VEDV    +PP  WL+VQ+DSFY 
Sbjct  122   FALDYSADTIFSNVSLVQNIFSRPSIFNGQ-MPISAVEDVLG-TKPPKFWLSVQYDSFYV  179

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             +H LS   ++ ++  R  I +ISSPE+ FLKSI        TKL+F F   +  EP+TN+
Sbjct  180   EHKLSAAEYLKTLRFR-GITFISSPEIAFLKSIGMDAGMSKTKLIFEFKDPEAIEPTTNK  238

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
              Y  LL +LA+IK FASG+LVPK YIWP+D S++YL+P ++ V DAHK GLEVYAS FA+
Sbjct  239   KYSELLLDLAAIKAFASGVLVPKDYIWPLD-SANYLKPASTFVADAHKAGLEVYASGFAN  297

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D+  +F+YSYDP AEYL F+DNG +SVDG ++DFP T S AI C SH ++G   +    L
Sbjct  298   DLRTSFNYSYDPSAEYLQFVDNGQFSVDGFITDFPPTASQAISCLSH-QQGNLPKANHAL  356

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             VI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  357   VITQNGASGDYPGCTDLAYQKAVDDGADVIDCS  389


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 147/318 (46%), Gaps = 45/318 (14%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             LVI + G SG +P  +  AY  A +    +VI  C VQ++KDG+  C     L  ++   
Sbjct  356   LVITQNGASGDYPGCTDLAYQKA-VDDGADVID-CSVQMSKDGIAFCHDSADLTTSTTAM  413

Query  547   TLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN-------LQQGVYSRSSRFDGTPQQI  705
             T F  + +T +    PT   F  D  + ++  +        L +G + R+   +    + 
Sbjct  414   TTFMSR-ATSVPEIQPTNGIFSFDLTWAEIQSLKPQILSPFLAKGGFQRNPS-NKNAGKF  471

Query  706   LTVEDV--FNKVQP-PGLWLNVQHDSFYS-----------QHNLSMRTFVLSVSRRVVIN  843
             +T+ D   F+K +   G+ +N+++ ++ +           Q  ++  T    ++++V+I 
Sbjct  472   MTLADFLEFSKEKAVTGVLINIENAAYLASKKGLGIVDTVQSAITKSTLDKQLTQKVLIQ  531

Query  844   YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGIL  1023
                S + + L S A+ + P    L       D  +PS ++           IK  A  + 
Sbjct  532   ---SDDSSVLSSFAA-VPPYTRVLTIDKEIGDAPKPSIDE-----------IKKHAEAVN  576

Query  1024  VPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSF  1200
             + +S +  V  S ++    T++V + HK  + VY S   ++ +  AFDY  DP  E  +F
Sbjct  577   LKRSSL--VTTSKNFATGKTNVVEEMHKGNVSVYVSVLRNEYLSIAFDYFSDPTVEIATF  634

Query  1201  IDNGNYSVDGVLSDFPIT  1254
             I  GN SVDGV+++FP+T
Sbjct  635   I-AGN-SVDGVVTEFPVT  650



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   387 bits (994),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 197/382 (52%), Positives = 255/382 (67%), Gaps = 46/382 (12%)
 Frame = +1

Query  295   VTLVAAQ-GSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWC  471
             + L AAQ  +  S S WQTLSGDAPLVIA GGFSGLFPDS  +AY  A  TS+   ++WC
Sbjct  14    IQLFAAQTNAKRSRSPWQTLSGDAPLVIASGGFSGLFPDSILDAYKLAMQTSVPGAVLWC  73

Query  472   DVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVN-  648
             DVQLTKD  G+C+PD+KL+N S + +++  ++ +YLVNGVPT  WF IDF+ + L  V+ 
Sbjct  74    DVQLTKDDFGMCYPDLKLNNHSTIESVYPKRRKSYLVNGVPTNGWFTIDFSLRDLKNVSC  133

