BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5177

Length=1016
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228630.1|  PREDICTED: cysteine protease ATG4 isoform X2       317   1e-100   Solanum lycopersicum
ref|XP_009761431.1|  PREDICTED: cysteine protease ATG4-like isofo...    317   2e-100   Nicotiana sylvestris
ref|XP_009588897.1|  PREDICTED: cysteine protease ATG4-like isofo...    315   1e-99    Nicotiana tomentosiformis
ref|XP_006354186.1|  PREDICTED: cysteine protease ATG4-like isofo...    313   7e-99    Solanum tuberosum [potatoes]
ref|XP_009761430.1|  PREDICTED: cysteine protease ATG4-like isofo...    308   1e-96    Nicotiana sylvestris
ref|XP_009588896.1|  PREDICTED: cysteine protease ATG4-like isofo...    306   5e-96    Nicotiana tomentosiformis
ref|XP_010316044.1|  PREDICTED: cysteine protease ATG4 isoform X1       305   2e-95    Solanum lycopersicum
ref|XP_006354185.1|  PREDICTED: cysteine protease ATG4-like isofo...    300   1e-93    Solanum tuberosum [potatoes]
ref|XP_011100135.1|  PREDICTED: cysteine protease ATG4-like             272   6e-83    
gb|EYU35704.1|  hypothetical protein MIMGU_mgv1a011057mg                256   2e-79    Erythranthe guttata [common monkey flower]
ref|XP_009354662.1|  PREDICTED: cysteine protease ATG4-like             257   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_010093156.1|  hypothetical protein L484_005165                   253   1e-76    Morus notabilis
ref|XP_009354661.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    255   4e-76    
ref|XP_007217926.1|  hypothetical protein PRUPE_ppa004885mg             253   5e-76    Prunus persica
ref|XP_012081889.1|  PREDICTED: cysteine protease ATG4-like isofo...    253   9e-76    Jatropha curcas
gb|KDO40319.1|  hypothetical protein CISIN_1g011418mg                   248   4e-75    Citrus sinensis [apfelsine]
ref|XP_008346919.1|  PREDICTED: cysteine protease ATG4-like isofo...    250   1e-74    
ref|XP_006441973.1|  hypothetical protein CICLE_v10019906mg             248   5e-74    Citrus clementina [clementine]
ref|XP_008232834.1|  PREDICTED: cysteine protease ATG4                  248   5e-74    Prunus mume [ume]
ref|XP_006478507.1|  PREDICTED: cysteine protease ATG4-like isofo...    248   5e-74    Citrus sinensis [apfelsine]
gb|KDO40316.1|  hypothetical protein CISIN_1g011418mg                   248   5e-74    Citrus sinensis [apfelsine]
ref|XP_008346917.1|  PREDICTED: cysteine protease ATG4-like isofo...    249   7e-74    Malus domestica [apple tree]
emb|CAN81102.1|  hypothetical protein VITISV_021940                     248   8e-74    Vitis vinifera
ref|XP_003635099.1|  PREDICTED: cysteine protease ATG4 isoform X2       248   8e-74    Vitis vinifera
ref|XP_010646415.1|  PREDICTED: cysteine protease ATG4 isoform X1       248   9e-74    Vitis vinifera
gb|EYU31238.1|  hypothetical protein MIMGU_mgv1a004965mg                248   1e-73    Erythranthe guttata [common monkey flower]
ref|XP_011004542.1|  PREDICTED: cysteine protease ATG4-like isofo...    246   2e-73    Populus euphratica
ref|XP_011004543.1|  PREDICTED: cysteine protease ATG4-like isofo...    246   2e-73    Populus euphratica
ref|XP_004138950.1|  PREDICTED: cysteine protease ATG4-like isofo...    245   5e-73    Cucumis sativus [cucumbers]
gb|KDO40318.1|  hypothetical protein CISIN_1g011418mg                   242   5e-73    Citrus sinensis [apfelsine]
ref|XP_011649086.1|  PREDICTED: cysteine protease ATG4-like isofo...    245   5e-73    Cucumis sativus [cucumbers]
ref|XP_011005240.1|  PREDICTED: cysteine protease ATG4-like             245   6e-73    Populus euphratica
ref|XP_002529225.1|  Cysteine protease ATG4B, putative                  245   9e-73    Ricinus communis
ref|XP_006478509.1|  PREDICTED: cysteine protease ATG4-like isofo...    243   2e-72    Citrus sinensis [apfelsine]
ref|XP_010672541.1|  PREDICTED: cysteine protease ATG4                  243   1e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012081892.1|  PREDICTED: cysteine protease ATG4-like isofo...    239   2e-71    Jatropha curcas
ref|XP_006478508.1|  PREDICTED: cysteine protease ATG4-like isofo...    240   2e-71    Citrus sinensis [apfelsine]
ref|XP_006441971.1|  hypothetical protein CICLE_v10019906mg             240   2e-71    
ref|XP_002309707.1|  autophagy 4b family protein                        241   2e-71    Populus trichocarpa [western balsam poplar]
ref|XP_008375115.1|  PREDICTED: cysteine protease ATG4                  241   3e-71    
ref|XP_008441684.1|  PREDICTED: cysteine protease ATG4-like isofo...    241   3e-71    Cucumis melo [Oriental melon]
ref|XP_007139667.1|  hypothetical protein PHAVU_008G048900g             238   2e-70    Phaseolus vulgaris [French bean]
gb|KHN40529.1|  Cysteine protease ATG4                                  238   3e-70    Glycine soja [wild soybean]
gb|KJB46918.1|  hypothetical protein B456_008G001300                    235   3e-70    Gossypium raimondii
ref|XP_007049915.1|  Peptidase family C54 protein isoform 1             239   4e-70    
gb|KJB46920.1|  hypothetical protein B456_008G001300                    235   1e-69    Gossypium raimondii
gb|KJB46917.1|  hypothetical protein B456_008G001300                    235   1e-69    Gossypium raimondii
ref|XP_006372315.1|  autophagy 4b family protein                        236   2e-69    
gb|KJB46915.1|  hypothetical protein B456_008G001300                    236   3e-69    Gossypium raimondii
ref|XP_007049917.1|  Peptidase family C54 protein isoform 3             234   1e-68    
ref|XP_010646416.1|  PREDICTED: cysteine protease ATG4 isoform X3       231   1e-68    Vitis vinifera
gb|EPS69655.1|  hypothetical protein M569_05108                         231   2e-68    Genlisea aurea
gb|KHN11545.1|  Cysteine protease ATG4                                  233   4e-68    Glycine soja [wild soybean]
gb|KHG08139.1|  Cysteine protease ATG4                                  233   9e-68    Gossypium arboreum [tree cotton]
gb|KEH23420.1|  cysteine protease ATG4B                                 229   6e-67    Medicago truncatula
ref|XP_007049916.1|  Peptidase family C54 protein isoform 2             226   1e-66    
ref|XP_010277861.1|  PREDICTED: cysteine protease ATG4-like             229   1e-66    Nelumbo nucifera [Indian lotus]
ref|XP_003624282.1|  Cysteine protease ATG4                             228   2e-66    Medicago truncatula
ref|XP_004492911.1|  PREDICTED: cysteine protease ATG4-like isofo...    226   6e-66    
ref|XP_004492910.1|  PREDICTED: cysteine protease ATG4-like isofo...    226   1e-65    Cicer arietinum [garbanzo]
ref|XP_006397592.1|  hypothetical protein EUTSA_v10001432mg             225   2e-65    Eutrema salsugineum [saltwater cress]
ref|XP_010934835.1|  PREDICTED: cysteine protease ATG4B-like isof...    223   2e-65    Elaeis guineensis
ref|XP_010934834.1|  PREDICTED: cysteine protease ATG4B-like isof...    224   9e-65    
ref|XP_010934833.1|  PREDICTED: cysteine protease ATG4B-like isof...    224   1e-64    Elaeis guineensis
ref|XP_009382779.1|  PREDICTED: cysteine protease ATG4B-like isof...    221   2e-64    
ref|XP_010037856.1|  PREDICTED: cysteine protease ATG4 isoform X1       222   6e-64    Eucalyptus grandis [rose gum]
ref|XP_006397591.1|  hypothetical protein EUTSA_v10001432mg             218   9e-64    Eutrema salsugineum [saltwater cress]
ref|XP_009382778.1|  PREDICTED: cysteine protease ATG4B-like isof...    221   9e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382776.1|  PREDICTED: cysteine protease ATG4B-like isof...    221   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH23421.1|  cysteine protease ATG4B                                 218   1e-63    Medicago truncatula
ref|XP_006855548.1|  PREDICTED: cysteine protease ATG4                  221   1e-63    Amborella trichopoda
ref|XP_008661518.1|  PREDICTED: autophagy-related 4b isoform X2         220   2e-63    
ref|XP_010532400.1|  PREDICTED: cysteine protease ATG4a-like            216   2e-63    
ref|XP_010508335.1|  PREDICTED: cysteine protease ATG4a isoform X2      218   2e-63    
ref|XP_010518001.1|  PREDICTED: cysteine protease ATG4a-like isof...    219   3e-63    Camelina sativa [gold-of-pleasure]
ref|XP_010508333.1|  PREDICTED: cysteine protease ATG4a isoform X1      219   3e-63    Camelina sativa [gold-of-pleasure]
sp|Q75KP8.1|ATG4A_ORYSJ  RecName: Full=Cysteine protease ATG4A; A...    219   4e-63    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001137489.1|  autophagy-related 4b                               219   5e-63    
gb|AAR87272.1|  putative autophagy protein (with alternative spli...    219   9e-63    Oryza sativa Japonica Group [Japonica rice]
gb|AEQ94126.1|  putative cysteine protease                              209   9e-63    Elaeis guineensis
ref|XP_010506319.1|  PREDICTED: cysteine protease ATG4a-like isof...    218   9e-63    Camelina sativa [gold-of-pleasure]
ref|XP_010508336.1|  PREDICTED: cysteine protease ATG4a isoform X3      216   1e-62    Camelina sativa [gold-of-pleasure]
ref|XP_004492912.1|  PREDICTED: cysteine protease ATG4-like isofo...    215   2e-62    
gb|ADT92194.1|  autophagy-related 4b                                    220   3e-62    Zea mays [maize]
ref|XP_006653040.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    217   3e-62    
ref|XP_006294155.1|  hypothetical protein CARUB_v10023148mg             217   3e-62    Capsella rubella
ref|XP_010506322.1|  PREDICTED: cysteine protease ATG4a-like isof...    214   4e-62    Camelina sativa [gold-of-pleasure]
ref|XP_002881949.1|  autophagy 4a                                       216   4e-62    Arabidopsis lyrata subsp. lyrata
ref|XP_010518003.1|  PREDICTED: cysteine protease ATG4a-like isof...    213   9e-62    Camelina sativa [gold-of-pleasure]
ref|XP_003580841.1|  PREDICTED: cysteine protease ATG4B-like            216   2e-61    Brachypodium distachyon [annual false brome]
ref|XP_010037858.1|  PREDICTED: cysteine protease ATG4 isoform X2       212   5e-61    
ref|NP_001054293.1|  Os04g0682000                                       214   5e-61    
sp|A2XHJ5.1|ATG4A_ORYSI  RecName: Full=Cysteine protease ATG4A; A...    213   8e-61    Oryza sativa Indica Group [Indian rice]
ref|NP_973687.1|  cysteine protease ATG4a                               211   2e-60    
emb|CDY17881.1|  BnaC04g03380D                                          212   2e-60    Brassica napus [oilseed rape]
ref|NP_850412.1|  cysteine protease ATG4a                               212   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850722.3|  peptidase family C54 protein                          208   6e-60    Arabidopsis thaliana [mouse-ear cress]
gb|ACJ73913.1|  autophagy-related 4a variant 2                          210   6e-60    Zea mays [maize]
ref|XP_008810459.1|  PREDICTED: cysteine protease ATG4B-like isof...    211   6e-60    Phoenix dactylifera
ref|XP_006294154.1|  hypothetical protein CARUB_v10023148mg             208   7e-60    Capsella rubella
ref|NP_001118859.1|  peptidase family C54 protein                       204   8e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385978.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    210   1e-59    
ref|XP_009142995.1|  PREDICTED: cysteine protease ATG4a isoform X1      210   1e-59    Brassica rapa
sp|Q2XPP4.2|ATG4B_ORYSI  RecName: Full=Cysteine protease ATG4B; A...    210   1e-59    Oryza sativa Indica Group [Indian rice]
emb|CDX79779.1|  BnaA05g03770D                                          209   2e-59    
ref|NP_001137488.1|  autophagy-related 4                                210   2e-59    Zea mays [maize]
gb|EEE61922.1|  hypothetical protein OsJ_16662                          215   3e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960034.1|  PREDICTED: cysteine protease ATG4B-like            209   4e-59    Setaria italica
ref|NP_191554.1|  peptidase family C54 protein                          208   9e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398483.1|  PREDICTED: cysteine protease ATG4B-like            207   2e-58    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78268.1|  hypothetical protein OsI_17962                          211   5e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_009142996.1|  PREDICTED: cysteine protease ATG4a isoform X2      203   7e-58    Brassica rapa
ref|XP_006292861.1|  hypothetical protein CARUB_v10019120mg             205   8e-58    Capsella rubella
ref|XP_010469250.1|  PREDICTED: cysteine protease ATG4b isoform X1      204   2e-57    Camelina sativa [gold-of-pleasure]
emb|CDX89039.1|  BnaA04g01470D                                          203   2e-57    
ref|XP_010469251.1|  PREDICTED: cysteine protease ATG4b isoform X2      204   3e-57    Camelina sativa [gold-of-pleasure]
emb|CAJ86292.1|  H0124B04.9                                             211   3e-57    Oryza sativa [red rice]
ref|XP_002878306.1|  autophagy 4b                                       203   5e-57    
gb|EMS55294.1|  hypothetical protein TRIUR3_04442                       204   6e-57    Triticum urartu
gb|AGW81780.1|  autophagy-related protein 4b                            203   7e-57    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010512286.1|  PREDICTED: cysteine protease ATG4b-like isof...    202   9e-57    Camelina sativa [gold-of-pleasure]
gb|ACN76571.1|  cysteine proteinase                                     202   1e-56    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004290339.1|  PREDICTED: cysteine protease ATG4-like             201   1e-56    Fragaria vesca subsp. vesca
gb|ACN76570.1|  cysteine proteinase                                     202   1e-56    Triticum aestivum [Canadian hard winter wheat]
gb|AGW81779.1|  autophagy-related protein 4a                            202   1e-56    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008810461.1|  PREDICTED: cysteine protease ATG4B-like isof...    200   2e-56    
ref|XP_010413618.1|  PREDICTED: cysteine protease ATG4b-like isof...    200   6e-56    Camelina sativa [gold-of-pleasure]
ref|XP_010512287.1|  PREDICTED: cysteine protease ATG4b-like isof...    198   6e-56    
ref|XP_010469252.1|  PREDICTED: cysteine protease ATG4b isoform X3      198   7e-56    
ref|XP_010469254.1|  PREDICTED: cysteine protease ATG4b isoform X4      197   1e-55    Camelina sativa [gold-of-pleasure]
gb|AFK45336.1|  unknown                                                 200   1e-55    Lotus japonicus
ref|XP_010413619.1|  PREDICTED: cysteine protease ATG4b-like isof...    197   1e-55    Camelina sativa [gold-of-pleasure]
emb|CDY45773.1|  BnaC04g22590D                                          196   1e-54    Brassica napus [oilseed rape]
ref|XP_009138889.1|  PREDICTED: cysteine protease ATG4b isoform X1      194   5e-54    Brassica rapa
ref|XP_009138890.1|  PREDICTED: cysteine protease ATG4b isoform X2      191   3e-53    Brassica rapa
gb|EMT18890.1|  hypothetical protein F775_28054                         190   7e-53    
ref|XP_006402637.1|  hypothetical protein EUTSA_v10005940mg             189   1e-51    Eutrema salsugineum [saltwater cress]
ref|XP_001758116.1|  predicted protein                                  186   1e-51    
emb|CDY41195.1|  BnaA09g38200D                                          186   6e-51    Brassica napus [oilseed rape]
ref|XP_006397589.1|  hypothetical protein EUTSA_v10001432mg             183   1e-50    
ref|XP_008441686.1|  PREDICTED: cysteine protease ATG4-like isofo...    186   1e-50    Cucumis melo [Oriental melon]
ref|XP_006402636.1|  hypothetical protein EUTSA_v10005940mg             182   6e-50    Eutrema salsugineum [saltwater cress]
ref|XP_009116671.1|  PREDICTED: cysteine protease ATG4b isoform X1      181   5e-49    Brassica rapa
gb|AAC23418.1|  unknown protein                                         181   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008661519.1|  PREDICTED: autophagy-related 4b isoform X3         180   1e-48    
ref|XP_009116672.1|  PREDICTED: cysteine protease ATG4b isoform X2      177   5e-48    Brassica rapa
ref|XP_001770869.1|  predicted protein                                  176   5e-48    
ref|XP_002975752.1|  hypothetical protein SELMODRAFT_54753              169   4e-45    
ref|XP_002973701.1|  hypothetical protein SELMODRAFT_54035              169   4e-45    
ref|XP_008668674.1|  PREDICTED: cysteine protease ATG4B-like isof...    171   5e-45    
gb|KJB46919.1|  hypothetical protein B456_008G001300                    161   2e-42    Gossypium raimondii
gb|AAR06350.1|  putative autophagy, 3'-partial                          152   3e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006441972.1|  hypothetical protein CICLE_v10019906mg             144   3e-36    
gb|ACJ73916.1|  autophagy-related 4b variant 4                          140   8e-36    Zea mays [maize]
gb|ACJ73918.1|  autophagy-related 4b variant 6                          141   1e-35    Zea mays [maize]
gb|ACJ73917.1|  autophagy-related 4b variant 5                          140   3e-35    Zea mays [maize]
tpg|DAA48004.1|  TPA: hypothetical protein ZEAMMB73_510335              143   5e-35    
emb|CDX71857.1|  BnaC08g30170D                                          134   1e-34    
gb|AFW57899.1|  hypothetical protein ZEAMMB73_419246                    132   4e-32    
ref|XP_002158689.2|  PREDICTED: cysteine protease ATG4C-like            120   3e-27    Hydra vulgaris
ref|XP_005651667.1|  peptidase C54                                      115   1e-25    Coccomyxa subellipsoidea C-169
ref|XP_008483713.1|  PREDICTED: cysteine protease ATG4B-like            107   3e-24    
ref|NP_001019605.1|  cysteine protease ATG4A                            111   3e-24    Danio rerio [leopard danio]
ref|XP_006679571.1|  hypothetical protein BATDEDRAFT_35298              110   9e-24    Batrachochytrium dendrobatidis JAM81
ref|XP_008193420.1|  PREDICTED: cysteine protease ATG4D isoform X2      109   2e-23    Tribolium castaneum [rust-red flour beetle]
ref|XP_971091.2|  PREDICTED: cysteine protease ATG4D isoform X1         109   2e-23    Tribolium castaneum [rust-red flour beetle]
dbj|BAN21584.1|  autophagy-specific protein, putative                   108   2e-23    Riptortus pedestris
ref|XP_002107680.1|  hypothetical protein TRIADDRAFT_20340              108   3e-23    Trichoplax adhaerens
ref|XP_006814857.1|  PREDICTED: cysteine protease ATG4B-like            108   3e-23    Saccoglossus kowalevskii
gb|ERL94645.1|  hypothetical protein D910_11920                         108   4e-23    Dendroctonus ponderosae
gb|KFB38709.1|  AGAP008497-PA-like protein                              108   5e-23    Anopheles sinensis
ref|XP_008187638.1|  PREDICTED: cysteine protease ATG4B-like            105   6e-23    
ref|XP_001968241.1|  GG24763                                            107   7e-23    Drosophila erecta
gb|ENN76867.1|  hypothetical protein YQE_06708                          107   7e-23    Dendroctonus ponderosae
ref|XP_011407948.1|  PREDICTED: cysteine protease ATG4A-like            108   7e-23    Amphimedon queenslandica
ref|XP_004521908.1|  PREDICTED: cysteine protease ATG4B-like isof...    107   7e-23    Ceratitis capitata [medfly]
emb|CDQ77825.1|  unnamed protein product                                107   9e-23    Oncorhynchus mykiss
ref|XP_002077704.1|  GD23066                                            107   9e-23    Drosophila simulans
ref|NP_608563.1|  Autophagy-specific gene 4a, isoform A                 107   1e-22    Drosophila melanogaster
ref|NP_001259852.1|  Autophagy-specific gene 4a, isoform B              107   1e-22    Drosophila melanogaster
ref|XP_011294432.1|  PREDICTED: cysteine protease ATG4B isoform X2      107   1e-22    
ref|XP_002087497.1|  GE17286                                            107   1e-22    Drosophila yakuba
ref|XP_004521907.1|  PREDICTED: cysteine protease ATG4B-like isof...    107   1e-22    Ceratitis capitata [medfly]
ref|XP_001637280.1|  predicted protein                                  106   1e-22    Nematostella vectensis
ref|XP_002059283.1|  GJ16311                                            106   2e-22    Drosophila virilis
ref|XP_002003544.1|  GI17971                                            106   2e-22    
ref|XP_001961821.1|  GF15159                                            106   2e-22    Drosophila ananassae
gb|EMF09037.1|  putative cysteine protease atg4                         106   2e-22    Sphaerulina musiva SO2202
ref|XP_011294428.1|  PREDICTED: cysteine protease ATG4B isoform X1      107   2e-22    
emb|CDQ73539.1|  unnamed protein product                                106   3e-22    Oncorhynchus mykiss
ref|XP_005432870.1|  PREDICTED: cysteine protease ATG4B-like            102   3e-22    
ref|XP_010893023.1|  PREDICTED: cysteine protease ATG4A                 105   3e-22    Esox lucius
gb|EFB16574.1|  hypothetical protein PANDA_012287                       105   3e-22    Ailuropoda melanoleuca
ref|XP_001947296.2|  PREDICTED: cysteine protease ATG4B-like            105   4e-22    
ref|XP_001356996.1|  GA18177                                            105   4e-22    Drosophila pseudoobscura pseudoobscura
ref|XP_002020652.1|  GL15485                                            105   4e-22    Drosophila persimilis
ref|XP_011228071.1|  PREDICTED: cysteine protease ATG4B isoform X1      105   5e-22    
ref|XP_003744760.1|  PREDICTED: cysteine protease ATG4D-like            105   6e-22    Galendromus occidentalis
ref|XP_011228072.1|  PREDICTED: cysteine protease ATG4B isoform X2      104   6e-22    
ref|XP_007893162.1|  PREDICTED: cysteine protease ATG4A-like            106   6e-22    Callorhinchus milii [Australian ghost shark]
ref|XP_010159254.1|  PREDICTED: cysteine protease ATG4B-like            101   6e-22    Eurypyga helias
gb|KFB41311.1|  AGAP004023-PA-like protein                              106   7e-22    Anopheles sinensis
gb|ACJ73915.1|  autophagy-related 4b variant 3                          100   8e-22    Zea mays [maize]
ref|XP_004695794.1|  PREDICTED: cysteine protease ATG4B-like            103   8e-22    
dbj|GAM28128.1|  hypothetical protein SAMD00019534_113040               104   8e-22    Acytostelium subglobosum LB1
ref|XP_002592932.1|  hypothetical protein BRAFLDRAFT_275700             104   8e-22    Branchiostoma floridae
ref|XP_010133175.1|  PREDICTED: cysteine protease ATG4B-like          99.8    1e-21    Buceros rhinoceros silvestris
ref|XP_007085129.1|  PREDICTED: cysteine protease ATG4B                 103   1e-21    
gb|EHH55320.1|  hypothetical protein EGM_04504                          102   1e-21    Macaca fascicularis [crab eating macaque]
ref|XP_007541517.1|  PREDICTED: cysteine protease ATG4B                 103   1e-21    Poecilia formosa
ref|XP_006760601.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   1e-21    Myotis davidii
ref|XP_008405954.1|  PREDICTED: cysteine protease ATG4B                 103   2e-21    Poecilia reticulata
ref|XP_006935825.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   2e-21    
emb|CDJ26739.1|  cysteine peptidase 1 family C54 protein                103   2e-21    Tityus serrulatus
ref|XP_005811409.1|  PREDICTED: cysteine protease ATG4B-like            103   2e-21    Xiphophorus maculatus
ref|XP_009694027.1|  PREDICTED: cysteine protease ATG4B                 103   2e-21    Cariama cristata
ref|XP_005857739.1|  PREDICTED: cysteine protease ATG4B isoform X7      103   2e-21    Myotis brandtii
ref|XP_006760600.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   2e-21    Myotis davidii
ref|XP_005295819.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   2e-21    Chrysemys picta bellii
ref|XP_002001327.1|  GI10728                                            105   2e-21    
gb|ELK32675.1|  Cysteine protease ATG4B                                 103   2e-21    Myotis davidii
ref|XP_008136708.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   2e-21    
ref|XP_005295820.1|  PREDICTED: cysteine protease ATG4B isoform X3      102   2e-21    
ref|XP_006083076.1|  PREDICTED: cysteine protease ATG4B isoform X3      103   2e-21    Myotis lucifugus
ref|XP_008136707.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   2e-21    
ref|XP_007884820.1|  PREDICTED: cysteine protease ATG4B                 103   2e-21    Callorhinchus milii [Australian ghost shark]
ref|XP_007247106.1|  PREDICTED: cysteine protease ATG4A-like            103   2e-21    
ref|XP_005826417.1|  hypothetical protein GUITHDRAFT_143439             102   3e-21    Guillardia theta CCMP2712
gb|EFX83634.1|  hypothetical protein DAPPUDRAFT_194862                  102   3e-21    Daphnia pulex
ref|XP_007440506.1|  PREDICTED: cysteine protease ATG4B-like          98.6    3e-21    Python bivittatus
ref|XP_001994383.1|  GH16873                                            105   3e-21    Drosophila grimshawi
ref|XP_007067442.1|  PREDICTED: cysteine protease ATG4B                 102   3e-21    
ref|XP_004453683.1|  PREDICTED: cysteine protease ATG4B-like            101   3e-21    
ref|XP_005295818.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   3e-21    Chrysemys picta bellii
ref|XP_011190462.1|  PREDICTED: cysteine protease ATG4B isoform X2      102   3e-21    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_009897776.1|  PREDICTED: cysteine protease ATG4B                 102   3e-21    Picoides pubescens
ref|XP_001993206.1|  GH13687                                            102   3e-21    Drosophila grimshawi
ref|XP_005857738.1|  PREDICTED: cysteine protease ATG4B isoform X6      102   3e-21    Myotis brandtii
ref|XP_006083075.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   3e-21    
ref|XP_009067746.1|  PREDICTED: cysteine protease ATG4B                 102   3e-21    Acanthisitta chloris
ref|XP_002424782.1|  Cysteine protease ATG4A, putative                  102   3e-21    Pediculus humanus corporis [human body lice]
ref|XP_554420.4|  AGAP004023-PA                                         104   4e-21    Anopheles gambiae str. PEST
gb|KFV66587.1|  Cysteine protease ATG4B                                 102   4e-21    Picoides pubescens
gb|EAW71280.1|  ATG4 autophagy related 4 homolog B (S. cerevisiae...    102   4e-21    Homo sapiens [man]
ref|XP_005857735.1|  PREDICTED: cysteine protease ATG4B isoform X3      103   4e-21    
ref|XP_005857736.1|  PREDICTED: cysteine protease ATG4B isoform X4      103   4e-21    Myotis brandtii
ref|XP_005857737.1|  PREDICTED: cysteine protease ATG4B isoform X5      102   4e-21    Myotis brandtii
gb|KFP75007.1|  Cysteine protease ATG4B                                 102   4e-21    Acanthisitta chloris
ref|XP_006083074.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   4e-21    
emb|CBJ33424.1|  Autophagy-related protein 4                            103   4e-21    Ectocarpus siliculosus
pdb|2Z0D|A  Chain A, The Crystal Structure Of Human Atg4b- Lc3(1-...    101   4e-21    Rattus norvegicus [brown rat]
ref|XP_009995536.1|  PREDICTED: cysteine protease ATG4A                 102   5e-21    Chaetura pelagica
ref|XP_005857734.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   5e-21    Myotis brandtii
ref|XP_003973833.2|  PREDICTED: cysteine protease ATG4B                 102   5e-21    Takifugu rubripes [tiger puffer]
gb|KFU89276.1|  Cysteine protease ATG4A                                 102   5e-21    Chaetura pelagica
ref|XP_006935826.1|  PREDICTED: cysteine protease ATG4B isoform X2      102   5e-21    
ref|XP_006822046.1|  PREDICTED: cysteine protease ATG4D-like            102   5e-21    Saccoglossus kowalevskii
ref|XP_010283556.1|  PREDICTED: cysteine protease ATG4B                 102   5e-21    Phaethon lepturus
dbj|BAC86110.1|  unnamed protein product                                102   5e-21    Homo sapiens [man]
ref|XP_007502499.1|  PREDICTED: cysteine protease ATG4B isoform X2      102   5e-21    Monodelphis domestica
ref|XP_007253743.1|  PREDICTED: cysteine protease ATG4B                 100   5e-21    
dbj|BAG64112.1|  unnamed protein product                                103   5e-21    Homo sapiens [man]
ref|XP_003766458.1|  PREDICTED: cysteine protease ATG4B                 102   5e-21    Sarcophilus harrisii
ref|XP_009443005.1|  PREDICTED: cysteine protease ATG4B isoform X2      102   6e-21    
ref|XP_011190459.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   6e-21    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001366892.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   6e-21    
ref|XP_005857733.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   6e-21    Myotis brandtii
ref|XP_011726027.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   6e-21    Macaca nemestrina [pigtail macaque]
ref|XP_005574947.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   6e-21    Macaca fascicularis [crab eating macaque]
ref|XP_004067831.1|  PREDICTED: cysteine protease ATG4B                 101   6e-21    Oryzias latipes [Japanese rice fish]
ref|XP_005501612.1|  PREDICTED: cysteine protease ATG4B isoform X2      100   6e-21    
ref|XP_008048030.1|  PREDICTED: cysteine protease ATG4B                 101   6e-21    
ref|XP_011896498.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   6e-21    Cercocebus atys
ref|XP_003908250.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   6e-21    Papio anubis [baboon]
ref|XP_006750817.1|  PREDICTED: cysteine protease ATG4B                 101   6e-21    Leptonychotes weddellii
ref|XP_003309622.2|  PREDICTED: cysteine protease ATG4B isoform X1      103   7e-21    Pan troglodytes
ref|XP_003813094.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   7e-21    Pan paniscus [bonobo]
ref|XP_007060204.1|  PREDICTED: cysteine protease ATG4A isoform X2      101   7e-21    
ref|XP_001513122.2|  PREDICTED: cysteine protease ATG4B                 102   7e-21    
ref|XP_011207057.1|  PREDICTED: cysteine protease ATG4B isoform X3      101   7e-21    
ref|XP_005028938.1|  PREDICTED: cysteine protease ATG4B                 102   7e-21    
ref|XP_003798310.1|  PREDICTED: cysteine protease ATG4B                 101   7e-21    
ref|XP_002066841.1|  GK24338                                            101   7e-21    
gb|KFV76946.1|  Cysteine protease ATG4B                                 101   7e-21    
ref|XP_009566051.1|  PREDICTED: cysteine protease ATG4B                 101   7e-21    
ref|XP_004743856.1|  PREDICTED: cysteine protease ATG4B                 101   7e-21    
ref|XP_009808038.1|  PREDICTED: cysteine protease ATG4B                 101   7e-21    
ref|XP_009665127.1|  PREDICTED: cysteine protease ATG4B                 101   7e-21    
dbj|BAA76787.2|  KIAA0943 protein                                       101   7e-21    
ref|XP_011593225.1|  PREDICTED: cysteine protease ATG4B isoform X3      101   7e-21    
ref|XP_010986787.1|  PREDICTED: cysteine protease ATG4B                 101   8e-21    
gb|KFV41888.1|  Cysteine protease ATG4B                                 101   8e-21    
ref|XP_010074114.1|  PREDICTED: cysteine protease ATG4B                 101   8e-21    
ref|XP_010177579.1|  PREDICTED: cysteine protease ATG4B                 101   8e-21    
ref|XP_011261074.1|  PREDICTED: cysteine protease ATG4D isoform X2      102   8e-21    
pdb|2D1I|A  Chain A, Structure Of Human Atg4b                           101   8e-21    
ref|XP_009865882.1|  PREDICTED: cysteine protease ATG4B                 101   8e-21    
gb|KGL73452.1|  Cysteine protease ATG4B                                 101   8e-21    
ref|XP_004412764.1|  PREDICTED: cysteine protease ATG4B                 101   8e-21    
gb|KFP60698.1|  Cysteine protease ATG4B                                 101   8e-21    
gb|KFO81215.1|  Cysteine protease ATG4B                                 101   8e-21    
emb|CAB45756.1|  hypothetical protein                                   101   8e-21    
pdb|2CY7|A  Chain A, The Crystal Structure Of Human Atg4b               101   8e-21    
gb|EHH21845.1|  hypothetical protein EGK_04999                          101   9e-21    
ref|XP_001804795.1|  hypothetical protein SNOG_14613                    100   9e-21    
ref|NP_998738.1|  cysteine protease ATG4B                               101   9e-21    