Query  649   -LQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVS  825
              L QG+ S++ +  G    ILTV+DV  +++P  +WLNVQHD+FY+QHNLSM +F++S S
Sbjct  134   KLIQGILSQTGKIHGNGFSILTVQDVTAQIKPESIWLNVQHDAFYAQHNLSMSSFLVSAS  193

Query  826   RRVVINYISSPEVNFLKSIA---SRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLAS  996
             R V I+YISSPE+NF + I     R  PR                               
Sbjct  194   RTVSIDYISSPELNFFQKITGHFGRNGPR-------------------------------  222

Query  997   IKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYD  1176
                    ILVPKSYI+P+D    YL P TSLV DAHK GL+VY S F++D   A++YS+D
Sbjct  223   -------ILVPKSYIFPLD-DKQYLLPPTSLVHDAHKAGLQVYVSGFSNDANIAYNYSFD  274

Query  1177  PVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDY  1356
             PV+EYLSF+DNG++SVDGVLSDFPIT S +IDC+SH+ +    QV +FLVIS  GA GDY
Sbjct  275   PVSEYLSFMDNGDFSVDGVLSDFPITASASIDCFSHIGRNATKQV-DFLVISKHGAGGDY  333

Query  1357  PGCTDXAYSKAVSDGVDIIDCT  1422
             PGCT+ AY KA+ DG D+IDC+
Sbjct  334   PGCTNLAYDKAIKDGADVIDCS  355



>emb|CDY02800.1| BnaC02g10890D [Brassica napus]
Length=748

 Score =   377 bits (967),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 261/394 (66%), Gaps = 7/394 (2%)
 Frame = +1

Query  247   MWKLRSIFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNA  423
             M +   +F+LL+  C A     A   T    KW TLSG  P V+ARGGFSGLFP+SS  A
Sbjct  1     MLRFLILFSLLIHSCVAPPKTKAAAGTLPAKKWLTLSGKEPAVVARGGFSGLFPESSATA  60

Query  424   YSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTA  603
                A  +S  ++ M C++QLTKDG G C  DI+LDN++ ++T F   Q TY V G     
Sbjct  61    NDLAISSSSPDLTMLCNLQLTKDGAGFCLSDIRLDNSTTISTFFPKGQKTYKVYGQNLKG  120

Query  604   WFPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFY  780
             WF +D++   + + V+L Q ++SR S FDG    I  VEDV +  +PP  WL+VQ+D+FY
Sbjct  121   WFALDYSADTIFSNVSLVQNIFSRPSIFDGQ-MAIAAVEDVLD-TKPPKFWLSVQYDAFY  178

Query  781   SQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTN  960
              +H LS   ++ S+ R   IN ISSPE+ FLKSI        TKL+F F   +  EP+TN
Sbjct  179   MEHKLSPAEYIRSL-RFNGINVISSPEIGFLKSIGKDARRAKTKLIFEFKDPEANEPTTN  237

Query  961   QTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFA  1140
             + Y  +L NLA+IK FA+GI+VPK YIWP+D S+ YL+P T++V DAHK GLE+YAS F 
Sbjct  238   KKYSEILLNLAAIKVFATGIIVPKDYIWPID-SAKYLKPPTTVVTDAHKAGLEIYASGFV  296

Query  1141  SDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEF  1320
             +D+  +++YSYDP AEYL F+DNG +SVDG +SDFP T S AI C++H ++    ++ + 
Sbjct  297   NDMLTSYNYSYDPSAEYLQFVDNGQFSVDGFISDFPPTASQAISCFAHQKRDTP-KIGKT  355

Query  1321  LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  356   LVITHNGASGDYPGCTDLAYQKAVDDGADVIDCS  389



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   377 bits (969),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 253/373 (68%), Gaps = 4/373 (1%)
 Frame = +1

Query  307   AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLT  486
             A Q     + KWQTL+G  PLVIARGG SGLFP++S  A   A   SL     +C++QL+
Sbjct  28    APQAQGPPSKKWQTLTGQQPLVIARGGLSGLFPEASIPANDLAKTLSLPGSAFFCNLQLS  87

Query  487   KDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTL-VNLQQGV  663
             KD VGIC  +I LDN + ++T F + Q TY VNG     WF +DF   +L   V+L Q +
Sbjct  88    KDNVGICLSNILLDNTTTISTFFPNGQKTYNVNGKDIRGWFALDFTADELLANVSLTQNI  147

Query  664   YSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVIN  843
             YSR S+FDG    I TVEDV  + +P   WLNV +DSFY+QH +SM +FV    +   I 
Sbjct  148   YSRPSQFDGM-MPIATVEDVL-ETKPNKFWLNVPYDSFYNQHKISMVSFVEKAVKFAPIP  205

Query  844   YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGIL  1023
             YISSPE+ FLK+I  ++N   TKL+F+FL  +ETEP+T + Y +L++ L  IK+ A+GIL
Sbjct  206   YISSPEIGFLKAIGGKVNKMKTKLIFQFLYPEETEPTTKEKYSALVKQLGMIKSVAAGIL  265

Query  1024  VPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFI  1203
             VPK YIWPV+K++ YL+  T+LV DAHK GLEV+AS FA+DV   ++YS+DP +EYL F+
Sbjct  266   VPKEYIWPVNKNN-YLEAATTLVNDAHKEGLEVHASGFANDVILPYNYSFDPTSEYLQFV  324

Query  1204  DNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYS  1383
             DN  +SVDGVL+DFP T S AI C++  + G K +    L+I+ +GASG YPGCTD AY 
Sbjct  325   DNSQFSVDGVLTDFPPTASEAIACFTQDKNGTKPKKGFPLIITRNGASGIYPGCTDLAYK  384

Query  1384  KAVSDGVDIIDCT  1422
             +AV D  DIIDC+
Sbjct  385   QAVDDEADIIDCS  397



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score =   376 bits (966),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 249/363 (69%), Gaps = 6/363 (2%)
 Frame = +1

Query  337   KWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPD  516
             KW TL+G  P+V+ARGGFSG+FP+SS +A   A  TS   + + C++Q+TKDGVGIC  D
Sbjct  27    KWLTLTGQEPIVVARGGFSGIFPESSASANDMAISTSSPGITLLCNLQMTKDGVGICLSD  86

Query  517   IKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFDGT  693
             ++LDN++ ++TLF   Q TY VNG     WF +D+    + + V+L Q ++SR S FDG 
Sbjct  87    VRLDNSTTISTLFPKGQKTYKVNGQDIKGWFALDYTSDTIFSNVSLVQNIFSRPSIFDGQ  146

Query  694   PQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVNFL  873
                I  VEDV    +PP  WL+VQ++SFY +H LS   ++ S+  R  I ++SSPE+ FL
Sbjct  147   -MPISAVEDVLG-TKPPKFWLSVQYNSFYMEHKLSAAEYLKSLRLR-GIGFVSSPEIGFL  203

Query  874   KSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVD  1053
             KSI        TKL+F     D  E +TN TY  LL NLA+IK FASGIL+PK YIW +D
Sbjct  204   KSIGMDAAKSKTKLIFELREPDMIEATTNTTYNELLTNLATIKQFASGILIPKGYIWALD  263

Query  1054  KSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGV  1233
               + YL+P+T+LV DAHK GLEVYAS FA+D+P +++YSYDP  EYL F+DNG + VDGV
Sbjct  264   P-NKYLKPSTNLVADAHKAGLEVYASGFANDIPTSYNYSYDPSIEYLQFVDNGQFCVDGV  322

Query  1234  LSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDII  1413
             +SDFP T S AI C++H +KG   +    ++I+ +GASGDYPGCTD AY KAV DG DII
Sbjct  323   ISDFPPTASQAISCFAH-QKGHLPKAGHAMIITHNGASGDYPGCTDMAYQKAVEDGADII  381