dbj|BAB55353.1|  unnamed protein product                                101   9e-21    
ref|XP_004427815.1|  PREDICTED: cysteine protease ATG4B                 101   9e-21    
ref|XP_008250609.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   9e-21    
ref|NP_847896.1|  cysteine protease ATG4B isoform b                     101   9e-21    
gb|KFP42673.1|  Cysteine protease ATG4A                                 101   9e-21    
ref|XP_011851754.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   9e-21    
gb|KFU96888.1|  Cysteine protease ATG4B                                 101   9e-21    
ref|XP_009939086.1|  PREDICTED: cysteine protease ATG4B                 101   9e-21    
ref|XP_007060203.1|  PREDICTED: cysteine protease ATG4A isoform X1      101   9e-21    
emb|CAG31871.1|  hypothetical protein RCJMB04_12m14                     100   9e-21    
gb|KFP00710.1|  Cysteine protease ATG4A                                 101   9e-21    
ref|XP_005610863.1|  PREDICTED: cysteine protease ATG4B                 101   9e-21    
gb|KFP20661.1|  Cysteine protease ATG4B                                 101   9e-21    
ref|XP_006267092.1|  PREDICTED: cysteine protease ATG4B                 101   9e-21    
ref|XP_010223022.1|  PREDICTED: cysteine protease ATG4B                 101   9e-21    
ref|XP_009891397.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
dbj|BAE88286.1|  unnamed protein product                                101   1e-20    
ref|XP_009947623.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_008688734.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_009461111.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_005636054.1|  PREDICTED: cysteine protease ATG4B                 102   1e-20    
ref|NP_037457.3|  cysteine protease ATG4B isoform a                     101   1e-20    
ref|XP_010894737.1|  PREDICTED: cysteine protease ATG4B isoform X3      101   1e-20    
ref|XP_011726029.1|  PREDICTED: cysteine protease ATG4B isoform X3      101   1e-20    
gb|KFQ30712.1|  Cysteine protease ATG4B                                 101   1e-20    
ref|XP_010171640.1|  PREDICTED: cysteine protease ATG4A                 101   1e-20    
ref|XP_011207054.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   1e-20    
ref|XP_010714852.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_009582022.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_005247050.2|  PREDICTED: cysteine protease ATG4B isoform X6      101   1e-20    
ref|XP_009972179.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|KFP75383.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_011671670.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|KFZ66364.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_011207056.1|  PREDICTED: cysteine protease ATG4B isoform X2      101   1e-20    
ref|XP_006005315.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|KFQ09502.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|NP_001085611.1|  cysteine protease ATG4A                            101   1e-20    
ref|XP_009485376.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_011593224.1|  PREDICTED: cysteine protease ATG4B isoform X2      100   1e-20    
ref|XP_004637502.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
gb|KFZ63517.1|  Cysteine protease ATG4A                                 100   1e-20    
ref|XP_008250610.1|  PREDICTED: cysteine protease ATG4B isoform X2      100   1e-20    
ref|XP_010894736.1|  PREDICTED: cysteine protease ATG4B isoform X2      101   1e-20    
ref|XP_010120189.1|  PREDICTED: cysteine protease ATG4A                 100   1e-20    
ref|XP_003282019.1|  PREDICTED: cysteine protease ATG4B                 102   1e-20    
ref|XP_010559511.1|  PREDICTED: cysteine protease ATG4B isoform X4      100   1e-20    
ref|XP_009321166.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_010894735.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   1e-20    
ref|XP_008928482.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|KFR15583.1|  Cysteine protease ATG4B                                 100   1e-20    
dbj|BAK62366.1|  cysteine protease ATG4B                                100   1e-20    
ref|XP_003292131.1|  hypothetical protein DICPUDRAFT_99239              102   1e-20    
gb|EOA94781.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_011374575.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   1e-20    
ref|XP_002193231.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_010409517.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|EAW71278.1|  ATG4 autophagy related 4 homolog B (S. cerevisiae...    101   1e-20    
gb|KGL99715.1|  Cysteine protease ATG4B                                 100   1e-20    
gb|KFQ01183.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_005151289.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_006034955.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_009512142.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
gb|KFV59860.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_004466399.1|  PREDICTED: cysteine protease ATG4A isoform 2     99.8    1e-20    
ref|XP_011784926.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    102   1e-20    
ref|XP_011593227.1|  PREDICTED: cysteine protease ATG4B isoform X4      100   1e-20    
gb|KFW66276.1|  Cysteine protease ATG4B                                 100   1e-20    
gb|KFQ57113.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_003371512.1|  cysteine protease ATG4B                            101   1e-20    
ref|XP_009995053.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_009087575.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_011261072.1|  PREDICTED: cysteine protease ATG4D isoform X1      102   1e-20    
ref|XP_010020972.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_006902983.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
gb|KFM11419.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_009283293.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|KFW81046.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_005241649.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_005501611.1|  PREDICTED: cysteine protease ATG4B isoform X1      100   1e-20    
gb|KFW86220.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_005247049.2|  PREDICTED: cysteine protease ATG4B isoform X1      100   1e-20    
gb|KFQ63324.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_005529560.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_008491928.1|  PREDICTED: cysteine protease ATG4A                 100   1e-20    
gb|KFW10247.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_004809677.1|  PREDICTED: cysteine protease ATG4B isoform X1      100   1e-20    
ref|XP_009642783.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
gb|KFQ87562.1|  Cysteine protease ATG4B                                 100   1e-20    
gb|KFQ95220.1|  Cysteine protease ATG4B                                 100   1e-20    
gb|KFQ73200.1|  Cysteine protease ATG4B                                 100   1e-20    
ref|XP_005489655.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_005050922.1|  PREDICTED: cysteine protease ATG4B                 101   1e-20    
ref|XP_010298299.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_005425162.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_007931427.1|  hypothetical protein MYCFIDRAFT_191078             101   1e-20    
ref|XP_003218398.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
gb|KFU88942.1|  Cysteine protease ATG4B                                 100   1e-20    
gb|AAS78582.1|  Aut2B1                                                  100   1e-20    
ref|NP_001258916.1|  cysteine protease ATG4A isoform 2                  100   1e-20    
ref|XP_009913625.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20    
ref|XP_006632797.1|  PREDICTED: cysteine protease ATG4A-like isof...    100   1e-20    
ref|XP_006632798.1|  PREDICTED: cysteine protease ATG4A-like isof...    100   1e-20    
ref|NP_001016619.1|  autophagy related 4A, cysteine peptidase           100   1e-20    
gb|EMC77925.1|  Cysteine protease ATG4B                                 100   1e-20    
sp|Q0U199.1|ATG4_PHANO  RecName: Full=Probable cysteine protease ...    101   2e-20    
gb|KFO09663.1|  Cysteine protease ATG4B                                 100   2e-20    
gb|EME39935.1|  hypothetical protein DOTSEDRAFT_47435                   100   2e-20    
ref|XP_008022467.1|  hypothetical protein SETTUDRAFT_37373              101   2e-20    
gb|KFQ84227.1|  Cysteine protease ATG4A                                 100   2e-20    
gb|KFO55958.1|  Cysteine protease ATG4B                                 100   2e-20    
ref|XP_007507011.1|  PREDICTED: cysteine protease ATG4A                 100   2e-20    
gb|ELT88258.1|  hypothetical protein CAPTEDRAFT_225251                  100   2e-20    
gb|EDL39932.1|  autophagy-related 4B (yeast), isoform CRA_a             100   2e-20    
gb|AAH76463.1|  Atg4b protein                                           100   2e-20    
sp|Q8BGE6.2|ATG4B_MOUSE  RecName: Full=Cysteine protease ATG4B; A...    100   2e-20    
gb|AAH27184.1|  Autophagy-related 4B (yeast)                            100   2e-20    
ref|NP_777363.1|  cysteine protease ATG4B                               100   2e-20    
ref|XP_008499103.1|  PREDICTED: cysteine protease ATG4B                 100   2e-20    
ref|NP_001082821.1|  cysteine protease ATG4B                            100   2e-20    
ref|XP_002129793.1|  PREDICTED: cysteine protease ATG4D                 101   2e-20    
gb|KFP06312.1|  Cysteine protease ATG4B                                 100   2e-20    
ref|XP_008627798.1|  PREDICTED: cysteine protease ATG4B                 100   2e-20    
sp|Q6DG88.2|ATG4B_DANRE  RecName: Full=Cysteine protease ATG4B; A...    100   2e-20    
ref|NP_001258915.1|  cysteine protease ATG4A isoform 1                  100   2e-20    
ref|XP_011593223.1|  PREDICTED: cysteine protease ATG4B isoform X1      100   2e-20    
ref|XP_005165980.1|  PREDICTED: cysteine protease ATG4B isoform X1      100   2e-20    
ref|XP_010784097.1|  PREDICTED: cysteine protease ATG4B                 100   2e-20    
ref|XP_010738092.1|  PREDICTED: cysteine protease ATG4B                 100   2e-20    
gb|EGV95335.1|  Cysteine protease ATG4B                                 100   2e-20    
gb|ETE63547.1|  Cysteine protease ATG4B                                 100   2e-20    
gb|KFR04240.1|  Cysteine protease ATG4A                                 100   3e-20    
tpg|DAA30847.1|  TPA: cysteine protease ATG4B                         99.8    3e-20    
ref|XP_011550553.1|  PREDICTED: cysteine protease ATG4D                 100   3e-20    
ref|XP_012012732.1|  PREDICTED: cysteine protease ATG4B isoform X2      101   3e-20    
ref|XP_005077246.1|  PREDICTED: cysteine protease ATG4B               99.8    3e-20    
ref|XP_005411176.1|  PREDICTED: cysteine protease ATG4B isoform X1    99.8    3e-20    
gb|EDL78958.1|  rCG26842                                              97.8    3e-20    
ref|XP_006245595.1|  PREDICTED: cysteine protease ATG4B isoform X1    99.8    3e-20    
ref|XP_007638248.1|  PREDICTED: cysteine protease ATG4B               99.8    3e-20    
ref|XP_008827384.1|  PREDICTED: cysteine protease ATG4B               99.8    3e-20    
gb|ELR52261.1|  Cysteine protease ATG4B                               99.8    3e-20    
ref|XP_001417407.1|  predicted protein                                99.4    3e-20    
ref|XP_004667863.1|  PREDICTED: cysteine protease ATG4B               99.8    3e-20    
ref|XP_003474409.2|  PREDICTED: cysteine protease ATG4B               99.8    3e-20    
ref|XP_004363659.2|  hypothetical protein CAOG_03931                    102   3e-20    
ref|XP_007950616.1|  PREDICTED: cysteine protease ATG4A isoform X2    99.0    3e-20    
gb|KFO22557.1|  Cysteine protease ATG4B                               99.8    3e-20    
ref|XP_011374576.1|  PREDICTED: cysteine protease ATG4B isoform X2    99.8    3e-20    
gb|KFQ90824.1|  Cysteine protease ATG4A                               99.8    3e-20    
ref|XP_005411177.1|  PREDICTED: cysteine protease ATG4B isoform X2    99.8    3e-20    
ref|NP_001001170.1|  cysteine protease ATG4B                          99.8    3e-20    
ref|XP_006110695.1|  PREDICTED: cysteine protease ATG4B               99.8    3e-20    
gb|KFQ29247.1|  Cysteine protease ATG4A                               99.8    3e-20    
gb|EXX64546.1|  Atg4p                                                 99.8    3e-20    
ref|XP_010567317.1|  PREDICTED: cysteine protease ATG4A isoform X2    99.4    3e-20    
ref|XP_004905723.1|  PREDICTED: cysteine protease ATG4B               99.8    4e-20    
ref|XP_008305564.1|  PREDICTED: cysteine protease ATG4B isoform X2    99.4    4e-20    
ref|XP_008276394.1|  PREDICTED: cysteine protease ATG4A isoform X2    99.4    4e-20    
ref|XP_004466398.1|  PREDICTED: cysteine protease ATG4A isoform 1     99.8    4e-20    
ref|XP_009221320.1|  cysteine protease ATG4                             100   4e-20    
ref|XP_005901566.1|  PREDICTED: cysteine protease ATG4B                 100   4e-20    
ref|XP_009943544.1|  PREDICTED: cysteine protease ATG4A               99.8    4e-20    
emb|CDJ26740.1|  cysteine peptidase 2 family C54 protein              99.8    4e-20    
ref|XP_006637839.1|  PREDICTED: cysteine protease ATG4B-like          99.4    4e-20    
ref|XP_006033631.1|  PREDICTED: cysteine protease ATG4A isoform X1    99.4    4e-20    
ref|XP_010831198.1|  PREDICTED: cysteine protease ATG4B                 100   4e-20    
ref|XP_006077233.1|  PREDICTED: cysteine protease ATG4B                 100   4e-20    
ref|XP_009475751.1|  PREDICTED: cysteine protease ATG4A               99.4    4e-20    
gb|ELV12252.1|  Cysteine protease ATG4B                               98.6    4e-20    
ref|XP_010192752.1|  PREDICTED: cysteine protease ATG4A               99.8    4e-20    
ref|XP_008276393.1|  PREDICTED: cysteine protease ATG4A isoform X1    99.4    4e-20    
ref|XP_010559508.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   4e-20    
ref|XP_005148340.1|  PREDICTED: cysteine protease ATG4A isoform X2    99.0    4e-20    
ref|XP_006262731.1|  PREDICTED: cysteine protease ATG4A               97.8    5e-20    
gb|EHB16183.1|  Cysteine protease ATG4B                                 100   5e-20    
gb|KFH68086.1|  hypothetical protein MVEG_06816                         102   5e-20    
ref|XP_004924539.1|  PREDICTED: cysteine protease ATG4D-like          99.8    5e-20    
ref|XP_009477117.1|  PREDICTED: cysteine protease ATG4A               99.0    5e-20    
gb|KFQ59287.1|  Cysteine protease ATG4A                               99.0    5e-20    
gb|KFZ60992.1|  Cysteine protease ATG4A                               99.0    5e-20    
ref|XP_004552916.1|  PREDICTED: cysteine protease ATG4B-like          99.0    5e-20    
gb|KFQ54333.1|  Cysteine protease ATG4A                               99.0    5e-20    
ref|XP_010567315.1|  PREDICTED: cysteine protease ATG4A isoform X1    99.0    5e-20    
gb|KFV86680.1|  Cysteine protease ATG4A                               99.0    5e-20    
ref|XP_010018033.1|  PREDICTED: cysteine protease ATG4A               99.0    5e-20    
ref|XP_010713743.1|  PREDICTED: cysteine protease ATG4A               99.8    5e-20    
gb|KFP91885.1|  Cysteine protease ATG4A                               99.0    5e-20    
ref|XP_004590237.1|  PREDICTED: cysteine protease ATG4A isoform X2    98.6    6e-20    
gb|KFO64299.1|  Cysteine protease ATG4A                               99.0    6e-20    
gb|AAI70397.1|  APG4A protein                                         99.0    6e-20    
gb|KFP10088.1|  Cysteine protease ATG4A                               99.0    6e-20    
ref|XP_005361424.1|  PREDICTED: cysteine protease ATG4B               99.0    6e-20    
ref|XP_004597486.1|  PREDICTED: cysteine protease ATG4B               99.0    6e-20    



>ref|XP_004228630.1| PREDICTED: cysteine protease ATG4 isoform X2 [Solanum lycopersicum]
Length=493

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 179/228 (79%), Gaps = 4/228 (2%)
 Frame = +1

Query  331   QRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWR  510
              + S WSG  VS FS          KG  +K       K+  IGWTSA++R +NSGS+ R
Sbjct  44    NKSSVWSGLLVSPFS----IFDSEPKGCLKKREFCCSKKYNGIGWTSAVKRMINSGSMRR  99

Query  511   ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKG  690
             I G++KTG+P+ S +DIWLLG CYKV QDD  S +PTQS+GFA+FV+DFSSRIL+TYRKG
Sbjct  100   IFGMDKTGMPNGSKSDIWLLGVCYKVVQDDDSSIEPTQSEGFAAFVDDFSSRILVTYRKG  159

Query  691   FAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGD  870
             FAPI ++KYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKS++K LEQ Y+EIL+LFGD
Sbjct  160   FAPIEDTKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSMDKPLEQKYVEILHLFGD  219

Query  871   SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             S ESAYSIHNLLQAGK Y LSPGSWVGPYAMCRTWETLA CKRE+  N
Sbjct  220   SVESAYSIHNLLQAGKTYGLSPGSWVGPYAMCRTWETLARCKREETGN  267



>ref|XP_009761431.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Nicotiana 
sylvestris]
Length=487

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 181/230 (79%), Gaps = 6/230 (3%)
 Frame = +1

Query  331   QRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIG--WTSALRRAMNSGSV  504
             ++ S WSGF VS FS          KG  +KG  S    +  IG  WTSA++R MNSGS+
Sbjct  37    KKSSVWSGFLVSPFS----IFDTEPKGCLKKGDLSSKKYYNGIGINWTSAVKRMMNSGSM  92

Query  505   WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYR  684
              RI G+NKTGIP+ S +DIWLLG CYKV QDD PS +PTQS+GF++FV+DFSSRIL+TYR
Sbjct  93    RRIFGINKTGIPNGSKSDIWLLGVCYKVVQDDDPSIEPTQSEGFSAFVDDFSSRILVTYR  152

Query  685   KGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLF  864
             KGF PIG+SKYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKSL+K  +Q Y+EIL+LF
Sbjct  153   KGFPPIGDSKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSLDKPHDQKYVEILHLF  212

Query  865   GDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             GDSEESA SIHNLLQAGK Y LSPGSWVGPYAMCRTWETLA  KRE+  N
Sbjct  213   GDSEESACSIHNLLQAGKTYGLSPGSWVGPYAMCRTWETLARSKREEMGN  262



>ref|XP_009588897.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=487

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 180/229 (79%), Gaps = 6/229 (3%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIG--WTSALRRAMNSGSVW  507
             + S WSGF VS FS          KG  +KG  S    +  IG  WTSA++R MNSGS+ 
Sbjct  38    KTSVWSGFLVSPFS----IFDTEPKGCLKKGDLSSKKYYNGIGINWTSAVKRMMNSGSMR  93

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             RI G+NKTGIP+ S +DIWLLG CYKV QDD PS +PTQS+GF++FV+DFSSRIL+TYRK
Sbjct  94    RIFGINKTGIPNGSKSDIWLLGVCYKVVQDDDPSIEPTQSEGFSAFVDDFSSRILVTYRK  153

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF PIG+SKYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKSL+K  +Q Y++IL+LFG
Sbjct  154   GFPPIGDSKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSLDKPHDQKYVDILHLFG  213

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             DSEESA SIHNLLQAGK Y LSPGSWVGPYAMCRTWETLA  KRE+  N
Sbjct  214   DSEESACSIHNLLQAGKTYGLSPGSWVGPYAMCRTWETLARSKREETGN  262



>ref|XP_006354186.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Solanum tuberosum]
Length=496

 Score =   313 bits (801),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 180/231 (78%), Gaps = 7/231 (3%)
 Frame = +1

Query  331   QRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKH---YAIGWTSALRRAMNSGS  501
              + S WSG  VS FS          KG  +KG      K+     IGWTSA++R +NSGS
Sbjct  44    NKSSVWSGLLVSPFS----IFDSEPKGCLKKGEFCCSKKYNGIVGIGWTSAVKRMINSGS  99

Query  502   VWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
             + RI G++KTGIP+ S +DIWLLG CYKV QDD  S +PTQS+GF++FV+DFSSRIL+TY
Sbjct  100   MRRIFGMDKTGIPNGSKSDIWLLGVCYKVVQDDDSSIEPTQSEGFSAFVDDFSSRILVTY  159

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGFAPIG++KYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKS++K LE+ Y+EIL+L
Sbjct  160   RKGFAPIGDTKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSMDKPLEEKYVEILHL  219

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             FGDSE SAYSIHNLLQAGK Y LSPGSWVGPYAMCRTWETLA  KRE+  N
Sbjct  220   FGDSEGSAYSIHNLLQAGKTYGLSPGSWVGPYAMCRTWETLARSKREETGN  270



>ref|XP_009761430.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Nicotiana 
sylvestris]
Length=515

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 183/258 (71%), Gaps = 34/258 (13%)
 Frame = +1

Query  331   QRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIG--WTSALRRAMNSGSV  504
             ++ S WSGF VS FS          KG  +KG  S    +  IG  WTSA++R MNSGS+
Sbjct  37    KKSSVWSGFLVSPFS----IFDTEPKGCLKKGDLSSKKYYNGIGINWTSAVKRMMNSGSM  92

Query  505   WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYR  684
              RI G+NKTGIP+ S +DIWLLG CYKV QDD PS +PTQS+GF++FV+DFSSRIL+TYR
Sbjct  93    RRIFGINKTGIPNGSKSDIWLLGVCYKVVQDDDPSIEPTQSEGFSAFVDDFSSRILVTYR  152

Query  685   KGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE----------  834
             KGF PIG+SKYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKSL+K+LE          
Sbjct  153   KGFPPIGDSKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSLDKVLESQNTAVLSVV  212

Query  835   ------------------QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYA  960
                               Q Y+EIL+LFGDSEESA SIHNLLQAGK Y LSPGSWVGPYA
Sbjct  213   KMLNFQFKTTILHSQPHDQKYVEILHLFGDSEESACSIHNLLQAGKTYGLSPGSWVGPYA  272

Query  961   MCRTWETLACCKREDAEN  1014
             MCRTWETLA  KRE+  N
Sbjct  273   MCRTWETLARSKREEMGN  290



>ref|XP_009588896.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=515

 Score =   306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/257 (62%), Positives = 182/257 (71%), Gaps = 34/257 (13%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIG--WTSALRRAMNSGSVW  507
             + S WSGF VS FS          KG  +KG  S    +  IG  WTSA++R MNSGS+ 
Sbjct  38    KTSVWSGFLVSPFS----IFDTEPKGCLKKGDLSSKKYYNGIGINWTSAVKRMMNSGSMR  93

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             RI G+NKTGIP+ S +DIWLLG CYKV QDD PS +PTQS+GF++FV+DFSSRIL+TYRK
Sbjct  94    RIFGINKTGIPNGSKSDIWLLGVCYKVVQDDDPSIEPTQSEGFSAFVDDFSSRILVTYRK  153

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE-----------  834
             GF PIG+SKYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKSL+K+LE           
Sbjct  154   GFPPIGDSKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSLDKVLESQNTAVLSVVK  213

Query  835   -----------------QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAM  963
                              Q Y++IL+LFGDSEESA SIHNLLQAGK Y LSPGSWVGPYAM
Sbjct  214   MLNFQFKTTIFHNQPHDQKYVDILHLFGDSEESACSIHNLLQAGKTYGLSPGSWVGPYAM  273

Query  964   CRTWETLACCKREDAEN  1014
             CRTWETLA  KRE+  N
Sbjct  274   CRTWETLARSKREETGN  290



>ref|XP_010316044.1| PREDICTED: cysteine protease ATG4 isoform X1 [Solanum lycopersicum]
Length=521

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 180/256 (70%), Gaps = 32/256 (13%)
 Frame = +1

Query  331   QRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWR  510
              + S WSG  VS FS          KG  +K       K+  IGWTSA++R +NSGS+ R
Sbjct  44    NKSSVWSGLLVSPFS----IFDSEPKGCLKKREFCCSKKYNGIGWTSAVKRMINSGSMRR  99

Query  511   ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKG  690
             I G++KTG+P+ S +DIWLLG CYKV QDD  S +PTQS+GFA+FV+DFSSRIL+TYRKG
Sbjct  100   IFGMDKTGMPNGSKSDIWLLGVCYKVVQDDDSSIEPTQSEGFAAFVDDFSSRILVTYRKG  159

Query  691   FAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKL--------------  828
             FAPI ++KYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKS++K+              
Sbjct  160   FAPIEDTKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSMDKVLESQNTAVFSVVKM  219

Query  829   --------------LEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMC  966
                           LEQ Y+EIL+LFGDS ESAYSIHNLLQAGK Y LSPGSWVGPYAMC
Sbjct  220   LNFQFRTTIMHNQPLEQKYVEILHLFGDSVESAYSIHNLLQAGKTYGLSPGSWVGPYAMC  279

Query  967   RTWETLACCKREDAEN  1014
             RTWETLA CKRE+  N
Sbjct  280   RTWETLARCKREETGN  295



>ref|XP_006354185.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Solanum tuberosum]
Length=524

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/259 (59%), Positives = 181/259 (70%), Gaps = 35/259 (14%)
 Frame = +1

Query  331   QRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKH---YAIGWTSALRRAMNSGS  501
              + S WSG  VS FS          KG  +KG      K+     IGWTSA++R +NSGS
Sbjct  44    NKSSVWSGLLVSPFS----IFDSEPKGCLKKGEFCCSKKYNGIVGIGWTSAVKRMINSGS  99

Query  502   VWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
             + RI G++KTGIP+ S +DIWLLG CYKV QDD  S +PTQS+GF++FV+DFSSRIL+TY
Sbjct  100   MRRIFGMDKTGIPNGSKSDIWLLGVCYKVVQDDDSSIEPTQSEGFSAFVDDFSSRILVTY  159

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKL-----------  828
             RKGFAPIG++KYT+D  WGCMLRSSQMLVAQALL HRLGRSWRKS++K+           
Sbjct  160   RKGFAPIGDTKYTSDVNWGCMLRSSQMLVAQALLLHRLGRSWRKSMDKVLESQNTAVLSV  219

Query  829   -----------------LEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPY  957
                              LE+ Y+EIL+LFGDSE SAYSIHNLLQAGK Y LSPGSWVGPY
Sbjct  220   VKMLNFQFKTTIMHNQPLEEKYVEILHLFGDSEGSAYSIHNLLQAGKTYGLSPGSWVGPY  279

Query  958   AMCRTWETLACCKREDAEN  1014
             AMCRTWETLA  KRE+  N
Sbjct  280   AMCRTWETLARSKREETGN  298



>ref|XP_011100135.1| PREDICTED: cysteine protease ATG4-like [Sesamum indicum]
Length=528

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  445   KHYAIGWTSALRRAM-NSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQ--DDSPSTD  615
             K+Y  GW +A+RR M N G++ RILG N+TG+ SVS +DIWLLG CY+VAQ  DD+ S D
Sbjct  92    KNYYEGWRAAVRRVMMNGGTMRRILGFNRTGV-SVSKSDIWLLGICYRVAQEGDDANSLD  150

Query  616   PTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRL  795
             P QS+GFA+FVEDFSSR+L TYRKGF+PIG++KYT+D  WGCMLRSSQMLVAQA LFH+L
Sbjct  151   PMQSEGFAAFVEDFSSRLLFTYRKGFSPIGDTKYTSDVYWGCMLRSSQMLVAQAFLFHKL  210

Query  796   GRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTW  975
             GRSWRKS +K L+ +YLEIL+LFGD E+S  SIHNLLQAG  Y L+PGSWVGPYAMCRTW
Sbjct  211   GRSWRKSPDKQLDPSYLEILHLFGDDEDSPCSIHNLLQAGGTYGLAPGSWVGPYAMCRTW  270

Query  976   ETLACCKREDAEN  1014
             E+L   KRE+  N
Sbjct  271   ESLVRNKREEIGN  283



>gb|EYU35704.1| hypothetical protein MIMGU_mgv1a011057mg [Erythranthe guttata]
Length=293

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 177/256 (69%), Gaps = 10/256 (4%)
 Frame = +1

Query  262   SDSNSPDRVpgsgpsfassssaEQRHSFWS-----GFRVSAFSSSGATAAE--HSKGSPR  420
             S  NSP  V          S+ ++  + WS        +   S+S  T +E  +S GS  
Sbjct  25    SPKNSPGSVSSEAEPSIRHSNHKKSEAIWSVIWPTTIPIFGISNSNRTESESKNSGGSVI  84

Query  421   KGASSLIPKHYAIGWTSALRRAMNSG-SVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQD  597
             +  SS   K+Y  GW  A+RR M +G ++ RI G ++    S S ++IWLLG CY+V+Q+
Sbjct  85    RKKSSSGSKNYYEGWRGAVRRVMMNGVTMRRIWGFSR-ATTSSSKSNIWLLGVCYQVSQE  143