Query  1414  DCT  1422
             DC+
Sbjct  382   DCS  384


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 138/323 (43%), Gaps = 51/323 (16%)
 Frame = +1

Query  367   LVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVA  546
             ++I   G SG +P  +  AY  A        I+ C VQ++KDG+  C     L  ++   
Sbjct  351   MIITHNGASGDYPGCTDMAYQKAVEDGAD--IIDCSVQMSKDGMAFCQDSADLMPSTTAI  408

Query  547   TLFKDKQSTYLVNGVP----TTAWFPIDFNFKQLTLVNLQ-QGVYSRSSRFDGTPQ----  699
             T F  + ST     VP    T   F  D  + ++  +  Q +  +  S+ F   P     
Sbjct  409   TTFMSRAST-----VPEIQATNGIFSFDLTWAEIISLKPQIESPFLTSTGFQRNPANKNV  463

Query  700   -QILTVEDV--FNKVQP-PGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVIN--------  843
                +T+ D   F K +   G+ +N+Q+ ++ +         V+ V +  +IN        
Sbjct  464   GNFMTLTDFLEFAKAKAVTGVLINIQNAAYLASKK---GIGVVDVVKSALINATLDKQST  520

Query  844   ---YISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFAS  1014
                 I S + + L S     +      + + +G D  +PS  +           IK +A 
Sbjct  521   QKVLIQSDDSSVLTSFQGMPSYSRVLSIDKEIG-DAPKPSVEE-----------IKKYAD  568

Query  1015  GILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEY  1191
              + + ++ +  V  S S+    T++V + HK  + VY S   ++ +  AFDY  DP  E 
Sbjct  569   AVNLKRTSL--VSISHSFTTAKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTVEL  626

Query  1192  LSFIDNGNYSVDGVLSDFPITPS  1260
              +FI  GN  VDGV+++FP T S
Sbjct  627   ATFI-AGN-GVDGVVTEFPATAS  647



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/374 (51%), Positives = 252/374 (67%), Gaps = 4/374 (1%)
 Frame = +1

Query  304   VAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQL  483
              A Q     + KWQTL+G  PLVIARGGFSGLFP++S  A + A   SL     +C++QL
Sbjct  27    AAPQAQGPPSKKWQTLTGQQPLVIARGGFSGLFPEASTYANNMAKSLSLQGSAFFCNLQL  86

Query  484   TKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ-LTLVNLQQG  660
             TKD VGIC  +I LDN + ++  +   Q TY VNG     WF +DF   Q L  V+L Q 
Sbjct  87    TKDSVGICLSNILLDNTTTISMFYPKGQKTYKVNGKDIRGWFALDFTADQVLNNVSLTQN  146

Query  661   VYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVI  840
             +YSR S+FDG    I TVED     +P   WLNVQ+D+FY++H +SM +FV   ++   I
Sbjct  147   IYSRPSQFDGI-LPIATVEDALG-AKPDKFWLNVQYDAFYNEHKISMASFVEKAAKFAPI  204

Query  841   NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGI  1020
              YISSPE+ FLK+I  ++N   TKL+F+FL  +ETEP+T Q Y +L++ L  IK+ A+GI
Sbjct  205   PYISSPEIRFLKAIGGKVNKMRTKLIFQFLDPEETEPTTKQKYSALVKQLGMIKSVAAGI  264

Query  1021  LVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSF  1200
             LVPK YIWPV+K++ Y++  T+LV DAHK GLEV+AS FA+DV   ++YS+DP AEYL F
Sbjct  265   LVPKEYIWPVNKNN-YVEKATTLVNDAHKEGLEVHASGFANDVILPYNYSFDPTAEYLQF  323

Query  1201  IDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAY  1380
             +DN  +SVDG+L+DFP T S AI C+   + G K +    L+I+ +GASG YPG TD AY
Sbjct  324   VDNSQFSVDGLLTDFPPTASEAIACFVQNKNGTKPKTGFPLIITRNGASGIYPGSTDLAY  383

Query  1381  SKAVSDGVDIIDCT  1422
              +AV DG DIIDC+
Sbjct  384   KQAVEDGADIIDCS  397



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score =   376 bits (966),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 264/393 (67%), Gaps = 9/393 (2%)
 Frame = +1

Query  256   LRS--IFNLLLL-CSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAY  426
             LRS  IF+L L  C A        +     KW TL+G  P V+ARGGFSGLFP+SS +A 
Sbjct  2     LRSFIIFSLFLHSCVAAPQTPTAAAAVPAKKWLTLNGQEPGVVARGGFSGLFPESSASAN  61

Query  427   SFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAW  606
             +FA  TS   + M C++Q+TKDGVGIC PDI+LDN++ ++TLF   Q TY VNG     W
Sbjct  62    AFAISTSSPGLTMLCNLQMTKDGVGICLPDIRLDNSTTISTLFPKAQKTYKVNGQDLKGW  121

Query  607   FPIDFNFKQL-TLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYS  783
             F +D++   + + V+L Q ++SR S F+G    I  VEDV    +PP  WL+VQ+DSFY 
Sbjct  122   FALDYSADTIFSNVSLVQNIFSRPSIFNGQ-MPISAVEDVLG-TKPPKFWLSVQYDSFYV  179

Query  784   QHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQ  963
             +H LS   ++ ++  R  I +ISSPE+ FLKSI        TKL+F F   +  EP+TN+
Sbjct  180   EHKLSAAEYLKTLRFR-GITFISSPEIAFLKSIGMDAGMSKTKLIFEFKDPEAIEPTTNK  238

Query  964   TYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFAS  1143
              Y   L +LA+IK FASG+LVPK YIWP+D S++YL+P ++ V DAHK GLEVYAS FA+
Sbjct  239   KYSEFLLDLAAIKAFASGVLVPKDYIWPLD-SANYLKPASTFVADAHKAGLEVYASGFAN  297

Query  1144  DVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFL  1323
             D+  +F+YSYDP AEYL F+DNG +SVDG ++DFP T S AI C SH ++G   +    L
Sbjct  298   DLRTSFNYSYDPSAEYLQFVDNGQFSVDGFITDFPPTASQAISCLSH-QQGNLPKANHAL  356

Query  1324  VISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  1422
             VI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  357   VITHNGASGDYPGCTDLAYQKAVDDGADVIDCS  389



>emb|CDY71959.1| BnaCnng75290D, partial [Brassica napus]
Length=328

 Score =   362 bits (928),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 225/310 (73%), Gaps = 5/310 (2%)
 Frame = +1

Query  274   LLLLCSAVTLVAAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLT  453
             L+L+    T + AQ    S S WQTL+G APL+IARGGFSGL PDSS +AYS    TS++
Sbjct  24    LILIQLLPTQLLAQ---RSKSPWQTLTGSAPLIIARGGFSGLLPDSSVDAYSIVSQTSVS  80

Query  454   NVIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQ  633
             + ++WCDVQLTKDGVGICFPD+K+ NAS++   +  ++++YLVNGVPT  WF IDF  K 
Sbjct  81    DAVLWCDVQLTKDGVGICFPDVKMMNASSIQDAYSKRKNSYLVNGVPTQDWFTIDFTLKD  140

Query  634   LTLVNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
             L  V L +G+ SRS  FD     I TV+D+  +++P   WLNVQHD+FY QHNLS+  F+
Sbjct  141   LKPVFLIRGILSRSDAFDNNQYAISTVQDIAMELKPKSFWLNVQHDAFYGQHNLSISKFL  200

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
             LS+ + V INY+SSPEV FL+SI  R      K VFRFL  D+ E STNQTYG+LL NL 
Sbjct  201   LSLPKTVTINYLSSPEVTFLQSIGGRFGKAGPKFVFRFLEKDDVEVSTNQTYGTLLGNLT  260