Query  598   -DSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQ  774
              +  S+DPTQS+GFA+FVEDFSSR+LITYRKGF+PIG+SKY +D  WGCMLRSSQMLVAQ
Sbjct  144   GEESSSDPTQSEGFAAFVEDFSSRVLITYRKGFSPIGDSKYISDVNWGCMLRSSQMLVAQ  203

Query  775   ALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGP  954
             A L H+LGRSWRKS  K L+Q Y+EIL+LFGD+E+S  S+HNLLQAGKAY L+PGSWVGP
Sbjct  204   AFLVHKLGRSWRKSPHKPLDQTYVEILHLFGDAEDSPCSVHNLLQAGKAYGLAPGSWVGP  263

Query  955   YAMCRTWETLACCKRE  1002
             YAMCRTWE+L     E
Sbjct  264   YAMCRTWESLVSSTTE  279



>ref|XP_009354662.1| PREDICTED: cysteine protease ATG4-like [Pyrus x bretschneideri]
 ref|XP_009354663.1| PREDICTED: cysteine protease ATG4-like [Pyrus x bretschneideri]
Length=487

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 164/229 (72%), Gaps = 14/229 (6%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVW  507
               + S W+ F  SAFS        HS+ S  +   S    +   GWT+A+R+ + SGS+ 
Sbjct  40    HNKASLWTNFFASAFS----IFETHSESSITEKKESHSRNN---GWTAAVRKVVTSGSMR  92

Query  508   RI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILI  675
             RI    LG ++TGI S S  DIWLLG CYKV+QDDS S D   + G  +F +DFSS+IL+
Sbjct  93    RIHERVLGSSRTGISSAS--DIWLLGVCYKVSQDDS-SGDAPINNGLGAFEQDFSSKILM  149

Query  676   TYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEIL  855
             TYRKGF  IG+SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSWR+ L K L++ Y+EIL
Sbjct  150   TYRKGFEAIGDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRRPLHKPLDEAYIEIL  209

Query  856   NLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
               FGDSE S +SIHNLLQAGKAYDL+ GSWVGPYAMCRTWETL  C+RE
Sbjct  210   YHFGDSETSTFSIHNLLQAGKAYDLAAGSWVGPYAMCRTWETLVRCRRE  258



>ref|XP_010093156.1| hypothetical protein L484_005165 [Morus notabilis]
 gb|EXB53615.1| hypothetical protein L484_005165 [Morus notabilis]
Length=444

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 9/192 (5%)
 Frame = +1

Query  460   GWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTD-PTQ  624
             GWT+A+R+A++ GS+     RILG  +TG+ S S +DIWLLG CYK++QD+ PS D P  
Sbjct  34    GWTAAVRKAVSVGSMRRFHERILGYARTGVSS-STSDIWLLGVCYKISQDE-PSVDLPAA  91

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
             + G A F +DFSSRIL+TYRKGF  IG+SKYT+D  WGCMLRSSQMLVAQALLFHRLGR 
Sbjct  92    NSGLADFEQDFSSRILMTYRKGFGAIGDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRC  151

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             WR+ ++  L+Q Y++ILN F DSEESA+SIHNLLQAGKAYDL+ GSW+GPYAMCRTWETL
Sbjct  152   WRRPVQSPLDQEYIDILNHFDDSEESAFSIHNLLQAGKAYDLTAGSWMGPYAMCRTWETL  211

Query  985   ACCKRE--DAEN  1014
                KRE  D EN
Sbjct  212   VRSKREENDFEN  223



>ref|XP_009354661.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4-like [Pyrus 
x bretschneideri]
Length=528

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 162/229 (71%), Gaps = 14/229 (6%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVW  507
               + S WS F  SAFS        HS+ S  +   S    +   GWT+A+R+A+  GS+ 
Sbjct  40    HDKASLWSNFFASAFS----IFETHSESSITEKKESHSRNN---GWTAAVRKAVTIGSMR  92

Query  508   RI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILI  675
             RI    LG  +TGI S S  DIWLLG CYKV+QDDS S D     G  +F +DFSSRIL+
Sbjct  93    RIHERVLGSRRTGISSAS--DIWLLGVCYKVSQDDS-SGDAPIDNGLGAFEQDFSSRILM  149

Query  676   TYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEIL  855
             TYRKGF  IG+SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSWR+ L K L++ Y+EIL
Sbjct  150   TYRKGFEAIGDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRRPLHKPLDEAYIEIL  209

Query  856   NLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
               FGDSE S +SIHNLLQAGKAY+L+ GSWVGPYAMCRTWETL  C+RE
Sbjct  210   YHFGDSETSTFSIHNLLQAGKAYELAAGSWVGPYAMCRTWETLVRCRRE  258



>ref|XP_007217926.1| hypothetical protein PRUPE_ppa004885mg [Prunus persica]
 gb|EMJ19125.1| hypothetical protein PRUPE_ppa004885mg [Prunus persica]
Length=487

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 163/233 (70%), Gaps = 22/233 (9%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFS----SSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNS  495
               + S WS F  SAFS     S ++  E  +   R             GWT A+R+ +  
Sbjct  40    HDKASLWSNFFASAFSIFETHSESSITEKKEIHSRNN-----------GWTEAVRKVVTG  88

Query  496   GSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSS  663
             GS+ RI    LG ++TGI S S  DIWLLG  YKV+QD+S S D   + G  +F +DFSS
Sbjct  89    GSMRRIHERVLGSSRTGISSAS--DIWLLGVLYKVSQDES-SGDAATNNGLRAFEQDFSS  145

Query  664   RILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNY  843
             RIL+TYRKGF  IG+SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSWR++L K L++ Y
Sbjct  146   RILMTYRKGFDAIGDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRRTLHKPLDEQY  205

Query  844   LEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             +EIL+ FGDSE SA+SIHNLLQAGKAYDL+ GSWVGPYAMCR+WETL  CKRE
Sbjct  206   IEILHHFGDSEGSAFSIHNLLQAGKAYDLAAGSWVGPYAMCRSWETLVRCKRE  258



>ref|XP_012081889.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Jatropha curcas]
 ref|XP_012081890.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Jatropha curcas]
 ref|XP_012081891.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Jatropha curcas]
 gb|KDP29532.1| hypothetical protein JCGZ_19245 [Jatropha curcas]
Length=492

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 162/225 (72%), Gaps = 10/225 (4%)
 Frame = +1

Query  343   FWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI---  513
              WS F  +AFS            S +KG+ +        GWTSA+++ +  GS+ RI   
Sbjct  46    LWSSFFTAAFSVFETYRESPPTTSEKKGSHT-----RNNGWTSAVKKIVAGGSMRRIHER  100

Query  514   -LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKG  690
              LG ++TGI S + ++IWLLG CYK++QD S +   T + G A F  DFSSRIL+TYRKG
Sbjct  101   VLGPSRTGI-SNTTSEIWLLGVCYKISQDGSNADAATSNNGLADFTHDFSSRILMTYRKG  159

Query  691   FAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGD  870
             F  IG+SK+T+D GWGCMLRSSQMLVAQALLFH+LGRSWRK ++K L+Q Y+EIL+LFGD
Sbjct  160   FDAIGDSKFTSDVGWGCMLRSSQMLVAQALLFHQLGRSWRKPIQKPLDQKYVEILHLFGD  219

Query  871   SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             SE S +SIHNL+ AGKAY L+ GSWVGPYAMCR+WE LA CKRE+
Sbjct  220   SEASPFSIHNLIHAGKAYGLAAGSWVGPYAMCRSWELLARCKREE  264



>gb|KDO40319.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=392

 Score =   248 bits (633),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GWT+A++R + +GS+ RI    LG ++TGI S S +DIWLLG C+K+AQD++   D   +
Sbjct  77    GWTAAVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLLGVCHKIAQDEALG-DAAGN  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
              G A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLRSSQMLVAQALLFHRLGR W
Sbjct  135   NGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA
Sbjct  195   RKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALA  254

Query  988   CCKRED  1005
              C+R +
Sbjct  255   RCQRAE  260



>ref|XP_008346919.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Malus domestica]
Length=487

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 161/229 (70%), Gaps = 14/229 (6%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVW  507
               + S WS F  SAFS        HS+ S      S    +   GWT+A+R+A++SGS+ 
Sbjct  40    HNKASLWSNFFESAFS----IFETHSESSITDKKESHSRNN---GWTAAVRKAVSSGSMR  92

Query  508   RI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILI  675
             RI    LG ++ GI S S  DIWLLG CYKV+QDDS S D   + G  +F +DFSSRIL+
Sbjct  93    RIQEHVLGSSRIGISSAS--DIWLLGVCYKVSQDDS-SGDAPINNGLGAFEQDFSSRILM  149

Query  676   TYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEIL  855
             TYRKGF  IG SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSW + L K L++ Y+ IL
Sbjct  150   TYRKGFEAIGNSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWTRPLHKPLDEAYIGIL  209

Query  856   NLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
               FGDSE S +SIHNLLQAG+AYDL+ GSWVGPYAMCRTWETL  C+RE
Sbjct  210   YHFGDSETSTFSIHNLLQAGRAYDLAAGSWVGPYAMCRTWETLVRCRRE  258



>ref|XP_006441973.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
 gb|ESR55213.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
Length=486

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GWT+A++R + +GS+ RI    LG ++TGI S S +DIWLLG C+K+AQD++   D   +
Sbjct  77    GWTAAVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLLGVCHKIAQDEALG-DAAGN  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
              G A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLRSSQMLVAQALLFHRLGR W
Sbjct  135   NGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA
Sbjct  195   RKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALA  254

Query  988   CCKRED  1005
              C+R +
Sbjct  255   RCQRAE  260



>ref|XP_008232834.1| PREDICTED: cysteine protease ATG4 [Prunus mume]
Length=487

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 162/229 (71%), Gaps = 14/229 (6%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVW  507
               + S WS F  SAFS    T +E S    ++  S         GWT A+R+ +  GS+ 
Sbjct  40    HDKASLWSNFFASAFSIF-ETHSESSNTEKKEIHSR------NNGWTEAVRKVVTGGSMR  92

Query  508   RI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILI  675
             RI    LG ++TGI S S  DIWLLG  YKV+QD+  S D   + G  +F +DFSSRIL+
Sbjct  93    RIHERVLGSSRTGISSAS--DIWLLGVRYKVSQDEF-SGDAATNNGLRAFEQDFSSRILM  149

Query  676   TYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEIL  855
             TYRKGF  IG+SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSWR+ L K L++ Y+EIL
Sbjct  150   TYRKGFDAIGDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRRPLHKPLDEQYIEIL  209

Query  856   NLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             + FGDSE SA+SIHNLLQ+GKAYDL+ GSWVGPYAMCR+WETL  CKRE
Sbjct  210   HHFGDSEGSAFSIHNLLQSGKAYDLAAGSWVGPYAMCRSWETLVRCKRE  258



>ref|XP_006478507.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Citrus sinensis]
Length=486

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GWT+A++R + +GS+ RI    LG ++TGI S S +DIWLLG C+K+AQD++   D   +
Sbjct  77    GWTAAVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLLGVCHKIAQDEALG-DAAGN  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
              G A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLRSSQMLVAQALLFHRLGR W
Sbjct  135   NGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA
Sbjct  195   RKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALA  254

Query  988   CCKRED  1005
              C+R +
Sbjct  255   RCQRAE  260



>gb|KDO40316.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
 gb|KDO40317.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=486

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 149/186 (80%), Gaps = 6/186 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GWT+A++R + +GS+ RI    LG ++TGI S S +DIWLLG C+K+AQD++   D   +
Sbjct  77    GWTAAVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLLGVCHKIAQDEALG-DAAGN  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
              G A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLRSSQMLVAQALLFHRLGR W
Sbjct  135   NGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA
Sbjct  195   RKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALA  254

Query  988   CCKRED  1005
              C+R +
Sbjct  255   RCQRAE  260



>ref|XP_008346917.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Malus domestica]
 ref|XP_008346918.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Malus domestica]
Length=529

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 161/229 (70%), Gaps = 14/229 (6%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVW  507
               + S WS F  SAFS        HS+ S      S    +   GWT+A+R+A++SGS+ 
Sbjct  40    HNKASLWSNFFESAFS----IFETHSESSITDKKESHSRNN---GWTAAVRKAVSSGSMR  92

Query  508   RI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILI  675
             RI    LG ++ GI S S  DIWLLG CYKV+QDDS S D   + G  +F +DFSSRIL+
Sbjct  93    RIQEHVLGSSRIGISSAS--DIWLLGVCYKVSQDDS-SGDAPINNGLGAFEQDFSSRILM  149

Query  676   TYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEIL  855
             TYRKGF  IG SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSW + L K L++ Y+ IL
Sbjct  150   TYRKGFEAIGNSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWTRPLHKPLDEAYIGIL  209

Query  856   NLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
               FGDSE S +SIHNLLQAG+AYDL+ GSWVGPYAMCRTWETL  C+RE
Sbjct  210   YHFGDSETSTFSIHNLLQAGRAYDLAAGSWVGPYAMCRTWETLVRCRRE  258



>emb|CAN81102.1| hypothetical protein VITISV_021940 [Vitis vinifera]
Length=489

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 162/228 (71%), Gaps = 10/228 (4%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WS    SAFS        +S+ SP       I      GWT+A+R+ +   S+ RI  
Sbjct  37    SLWSSVFASAFS----VFETNSESSPSASEKKAIDNGRNNGWTTAVRKVVTGVSMRRIQE  92

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG +KTGI S S +DIWLLG CYK++Q++S S   + S G A F +DFSSRIL+TYRK
Sbjct  93    RVLGTSKTGISS-STSDIWLLGLCYKISQEES-SNHASSSNGLAEFEQDFSSRILMTYRK  150

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG+SK T+D  WGCMLRSSQMLVAQALL HR+GRSWRK+  K ++Q+Y+EIL+ FG
Sbjct  151   GFEAIGDSKLTSDVNWGCMLRSSQMLVAQALLLHRMGRSWRKTSHKPMDQDYIEILHHFG  210

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DS+ SA+SIHN+LQAGKAY L+ GSWVGPYAMCR+WETLA  KRE+ +
Sbjct  211   DSKASAFSIHNILQAGKAYGLAAGSWVGPYAMCRSWETLARSKREETD  258



>ref|XP_003635099.1| PREDICTED: cysteine protease ATG4 isoform X2 [Vitis vinifera]
 emb|CBI33041.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 162/228 (71%), Gaps = 10/228 (4%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WS    SAFS        +S+ SP       I      GWT+A+R+ +   S+ RI  
Sbjct  37    SLWSSVFASAFS----VFETNSESSPSASEKKAIDNGRNNGWTTAVRKVVTGVSMRRIQE  92

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG +KTGI S S +DIWLLG CYK++Q++S S   + S G A F +DFSSRIL+TYRK
Sbjct  93    RVLGTSKTGISS-STSDIWLLGLCYKISQEES-SNHASSSNGLAEFEQDFSSRILMTYRK  150

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG+SK T+D  WGCMLRSSQMLVAQALL HR+GRSWRK+  K ++Q+Y+EIL+ FG
Sbjct  151   GFEAIGDSKLTSDVNWGCMLRSSQMLVAQALLLHRMGRSWRKTSHKPMDQDYIEILHHFG  210

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DS+ SA+SIHN+LQAGKAY L+ GSWVGPYAMCR+WETLA  KRE+ +
Sbjct  211   DSKASAFSIHNILQAGKAYGLAAGSWVGPYAMCRSWETLARSKREETD  258



>ref|XP_010646415.1| PREDICTED: cysteine protease ATG4 isoform X1 [Vitis vinifera]
Length=489

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 162/228 (71%), Gaps = 10/228 (4%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WS    SAFS        +S+ SP       I      GWT+A+R+ +   S+ RI  
Sbjct  37    SLWSSVFASAFS----VFETNSESSPSASEKKAIDNGRNNGWTTAVRKVVTGVSMRRIQE  92

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG +KTGI S S +DIWLLG CYK++Q++S S   + S G A F +DFSSRIL+TYRK
Sbjct  93    RVLGTSKTGISS-STSDIWLLGLCYKISQEES-SNHASSSNGLAEFEQDFSSRILMTYRK  150

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG+SK T+D  WGCMLRSSQMLVAQALL HR+GRSWRK+  K ++Q+Y+EIL+ FG
Sbjct  151   GFEAIGDSKLTSDVNWGCMLRSSQMLVAQALLLHRMGRSWRKTSHKPMDQDYIEILHHFG  210

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DS+ SA+SIHN+LQAGKAY L+ GSWVGPYAMCR+WETLA  KRE+ +
Sbjct  211   DSKASAFSIHNILQAGKAYGLAAGSWVGPYAMCRSWETLARSKREETD  258



>gb|EYU31238.1| hypothetical protein MIMGU_mgv1a004965mg [Erythranthe guttata]
Length=502

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 172/259 (66%), Gaps = 8/259 (3%)
 Frame = +1

Query  262   SDSNSPDRVpgsgpsfassssaEQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLI  441
             S  NSP  V          S+ E+  + WS    +     G +    S+   R   SS+I
Sbjct  25    SPKNSPGSVSSEAEPSILLSNHEKSEAIWSVIWPTTIPIFGISNGNRSESGSRNSGSSII  84

Query  442   -------PKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQD-  597
                     K+Y  GW  A+RR M +G   R +        S S ++I LLG CY+V+Q+ 
Sbjct  85    RKKSSSGSKNYYEGWRGAVRRVMMNGVTMRRIWGFSRASTSSSKSNICLLGVCYQVSQEG  144

Query  598   DSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQA  777
             +  S+DPTQS+GFA+FVEDFSSR+LITYRKGF+PIG+SKY +D  WGCMLRSSQMLVAQA
Sbjct  145   EESSSDPTQSEGFAAFVEDFSSRVLITYRKGFSPIGDSKYISDVNWGCMLRSSQMLVAQA  204

Query  778   LLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPY  957
              L H+LGRSWRKS  K L+Q Y+EIL+LFGD+E+S  S+HNLLQAGKAY L+PGSWVGPY
Sbjct  205   FLVHKLGRSWRKSPHKPLDQTYVEILHLFGDAEDSPCSVHNLLQAGKAYGLAPGSWVGPY  264

Query  958   AMCRTWETLACCKREDAEN  1014
             AMCRTWE+L   K+E+ +N
Sbjct  265   AMCRTWESLVRNKKEEIDN  283



>ref|XP_011004542.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Populus euphratica]
Length=483

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 165/228 (72%), Gaps = 11/228 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI  513
             R S WS F  SAFS    T  + S  S +K         +  GWTSA+++ +  GS+ RI
Sbjct  42    RPSLWSTFFASAFSVFD-THCDSSSTSEKKAPH----IRHGNGWTSAVKKILAGGSMRRI  96

Query  514   ----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
                 LG +KTGI +++ +DIWLLG CYK++QD+S S D T +   A+F  DFSSRILITY
Sbjct  97    QECVLGTSKTGISNIT-SDIWLLGACYKISQDNS-SGDATATNALAAFNHDFSSRILITY  154

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  I +SK T+D  WGCMLRSSQMLVAQALLFHRLGRSWRK L+K L++ Y+EIL+L
Sbjct  155   RKGFDAIEDSKLTSDVSWGCMLRSSQMLVAQALLFHRLGRSWRKPLDKPLDREYVEILHL  214

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             FGDSE SA+SIHNLL+AGKAY L+ GSWVGPYA+C +WE+L   +RE+
Sbjct  215   FGDSESSAFSIHNLLRAGKAYGLAAGSWVGPYAVCHSWESLVRSRREE  262



>ref|XP_011004543.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Populus euphratica]
Length=482

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 165/228 (72%), Gaps = 11/228 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI  513
             R S WS F  SAFS    T  + S  S +K         +  GWTSA+++ +  GS+ RI
Sbjct  42    RPSLWSTFFASAFSVFD-THCDSSSTSEKKAPH----IRHGNGWTSAVKKILAGGSMRRI  96

Query  514   ----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
                 LG +KTGI +++ +DIWLLG CYK++QD+S S D T +   A+F  DFSSRILITY
Sbjct  97    QECVLGTSKTGISNIT-SDIWLLGACYKISQDNS-SGDATATNALAAFNHDFSSRILITY  154

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  I +SK T+D  WGCMLRSSQMLVAQALLFHRLGRSWRK L+K L++ Y+EIL+L
Sbjct  155   RKGFDAIEDSKLTSDVSWGCMLRSSQMLVAQALLFHRLGRSWRKPLDKPLDREYVEILHL  214

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             FGDSE SA+SIHNLL+AGKAY L+ GSWVGPYA+C +WE+L   +RE+
Sbjct  215   FGDSESSAFSIHNLLRAGKAYGLAAGSWVGPYAVCHSWESLVRSRREE  262



>ref|XP_004138950.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Cucumis sativus]
 gb|KGN61454.1| hypothetical protein Csa_2G128640 [Cucumis sativus]
Length=483

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 158/225 (70%), Gaps = 14/225 (6%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WSGF  S FS       EH K S         P+H    W + +R+ M SGS+ RI  
Sbjct  42    SSWSGFFSSNFS-----IFEHHKDSSVTEKKVFHPRHNV--WAT-VRKVMTSGSMRRIQE  93

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG  ++G+ S S  DIWLLG C+K++QD  P  D   S G A + +DFSSRIL+TYRK
Sbjct  94    RLLGSRRSGVYS-SGGDIWLLGVCHKISQD-HPPDDAASSPGVAGYEQDFSSRILMTYRK  151

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSWRK  +K L++ Y+EIL+LFG
Sbjct  152   GFHVIQDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPLDKEYVEILHLFG  211

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             DSE SA+SIHNLLQAG+AYDL+ GSWVGPYAMCR+WETL   KRE
Sbjct  212   DSETSAFSIHNLLQAGRAYDLAAGSWVGPYAMCRSWETLVRSKRE  256



>gb|KDO40318.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=379

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 156/219 (71%), Gaps = 6/219 (3%)
 Frame = +1

Query  361   VSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI----LGLNK  528
             +  F      +   SK +P     SL      +G +  ++R + +GS+ RI    LG ++
Sbjct  1     MKGFREKAGASKCFSKSTPDTPNRSLASVGSELGSSETVKRLVTAGSMRRIHERVLGPSR  60

Query  529   TGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGE  708
             TGI S S +DIWLLG C+K+AQD++   D   + G A F +DFSSRILI+YRKGF PIG+
Sbjct  61    TGISS-STSDIWLLGVCHKIAQDEALG-DAAGNNGLAEFNQDFSSRILISYRKGFDPIGD  118

Query  709   SKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAY  888
             SK T+D GWGCMLRSSQMLVAQALLFHRLGR WRK L+K  ++ Y+EIL+LFGDSE S +
Sbjct  119   SKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPF  178

Query  889   SIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA C+R +
Sbjct  179   SIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQRAE  217



>ref|XP_011649086.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Cucumis sativus]
Length=483

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 158/225 (70%), Gaps = 14/225 (6%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WSGF  S FS       EH K S         P+H    W + +R+ M SGS+ RI  
Sbjct  42    SSWSGFFSSNFS-----IFEHHKDSSVTEKKVFHPRHNV--WAT-VRKVMTSGSMRRIQE  93

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG  ++G+ S S  DIWLLG C+K++QD  P  D   S G A + +DFSSRIL+TYRK
Sbjct  94    RLLGSRRSGVYS-SGGDIWLLGVCHKISQD-HPPDDAASSPGVAGYEQDFSSRILMTYRK  151

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +SKYT+D  WGCMLRSSQMLVAQALLFHRLGRSWRK  +K L++ Y+EIL+LFG
Sbjct  152   GFNVIQDSKYTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPLDKEYVEILHLFG  211

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             DSE SA+SIHNLLQAG+AYDL+ GSWVGPYAMCR+WETL   KRE
Sbjct  212   DSETSAFSIHNLLQAGRAYDLAAGSWVGPYAMCRSWETLVRSKRE  256



>ref|XP_011005240.1| PREDICTED: cysteine protease ATG4-like [Populus euphratica]
Length=481

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 167/232 (72%), Gaps = 19/232 (8%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSS----SGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGS  501
             + S WS F  SAFS       +++  HS+G        L  +H   GWTS++++ +  G+
Sbjct  41    KPSLWSSFLASAFSVFDIYRDSSSTSHSEG--------LHIRHRN-GWTSSVKKILAGGT  91

Query  502   VWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRI  669
             + RI    LG +KTGI S + +DIW LG CYK++Q DS S +   +   A+F  DFSSRI
Sbjct  92    MRRIQERVLGTSKTGI-SNTTSDIWFLGACYKISQGDS-SGNADATDALAAFHRDFSSRI  149

Query  670   LITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLE  849
             LITYRKGF  I +SK+T+D  WGCMLRSSQMLVAQALLFHRLGRSWRK L+K L+Q+Y+E
Sbjct  150   LITYRKGFDMIEDSKFTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRKPLDKPLDQDYVE  209

Query  850   ILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             IL+LFGDSE SA+SI NLLQAGKAY L+ GSWVGPYAMCR+WE+LA  KRE+
Sbjct  210   ILHLFGDSEASAFSIRNLLQAGKAYGLAAGSWVGPYAMCRSWESLARSKREE  261



>ref|XP_002529225.1| Cysteine protease ATG4B, putative [Ricinus communis]
 gb|EEF33181.1| Cysteine protease ATG4B, putative [Ricinus communis]
Length=489

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 165/226 (73%), Gaps = 13/226 (6%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WS F  SAFS    T  E    S +KG+ S   +H   GWTSA+++ ++ GS+ RI  
Sbjct  41    SLWSSFFASAFSVF-ETYRESPPASEKKGSHS---RHN--GWTSAVKKIVSGGSMRRIHE  94

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG ++TGI S + +DIWLLG CYK+++D+S + D       A F  D+SSRIL+TYR+
Sbjct  95    RVLGPSRTGISSTT-SDIWLLGVCYKISEDESGNAD--TGNALAEFTHDYSSRILMTYRR  151

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG+SKY +D GWGCMLRSSQMLVAQALLFH+LGR+W K  +K ++Q Y+EIL+LFG
Sbjct  152   GFDAIGDSKYISDVGWGCMLRSSQMLVAQALLFHKLGRAWTKPFQKPMDQAYVEILHLFG  211

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             DSE + +SIHNL+QAGKAY L+ GSWVGPYAMCR+WE+LA  KRE+
Sbjct  212   DSEAAPFSIHNLIQAGKAYSLAAGSWVGPYAMCRSWESLARSKREE  257



>ref|XP_006478509.1| PREDICTED: cysteine protease ATG4-like isoform X3 [Citrus sinensis]
 gb|KDO40313.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
 gb|KDO40314.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
 gb|KDO40315.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=443

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 153/205 (75%), Gaps = 6/205 (3%)
 Frame = +1

Query  403   SKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLL  570
             SK +P     SL      +G +  ++R + +GS+ RI    LG ++TGI S S +DIWLL
Sbjct  15    SKSTPDTPNRSLASVGSELGSSETVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLL  73

Query  571   GCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLR  750
             G C+K+AQD++   D   + G A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLR
Sbjct  74    GVCHKIAQDEALG-DAAGNNGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLR  132

Query  751   SSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDL  930
             SSQMLVAQALLFHRLGR WRK L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L
Sbjct  133   SSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGL  192

Query  931   SPGSWVGPYAMCRTWETLACCKRED  1005
             + GSWVGPYAMCR+WE LA C+R +
Sbjct  193   AAGSWVGPYAMCRSWEALARCQRAE  217



>ref|XP_010672541.1| PREDICTED: cysteine protease ATG4 [Beta vulgaris subsp. vulgaris]
Length=502

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 149/200 (75%), Gaps = 7/200 (4%)
 Frame = +1

Query  424   GASSLIPKHYAIGWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVA  591
             GA + I    + GW +A++R M SGS+ RI     G N++ I + S +DIWLLG CYK+ 
Sbjct  84    GAKNKISNSSSNGWGTAVKRIMASGSMRRIKEHMFGFNRSSIIA-STSDIWLLGVCYKL-  141

Query  592   QDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVA  771
              DD+   DP  S GFA+FVEDFSSRIL+TYRKGF PIG+SKYT+D  WGCMLRSSQML A
Sbjct  142   -DDATGGDPVSSSGFAAFVEDFSSRILLTYRKGFDPIGDSKYTSDVNWGCMLRSSQMLAA  200

Query  772   QALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVG  951
             QALL HR GRSWRKS+ + ++Q Y+EIL+ FGDSEESA+SIH LL+AGK Y L+ GSW+G
Sbjct  201   QALLVHRFGRSWRKSVNEQIDQGYIEILHEFGDSEESAFSIHKLLEAGKGYGLAAGSWIG  260

Query  952   PYAMCRTWETLACCKREDAE  1011
             PYA CR +E LA   ++ A+
Sbjct  261   PYATCRAFENLARADKDKAK  280



>ref|XP_012081892.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081893.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081894.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081895.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081896.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081897.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081899.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
Length=399

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG ++TGI S + ++IWLLG CYK++QD S +   T + G A F  DFSSRIL+TYRK
Sbjct  7     RVLGPSRTGI-SNTTSEIWLLGVCYKISQDGSNADAATSNNGLADFTHDFSSRILMTYRK  65

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG+SK+T+D GWGCMLRSSQMLVAQALLFH+LGRSWRK ++K L+Q Y+EIL+LFG
Sbjct  66    GFDAIGDSKFTSDVGWGCMLRSSQMLVAQALLFHQLGRSWRKPIQKPLDQKYVEILHLFG  125

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             DSE S +SIHNL+ AGKAY L+ GSWVGPYAMCR+WE LA CKRE+
Sbjct  126   DSEASPFSIHNLIHAGKAYGLAAGSWVGPYAMCRSWELLARCKREE  171



>ref|XP_006478508.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Citrus sinensis]
Length=444

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 146/183 (80%), Gaps = 6/183 (3%)
 Frame = +1

Query  469   SALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGF  636
             +A++R + +GS+ RI    LG ++TGI S S +DIWLLG C+K+AQD++   D   + G 
Sbjct  38    TAVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLLGVCHKIAQDEALG-DAAGNNGL  95

Query  637   ASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKS  816
             A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLRSSQMLVAQALLFHRLGR WRK 
Sbjct  96    AEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKP  155

Query  817   LEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCK  996
             L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA C+
Sbjct  156   LQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQ  215

Query  997   RED  1005
             R +
Sbjct  216   RAE  218



>ref|XP_006441971.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
 gb|ESR55211.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
Length=444

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 146/183 (80%), Gaps = 6/183 (3%)
 Frame = +1

Query  469   SALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGF  636
             +A++R + +GS+ RI    LG ++TGI S S +DIWLLG C+K+AQD++   D   + G 
Sbjct  38    TAVKRLVTAGSMRRIHERVLGPSRTGISS-STSDIWLLGVCHKIAQDEALG-DAAGNNGL  95