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              IKTFASG+LVPKSYIWP++    YL P TS V DAHK GLEVYAS FA+D+  A++YS+
Sbjct  261   FIKTFASGVLVPKSYIWPLE--DQYLSPHTSFVQDAHKAGLEVYASGFANDLDMAYNYSF  318

Query  1174  DPVAEYLSFI  1203
             DP+AEYLSF+
Sbjct  319   DPLAEYLSFM  328



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   376 bits (966),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 250/365 (68%), Gaps = 4/365 (1%)
 Frame = +1

Query  331   TSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICF  510
             T KW TL+G  PLVIARGGFSGLFP+SS  A   A   SL     +C++QLTKD VGIC 
Sbjct  40    TKKWLTLNGQQPLVIARGGFSGLFPESSTYAIDMAKSQSLPGYAFFCNLQLTKDSVGICL  99

Query  511   PDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL-TLVNLQQGVYSRSSRFD  687
              +I LDN + ++  +   Q TY VNG     WF +DF   QL   V+L Q ++SR S FD
Sbjct  100   SNILLDNTTTISMFYPKDQKTYNVNGKDIRGWFALDFTADQLLNNVSLTQNIFSRPSHFD  159

Query  688   GTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFVLSVSRRVVINYISSPEVN  867
             GT   I TVED    ++P   WLNV +D+FYSQH +SM +FV  V R   +NYISSPE+ 
Sbjct  160   GT-LPIATVEDALG-IKPDKFWLNVPYDTFYSQHKISMASFVEKVIRFPSMNYISSPEIG  217

Query  868   FLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPKSYIWP  1047
             FLK++++++N   TKL+F+FL  +ETEP+T Q Y +L++NL  IK+ A+GILVPK YIWP
Sbjct  218   FLKTVSAKVNKGRTKLIFQFLDPEETEPTTKQKYSALVKNLEMIKSVAAGILVPKEYIWP  277

Query  1048  VDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVD  1227
             V+K++ YL+  T+LV +AHK GLEV+AS FA+D+   ++YS+DP AEYL F+D  N+SVD
Sbjct  278   VNKNN-YLEAATTLVTEAHKQGLEVHASGFANDIVLPYNYSFDPTAEYLQFVDQPNFSVD  336

Query  1228  GVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVD  1407
             GVL+DFP T S  I C++      K +    L+I+ +GASG YPG TD AY +AV DG D
Sbjct  337   GVLTDFPPTASETIACFAQNNNATKPKKGLPLIITRNGASGTYPGSTDLAYKQAVDDGAD  396

Query  1408  IIDCT  1422
             IIDC+
Sbjct  397   IIDCS  401


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 140/322 (43%), Gaps = 37/322 (11%)
 Frame = +1

Query  364   PLVIARGGFSGLFPDSSFNAYSFAGLTSLTNVIMWCDVQLTKDGVGICFPDIKLDNASNV  543
             PL+I R G SG +P S+  AY  A        I+ C VQL+ DGV  C   I L++ +N 
Sbjct  367   PLIITRNGASGTYPGSTDLAYKQAVDDGAD--IIDCSVQLSSDGVAFCLDTIDLNSGTNA  424

Query  544   ATLFKDKQSTYLVNGVPTTAWFPIDFNFKQLTLVNLQ------QGVYSRSSRFDGTPQ--  699
              + F  K  T     +P        F+F QL+   +Q      Q  Y    +    P   
Sbjct  425   LSQFMTKSET-----IPELQAEAGVFSF-QLSWDEIQSLKPQIQSPYGTKEKVYRNPANK  478

Query  700   ---QILTVEDV--FNKVQP-PGLWLNVQHDSFY-SQHNLSMRTFVLSVSRRVVINYISSP  858
                +++T+ D   F+K +   G+ +N+++ ++  S+  L +   V S       +  S+ 
Sbjct  479   DVGKLVTLSDFLEFSKTKAVTGILINIENAAYLASKAGLDIVKTVTSALSNATFDKQSTQ  538