Query  637   ASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKS  816
             A F +DFSSRILI+YRKGF PIG+SK T+D GWGCMLRSSQMLVAQALLFHRLGR WRK 
Sbjct  96    AEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKP  155

Query  817   LEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCK  996
             L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKAY L+ GSWVGPYAMCR+WE LA C+
Sbjct  156   LQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQ  215

Query  997   RED  1005
             R +
Sbjct  216   RAE  218



>ref|XP_002309707.1| autophagy 4b family protein [Populus trichocarpa]
 gb|EEE90157.1| autophagy 4b family protein [Populus trichocarpa]
Length=481

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 164/228 (72%), Gaps = 11/228 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI  513
             + S WS F  SAFS       +  + S     +      ++ GWTS++++ +  G++ RI
Sbjct  41    KPSLWSSFFASAFS-----VFDIYRDSSSTSHNEAPHIRHSNGWTSSVKKIVAGGTMRRI  95

Query  514   ----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
                 LG +KTGI S + +DIWLLG  YK++QDDS S +   +   A+F  DFSSRILITY
Sbjct  96    QERVLGTSKTGI-SNTTSDIWLLGARYKISQDDS-SGNADATNALAAFHRDFSSRILITY  153

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  I +SK T+D  WGCMLRSSQMLVAQALLFHRLGRSWRK ++K L+++Y+EIL+L
Sbjct  154   RKGFDMIEDSKLTSDVNWGCMLRSSQMLVAQALLFHRLGRSWRKPVDKPLDRDYVEILHL  213

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             FGDSE SA+SIHNLLQAGKAY L+ GSWVGPYAMCR+WE+LA  KRE+
Sbjct  214   FGDSEASAFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWESLARSKREE  261



>ref|XP_008375115.1| PREDICTED: cysteine protease ATG4 [Malus domestica]
Length=492

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 158/234 (68%), Gaps = 19/234 (8%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVW  507
               + S WS F  SAFS        HS+ S      S    +   GWT A+R+A+ SGS+ 
Sbjct  40    HNKASLWSNFFXSAFS----IFETHSESSITXKKESHSRNN---GWTXAVRKAVXSGSMR  92

Query  508   RI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILI  675
             RI    LG ++ GI S S  DIWLLG CYKV+QDDS S D   + G  +F +DFSSRIL+
Sbjct  93    RIXEXVLGSSRXGISSAS--DIWLLGVCYKVSQDDS-SGDAPINNGLGAFEQDFSSRILM  149

Query  676   TYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQ-----ALLFHRLGRSWRKSLEKLLEQN  840
             TYRKGF  IG+SKYT+D  WGCMLRSSQMLV Q     ALLFHRLGRSW + L K L++ 
Sbjct  150   TYRKGFEAIGBSKYTSDVNWGCMLRSSQMLVXQXIFLQALLFHRLGRSWXRPLHKPLDEA  209

Query  841   YLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             Y+ IL  FGDSE S +SIHNLLQAG AYDL+ GSWVGPYAMCRTWETL  C+RE
Sbjct  210   YIXILYHFGDSETSTFSIHNLLQAGXAYDLAAGSWVGPYAMCRTWETLVRCRRE  263



>ref|XP_008441684.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Cucumis melo]
Length=483

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 156/225 (69%), Gaps = 14/225 (6%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSV----W  507
             S WSGF  S FS       +H K S          +H    W + +R+ M SGS+     
Sbjct  42    SLWSGFFSSNFS-----ICDHHKDSSVSEKKVFHSRHNV--WAT-VRKVMTSGSMRRIQE  93

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             RILG  ++G+ + S  DIWLLG C+K++QD  P  D   S G A F +DFSSRIL+TYRK
Sbjct  94    RILGSRRSGVYT-SGGDIWLLGVCHKISQDHLPD-DAASSTGVAGFEQDFSSRILMTYRK  151

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +SKYT+D  WGCMLRSSQMLV+QALLFHRLGRSWRK  +K  ++ Y+EIL+LFG
Sbjct  152   GFNVIQDSKYTSDVNWGCMLRSSQMLVSQALLFHRLGRSWRKPSQKPFDKEYVEILHLFG  211

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             DSE SA+SIHNLLQAG+AYDL+ GSWVGPYAMCR+WETL   KRE
Sbjct  212   DSETSAFSIHNLLQAGRAYDLAAGSWVGPYAMCRSWETLVRSKRE  256



>ref|XP_007139667.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
 ref|XP_007139668.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
 gb|ESW11661.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
 gb|ESW11662.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
Length=489

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 147/185 (79%), Gaps = 6/185 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GW +A+R+ + SGS+     R+LG ++T I S S+ DIWLLG C+K++Q +S     T S
Sbjct  79    GWAAAVRKVVTSGSMRRFHERVLGSSRTDISS-SDGDIWLLGVCHKISQQESSGGVDT-S  136

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
              G ASF +DFSS+IL+TYRKGF  IG+SKYT+D  WGCMLRSSQMLVAQAL+FH+LGRSW
Sbjct  137   NGLASFEQDFSSKILVTYRKGFDAIGDSKYTSDVNWGCMLRSSQMLVAQALVFHKLGRSW  196

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK+++K +++ YL+IL LFGDSE SA+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA
Sbjct  197   RKTVDKPVDKEYLKILQLFGDSEASAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLA  256

Query  988   CCKRE  1002
               +RE
Sbjct  257   RIQRE  261



>gb|KHN40529.1| Cysteine protease ATG4 [Glycine soja]
Length=485

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 161/233 (69%), Gaps = 19/233 (8%)
 Frame = +1

Query  334   RHSFWSGFRVSAFS---SSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSV  504
             + S WS    S FS   +   ++A   K  P + +          GW +A+R+ +  GS+
Sbjct  44    KASLWSSIFTSGFSVVETYSESSASEKKAVPSRSS----------GWAAAVRKVVTGGSM  93

Query  505   ----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRIL  672
                  R+LG ++T I S S+ DIWLLG C+K++Q +S + D   S G ASF +DFSS+IL
Sbjct  94    RRFQERVLGSSRTDISS-SDGDIWLLGVCHKISQQES-TGDVDTSNGLASFEQDFSSKIL  151

Query  673   ITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEI  852
             +TYRKGF  IG++KYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK ++K L++ Y+++
Sbjct  152   VTYRKGFDAIGDTKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKPIDKPLDKEYIDV  211

Query  853   LNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             L LFGDSE SA+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  K +  E
Sbjct  212   LQLFGDSEASAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARKKNDLGE  264



>gb|KJB46918.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=392

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 162/230 (70%), Gaps = 11/230 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI  513
             + S WS F  SAFS     +   S  +  + +S         GWT+A++R ++ GS+ RI
Sbjct  40    KTSLWSNFFASAFSVFDTYSESSSSSACERKSSF----SKTNGWTAAVKRVVSGGSMRRI  95

Query  514   ----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
                 LG +K GI S S +DIWLLG CYK++Q+ S   D T +   A+F +DFSSRIL+TY
Sbjct  96    HERVLGPSKIGISS-STSDIWLLGLCYKISQESSGDVDATSA--LAAFKQDFSSRILMTY  152

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  IGE+K T+D+ WGCMLRSSQMLVAQALLFHRLGRSWRK  +K  +  Y+EIL+ 
Sbjct  153   RKGFDAIGETKITSDASWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPFDLAYIEILHQ  212

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             FGDSE SA+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  213   FGDSEASAFSIHNLVEAGKNYGLAAGSWVGPYAMCRSWESLARSKREEID  262



>ref|XP_007049915.1| Peptidase family C54 protein isoform 1 [Theobroma cacao]
 gb|EOX94072.1| Peptidase family C54 protein isoform 1 [Theobroma cacao]
Length=514

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 162/234 (69%), Gaps = 21/234 (9%)
 Frame = +1

Query  334   RHSFWSGFRVSAFS----SSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGS  501
             + S WS    SAFS     S ++A E      R             GWT+A++R ++ GS
Sbjct  41    KSSVWSNLFASAFSIFDTYSESSACEKKALHARNN-----------GWTAAVKRVVSGGS  89

Query  502   VWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRI  669
             + RI    LG +K GI S S +DIWLLG CYK++Q  S S D   S G A+F  DFSSRI
Sbjct  90    MRRIHERVLGPSKIGISS-STSDIWLLGVCYKISQVSS-SGDVDASNGLAAFKRDFSSRI  147

Query  670   LITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLE  849
             L+TYRKGF  IG++K T+D GWGCMLRSSQMLVAQALLFH+LGRSWRK L+K  EQ Y+E
Sbjct  148   LMTYRKGFDAIGDTKITSDFGWGCMLRSSQMLVAQALLFHQLGRSWRKPLQKPFEQAYIE  207

Query  850   ILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             IL+ FGDSE +A+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  208   ILHQFGDSEATAFSIHNLVEAGKIYGLAAGSWVGPYAMCRSWESLARFKREEND  261



>gb|KJB46920.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=429

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 162/230 (70%), Gaps = 11/230 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI  513
             + S WS F  SAFS     +   S  +  + +S         GWT+A++R ++ GS+ RI
Sbjct  40    KTSLWSNFFASAFSVFDTYSESSSSSACERKSSF----SKTNGWTAAVKRVVSGGSMRRI  95

Query  514   ----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
                 LG +K GI S S +DIWLLG CYK++Q+ S   D T +   A+F +DFSSRIL+TY
Sbjct  96    HERVLGPSKIGISS-STSDIWLLGLCYKISQESSGDVDATSA--LAAFKQDFSSRILMTY  152

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  IGE+K T+D+ WGCMLRSSQMLVAQALLFHRLGRSWRK  +K  +  Y+EIL+ 
Sbjct  153   RKGFDAIGETKITSDASWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPFDLAYIEILHQ  212

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             FGDSE SA+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  213   FGDSEASAFSIHNLVEAGKNYGLAAGSWVGPYAMCRSWESLARSKREEID  262



>gb|KJB46917.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=433

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 162/230 (70%), Gaps = 11/230 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI  513
             + S WS F  SAFS     +   S  +  + +S         GWT+A++R ++ GS+ RI
Sbjct  40    KTSLWSNFFASAFSVFDTYSESSSSSACERKSSF----SKTNGWTAAVKRVVSGGSMRRI  95

Query  514   ----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
                 LG +K GI S S +DIWLLG CYK++Q+ S   D T +   A+F +DFSSRIL+TY
Sbjct  96    HERVLGPSKIGISS-STSDIWLLGLCYKISQESSGDVDATSA--LAAFKQDFSSRILMTY  152

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  IGE+K T+D+ WGCMLRSSQMLVAQALLFHRLGRSWRK  +K  +  Y+EIL+ 
Sbjct  153   RKGFDAIGETKITSDASWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPFDLAYIEILHQ  212

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             FGDSE SA+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  213   FGDSEASAFSIHNLVEAGKNYGLAAGSWVGPYAMCRSWESLARSKREEID  262



>ref|XP_006372315.1| autophagy 4b family protein [Populus trichocarpa]
 gb|ERP50112.1| autophagy 4b family protein [Populus trichocarpa]
Length=482

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 161/226 (71%), Gaps = 11/226 (5%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRI--  513
             S WS F  SAFS    T  + S  S +K         +  GWTSA+++ +  GS+ RI  
Sbjct  44    SLWSTFFASAFSVFD-THCDSSSTSEKKAPH----IRHGNGWTSAVKKIVAGGSMRRIQE  98

Query  514   --LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
               LG +KTGI + +  DIWLLG CYK++QD+S S D   +   A+F  DFSSRILITYRK
Sbjct  99    CVLGTSKTGISNTTG-DIWLLGACYKISQDNS-SGDAAATNALAAFNHDFSSRILITYRK  156

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +SK T+D  WGCMLRSSQMLVAQALLFHRLGRSWRK L+K L++ Y+EIL+LFG
Sbjct  157   GFDAIEDSKLTSDVSWGCMLRSSQMLVAQALLFHRLGRSWRKPLDKPLDREYVEILHLFG  216

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             DSE SA+SIHNLL+AGKAY L+ GSWVGPYA+C +WE+L   +RE+
Sbjct  217   DSESSAFSIHNLLRAGKAYGLAAGSWVGPYAVCHSWESLVRSRREE  262



>gb|KJB46915.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
 gb|KJB46916.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
 gb|KJB46921.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=488

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 163/231 (71%), Gaps = 13/231 (6%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGA-TAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWR  510
             + S WS F  SAFS     + +  S    RK + S        GWT+A++R ++ GS+ R
Sbjct  40    KTSLWSNFFASAFSVFDTYSESSSSSACERKSSFS-----KTNGWTAAVKRVVSGGSMRR  94

Query  511   I----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILIT  678
             I    LG +K GI S S +DIWLLG CYK++Q+ S   D T +   A+F +DFSSRIL+T
Sbjct  95    IHERVLGPSKIGISS-STSDIWLLGLCYKISQESSGDVDATSA--LAAFKQDFSSRILMT  151

Query  679   YRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILN  858
             YRKGF  IGE+K T+D+ WGCMLRSSQMLVAQALLFHRLGRSWRK  +K  +  Y+EIL+
Sbjct  152   YRKGFDAIGETKITSDASWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPFDLAYIEILH  211

Query  859   LFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
              FGDSE SA+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  212   QFGDSEASAFSIHNLVEAGKNYGLAAGSWVGPYAMCRSWESLARSKREEID  262



>ref|XP_007049917.1| Peptidase family C54 protein isoform 3 [Theobroma cacao]
 gb|EOX94074.1| Peptidase family C54 protein isoform 3 [Theobroma cacao]
Length=486

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 162/235 (69%), Gaps = 22/235 (9%)
 Frame = +1

Query  334   RHSFWSGFRVSAFS----SSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGS  501
             + S WS    SAFS     S ++A E      R             GWT+A++R ++ GS
Sbjct  41    KSSVWSNLFASAFSIFDTYSESSACEKKALHARNN-----------GWTAAVKRVVSGGS  89

Query  502   VWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRI  669
             + RI    LG +K GI S S +DIWLLG CYK++Q  S S D   S G A+F  DFSSRI
Sbjct  90    MRRIHERVLGPSKIGISS-STSDIWLLGVCYKISQV-SSSGDVDASNGLAAFKRDFSSRI  147

Query  670   LITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQ-ALLFHRLGRSWRKSLEKLLEQNYL  846
             L+TYRKGF  IG++K T+D GWGCMLRSSQMLVAQ ALLFH+LGRSWRK L+K  EQ Y+
Sbjct  148   LMTYRKGFDAIGDTKITSDFGWGCMLRSSQMLVAQQALLFHQLGRSWRKPLQKPFEQAYI  207

Query  847   EILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             EIL+ FGDSE +A+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  208   EILHQFGDSEATAFSIHNLVEAGKIYGLAAGSWVGPYAMCRSWESLARFKREEND  262



>ref|XP_010646416.1| PREDICTED: cysteine protease ATG4 isoform X3 [Vitis vinifera]
 ref|XP_010646417.1| PREDICTED: cysteine protease ATG4 isoform X3 [Vitis vinifera]
Length=403

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG +KTGI S S +DIWLLG CYK++Q++S S   + S G A F +DFSSRIL+TYRK
Sbjct  7     RVLGTSKTGISS-STSDIWLLGLCYKISQEES-SNHASSSNGLAEFEQDFSSRILMTYRK  64

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG+SK T+D  WGCMLRSSQMLVAQALL HR+GRSWRK+  K ++Q+Y+EIL+ FG
Sbjct  65    GFEAIGDSKLTSDVNWGCMLRSSQMLVAQALLLHRMGRSWRKTSHKPMDQDYIEILHHFG  124