Query  859   EVNFLKSIASRINPRV--TKLVFRFLGNDETEPSTNQTYGSLLQNLASIKTFASGILVPK  1032
             +V  +KS  + +  +    K   R L   E      +   +   ++  IK FA  + + K
Sbjct  539   QV-LIKSDDTSVLSKFKDVKTYRRVLNIKE------KISDAPKASVDEIKKFADAVTISK  591

Query  1033  SYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFDYSYDPVAEYLSFIDN  1209
               I  V  S  ++   T++V +     + VY     ++ V   FDY  DP+ E  S+   
Sbjct  592   DSI--VKISDYFISGKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSDPIIEIASYA--  647

Query  1210  GNYSVDGVLSDFPITPSGAIDC  1275
               + VDG+++DFP T +  + C
Sbjct  648   LEFQVDGIVTDFPATANKYMRC  669



>ref|NP_001170117.1| hypothetical protein [Zea mays]
 gb|ACN35879.1| unknown [Zea mays]
Length=713

 Score =   374 bits (961),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 195/383 (51%), Positives = 259/383 (68%), Gaps = 9/383 (2%)
 Frame = +1

Query  286   CSAVTLV---AAQGSTNSTSKWQTLSGDAPLVIARGGFSGLFPDSSFNAYSFAGLTSLTN  456
             C  + LV   AAQG     S ++TLSG APLV+ARGGFSG FPDSS  AYSF    S   
Sbjct  35    CVVMALVGGAAAQGP-RLPSDYKTLSGAAPLVVARGGFSGAFPDSSEGAYSFGASASAPG  93

Query  457   VIMWCDVQLTKDGVGICFPDIKLDNASNVATLFKDKQSTYLVNGVPTTAWFPIDFNFKQL  636
               MWCDVQLTKDGVG+C  D+ + N + V   +  ++ TY+++GV  T WF  DF   +L
Sbjct  94    TAMWCDVQLTKDGVGLCLRDVNMKNCTTVDQTYPGRKRTYVIDGVHKTGWFVPDFTSAEL  153

Query  637   TL-VNLQQGVYSRSSRFDGTPQQILTVEDVFNKVQPPGLWLNVQHDSFYSQHNLSMRTFV  813
                V L Q ++SR+ R DG    I+TV DV + V    +WLNVQH  FY Q +L M +++
Sbjct  154   LQSVYLTQAIWSRTERMDGI-YPIVTVPDVQSIVNTSPIWLNVQHPIFYKQRDLDMSSYI  212

Query  814   LSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLA  993
              S+ + V ++YISSPE+ FL++I++R+  R TKLVF FL     + S NQTYGSL +NL 
Sbjct  213   HSIRKLVRMDYISSPEIGFLRNISARVR-RRTKLVFSFLDKKLLDHSVNQTYGSLARNLT  271

Query  994   SIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSY  1173
              +++ ASGILVPK YIWPV  + +YL P+TS+V +AH+ GLE+YAS F +D    F+YSY
Sbjct  272   FVRSVASGILVPKDYIWPV-TADNYLLPSTSIVTEAHEAGLEIYASGFVNDKAVPFNYSY  330

Query  1174  DPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP-EFLVISFDGASG  1350
             DP+AEYL+F+ +G +SVDGVLSD+PIT S AI C++++   + + V  + LVIS +GASG
Sbjct  331   DPLAEYLNFVGDGGFSVDGVLSDYPITASEAIGCFANLNSSKTDHVTGKPLVISHNGASG  390

Query  1351  DYPGCTDXAYSKAVSDGVDIIDC  1419
             D P CTD AY  AV DG D+IDC
Sbjct  391   DCPDCTDLAYHSAVDDGADVIDC  413



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4268715394240