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DS+ SA+SIHN+LQAGKAY L+ GSWVGPYAMCR+WETLA  KRE+ +
Sbjct  125   DSKASAFSIHNILQAGKAYGLAAGSWVGPYAMCRSWETLARSKREETD  172



>gb|EPS69655.1| hypothetical protein M569_05108, partial [Genlisea aurea]
Length=403

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = +1

Query  418  RKGASSLIPKHYAIGWTSALRRA-MNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQ  594
            RK +SS   ++Y   W +A+RR  MN GS+ RI G  +    S S  DIWLLG CY+V  
Sbjct  1    RKKSSS--GRNYYDSWRAAVRRVIMNGGSMRRIWGFGRM-WASASKGDIWLLGVCYQVFH  57

Query  595  DDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQ  774
            +   S+DPTQS+GFA+FVED SSRI ITYR+GF PI  SKY +D+ WGCMLRSSQMLVAQ
Sbjct  58   EGDDSSDPTQSEGFAAFVEDLSSRIWITYRRGFLPIENSKYCSDANWGCMLRSSQMLVAQ  117

Query  775  ALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGP  954
            A LFH+LGRSWRK+  +  E  Y+EIL LFGDSEES  SIHNLLQ GKAY L+PGSWVGP
Sbjct  118  AFLFHKLGRSWRKTSNQPHE--YIEILQLFGDSEESPCSIHNLLQVGKAYGLAPGSWVGP  175

Query  955  YAMCRTWETL  984
            YAMCR WE L
Sbjct  176  YAMCRAWECL  185



>gb|KHN11545.1| Cysteine protease ATG4 [Glycine soja]
Length=486

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 157/230 (68%), Gaps = 13/230 (6%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSV---  504
             + S WS    S FS         S  S +K   S      + GW +A+R+ +  GS+   
Sbjct  44    KASLWSNIFTSGFSV--VETYSESSASEKKAVHS-----RSSGWAAAVRKVVTGGSMRRF  96

Query  505   -WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
               R+LG ++T I S S+ DIWLLG C+K++Q +S S     S G ASF +DFSS+IL+TY
Sbjct  97    QERVLGSSRTDISS-SDGDIWLLGVCHKISQQES-SGGVDNSNGLASFEQDFSSKILVTY  154

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  IG++KYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK ++K  ++ Y+++L L
Sbjct  155   RKGFDAIGDTKYTSDVHWGCMLRSSQMLVAQALLFHKLGRSWRKPIDKPPDKEYIDVLQL  214

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             FGDSE SA+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  K +  E
Sbjct  215   FGDSEASAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARKKNDLGE  264



>gb|KHG08139.1| Cysteine protease ATG4 [Gossypium arboreum]
Length=530

 Score =   233 bits (594),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 147/188 (78%), Gaps = 7/188 (4%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GWT+A++R ++ GS+ RI    LG +K GI S S +DIWLLG CYK++Q+ S   D T +
Sbjct  113   GWTAAVKRVVSGGSMRRIHERVLGPSKIGISS-STSDIWLLGLCYKISQESSGDVDATSA  171

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
                A+F +DFSSRIL+TYRKGF  IGE+K T+D+ WGCMLRSSQMLVAQALLFHRLGRSW
Sbjct  172   --LAAFKQDFSSRILMTYRKGFDAIGETKITSDASWGCMLRSSQMLVAQALLFHRLGRSW  229

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK  +K  +  Y+EIL+ FGDSE SA+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA
Sbjct  230   RKPSQKPFDLAYIEILHQFGDSEASAFSIHNLVEAGKNYGLAAGSWVGPYAMCRSWESLA  289

Query  988   CCKREDAE  1011
               KRE+ +
Sbjct  290   RSKREEND  297



>gb|KEH23420.1| cysteine protease ATG4B [Medicago truncatula]
Length=454

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 159/222 (72%), Gaps = 8/222 (4%)
 Frame = +1

Query  358   RVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSV----WRILGLN  525
             + S+ SS+          S + G+S +  ++   GW +A+R+ ++ GS+     R+LG  
Sbjct  14    KCSSKSSTEIVDNTQVPASSKAGSSDIHSRNS--GWAAAVRKVVSGGSMRRFQERVLGSC  71

Query  526   KTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIG  705
             +T + S S+ DIWLLG C+K++Q +S + D      FA+F +DF SRILITYRKGF  I 
Sbjct  72    RTDVSS-SDGDIWLLGVCHKISQHES-TGDVDIRNVFAAFEQDFFSRILITYRKGFDAIE  129

Query  706   ESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESA  885
             +SKYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK+++K +++ Y++IL LFGDSE +A
Sbjct  130   DSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTVDKPVDKEYIDILQLFGDSEAAA  189

Query  886   YSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             +SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  +RE  E
Sbjct  190   FSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQREKNE  231



>ref|XP_007049916.1| Peptidase family C54 protein isoform 2 [Theobroma cacao]
 gb|EOX94073.1| Peptidase family C54 protein isoform 2 [Theobroma cacao]
Length=396

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG +K GI S S +DIWLLG CYK++Q  S S D   S G A+F  DFSSRIL+TYRK
Sbjct  7     RVLGPSKIGISS-STSDIWLLGVCYKISQV-SSSGDVDASNGLAAFKRDFSSRILMTYRK  64

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG++K T+D GWGCMLRSSQMLVAQALLFH+LGRSWRK L+K  EQ Y+EIL+ FG
Sbjct  65    GFDAIGDTKITSDFGWGCMLRSSQMLVAQALLFHQLGRSWRKPLQKPFEQAYIEILHQFG  124

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DSE +A+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  125   DSEATAFSIHNLVEAGKIYGLAAGSWVGPYAMCRSWESLARFKREEND  172



>ref|XP_010277861.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
 ref|XP_010277863.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
 ref|XP_010277864.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
 ref|XP_010277865.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
Length=490

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 142/185 (77%), Gaps = 7/185 (4%)
 Frame = +1

Query  460   GWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GWT+AL++ +  GS+     RILG +KTG+ S S ++IWLLG CYKV+++DS S +    
Sbjct  77    GWTTALKKVLTVGSMRRLQERILGPSKTGVSS-STSEIWLLGVCYKVSEEDS-SGNLVNG  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
              G  +F EDFSSRI +TYRKGF  I +SK+T+D  WGCMLRSSQMLVAQALL H LGRSW
Sbjct  135   NGLVAFTEDFSSRIWMTYRKGFDVI-DSKFTSDVNWGCMLRSSQMLVAQALLVHCLGRSW  193

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK L+   +  Y+EIL+LFGDSE SA+SIHNLLQAGKAY L+ GSW+GPYAMCR+WETL 
Sbjct  194   RKPLQPPFDPEYIEILHLFGDSEASAFSIHNLLQAGKAYGLAAGSWIGPYAMCRSWETLV  253

Query  988   CCKRE  1002
               KRE
Sbjct  254   RSKRE  258



>ref|XP_003624282.1| Cysteine protease ATG4 [Medicago truncatula]
 sp|A2Q1V6.1|ATG4_MEDTR RecName: Full=Cysteine protease ATG4; AltName: Full=Autophagy-related 
protein 4 [Medicago truncatula]
 gb|ABN05923.1| Peptidase C54 [Medicago truncatula]
 gb|AES80500.1| cysteine protease ATG4B [Medicago truncatula]
Length=487

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 145/188 (77%), Gaps = 6/188 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             GW +A+R+ ++ GS+     R+LG  +T + S S+ DIWLLG C+K++Q +S + D    
Sbjct  79    GWAAAVRKVVSGGSMRRFQERVLGSCRTDVSS-SDGDIWLLGVCHKISQHES-TGDVDIR  136

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
               FA+F +DF SRILITYRKGF  I +SKYT+D  WGCMLRSSQMLVAQALLFH+LGRSW
Sbjct  137   NVFAAFEQDFFSRILITYRKGFDAIEDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSW  196

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK+++K +++ Y++IL LFGDSE +A+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA
Sbjct  197   RKTVDKPVDKEYIDILQLFGDSEAAAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLA  256

Query  988   CCKREDAE  1011
               +RE  E
Sbjct  257   RNQREKNE  264



>ref|XP_004492911.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Cicer arietinum]
Length=457

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 156/219 (71%), Gaps = 9/219 (4%)
 Frame = +1

Query  358  RVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWR-----ILGL  522
            + SA SS+          S + G+S +  ++   GW +A+R+ +++G   R     +LG 
Sbjct  14   KCSAKSSTDTVDNTQVPASSKAGSSDIYSRNS--GWAAAVRKVVSAGGSMRRFQERVLGS  71

Query  523  NKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPI  702
            ++T I S S+ D+WLLG C+K++Q +S + D      FA+F +DF S+IL+TYRKGF  I
Sbjct  72   SRTDI-SCSDGDVWLLGVCHKISQQES-TGDVDTRNVFAAFEQDFFSKILVTYRKGFDAI  129

Query  703  GESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEES  882
             +SKYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK+ +K +++ Y++IL LFGDSE +
Sbjct  130  EDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTTDKPVDKEYIDILQLFGDSEAA  189

Query  883  AYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKR  999
            A+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  +R
Sbjct  190  AFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQR  228



>ref|XP_004492910.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Cicer arietinum]
Length=490

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 156/227 (69%), Gaps = 14/227 (6%)
 Frame = +1

Query  334  RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWR-  510
            + S WS F  S FS     +   S  S +K   S        GW +A+R+ +++G   R 
Sbjct  44   KASLWSTFFTSGFSVDETYS--ESSASEKKAVYS-----RNSGWAAAVRKVVSAGGSMRR  96

Query  511  ----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILIT  678
                +LG ++T I S S+ D+WLLG C+K++Q +S + D      FA+F +DF S+IL+T
Sbjct  97   FQERVLGSSRTDI-SCSDGDVWLLGVCHKISQQES-TGDVDTRNVFAAFEQDFFSKILVT  154

Query  679  YRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILN  858
            YRKGF  I +SKYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK+ +K +++ Y++IL 
Sbjct  155  YRKGFDAIEDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTTDKPVDKEYIDILQ  214

Query  859  LFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKR  999
            LFGDSE +A+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  +R
Sbjct  215  LFGDSEAAAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQR  261



>ref|XP_006397592.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39045.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
Length=471

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 145/190 (76%), Gaps = 7/190 (4%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ +++A M SG++     R+LG N+TG+PS + +D+WLLG CYK+++D++ S +   
Sbjct  76    GWTAFVKKAFMTSGAIRRFQERVLGPNRTGLPS-TTSDVWLLGVCYKISEDEA-SGETDD  133

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+F +D+SSRILITYRKGF PI ++ YT+D  WGCMLRSSQML AQALLFHRLGRS
Sbjct  134   GSVLAAFKQDYSSRILITYRKGFEPIKDTTYTSDVNWGCMLRSSQMLFAQALLFHRLGRS  193

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             WR    +  EQ YLE L LFGDSE SA+SIHNL+  G++Y L+ GSW+GPYA+CR+WE+L
Sbjct  194   WRTKKSEPPEQEYLETLELFGDSEASAFSIHNLILVGESYGLAAGSWIGPYAICRSWESL  253

Query  985   ACCKREDAEN  1014
             AC KR+  ++
Sbjct  254   ACKKRKQTDS  263



>ref|XP_010934835.1| PREDICTED: cysteine protease ATG4B-like isoform X3 [Elaeis guineensis]
 ref|XP_010934836.1| PREDICTED: cysteine protease ATG4B-like isoform X3 [Elaeis guineensis]
Length=396

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 164/254 (65%), Gaps = 15/254 (6%)
 Frame = +1

Query  262   SDSNSPDRVpgsgpsfassssaEQRHSFWSGFRVSAFSSSGATAAEHS-KGSPRKGASSL  438
             +DS   DRV       AS + +  + SF S F VS  S        HS +  P K  S  
Sbjct  19    ADSTDTDRVAVKSEQKASHNKS-LKASFLSSFFVSTLSIFETHPESHSGEKKPTKSRS--  75

Query  439   IPKHYAIGWTSALRRAMNSGSVWRI---LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPS  609
                    GWT+A+++ +  GS+ R+   LG + T   S S +DIWLLG CYK++ ++S S
Sbjct  76    ------YGWTTAVKKVVTGGSMRRLQELLGTSSTDALS-STSDIWLLGKCYKLSPEES-S  127

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
                    G A+F+EDFSSRI ITYRKGF  IG+SK+T+D  WGCM+RSSQMLVAQALLFH
Sbjct  128   GGTDHGNGSAAFLEDFSSRIWITYRKGFDAIGDSKFTSDVRWGCMIRSSQMLVAQALLFH  187

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK  +K  +  Y+EIL+LFGDSE  A+SIHNLL+AGKAY L+   WVGPYAMCR
Sbjct  188   HLGRSWRKPSQKPHDSKYIEILHLFGDSEACAFSIHNLLEAGKAYGLAAREWVGPYAMCR  247

Query  970   TWETLACCKREDAE  1011
             TWET+   KRE A+
Sbjct  248   TWETITRAKREQAD  261



>ref|XP_010934834.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Elaeis guineensis]
Length=484

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 164/254 (65%), Gaps = 15/254 (6%)
 Frame = +1

Query  262   SDSNSPDRVpgsgpsfassssaEQRHSFWSGFRVSAFSSSGATAAEHS-KGSPRKGASSL  438
             +DS   DRV       AS + +  + SF S F VS  S        HS +  P K  S  
Sbjct  19    ADSTDTDRVAVKSEQKASHNKS-LKASFLSSFFVSTLSIFETHPESHSGEKKPTKSRS--  75

Query  439   IPKHYAIGWTSALRRAMNSGSVWRI---LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPS  609
                    GWT+A+++ +  GS+ R+   LG + T   S S +DIWLLG CYK++ ++S S
Sbjct  76    ------YGWTTAVKKVVTGGSMRRLQELLGTSSTDALS-STSDIWLLGKCYKLSPEES-S  127

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
                    G A+F+EDFSSRI ITYRKGF  IG+SK+T+D  WGCM+RSSQMLVAQALLFH
Sbjct  128   GGTDHGNGSAAFLEDFSSRIWITYRKGFDAIGDSKFTSDVRWGCMIRSSQMLVAQALLFH  187

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK  +K  +  Y+EIL+LFGDSE  A+SIHNLL+AGKAY L+   WVGPYAMCR
Sbjct  188   HLGRSWRKPSQKPHDSKYIEILHLFGDSEACAFSIHNLLEAGKAYGLAAREWVGPYAMCR  247

Query  970   TWETLACCKREDAE  1011
             TWET+   KRE A+
Sbjct  248   TWETITRAKREQAD  261



>ref|XP_010934833.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Elaeis guineensis]
Length=488

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 164/254 (65%), Gaps = 15/254 (6%)
 Frame = +1

Query  262   SDSNSPDRVpgsgpsfassssaEQRHSFWSGFRVSAFSSSGATAAEHS-KGSPRKGASSL  438
             +DS   DRV       AS + +  + SF S F VS  S        HS +  P K  S  
Sbjct  19    ADSTDTDRVAVKSEQKASHNKS-LKASFLSSFFVSTLSIFETHPESHSGEKKPTKSRS--  75

Query  439   IPKHYAIGWTSALRRAMNSGSVWRI---LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPS  609
                    GWT+A+++ +  GS+ R+   LG + T   S S +DIWLLG CYK++ ++S S
Sbjct  76    ------YGWTTAVKKVVTGGSMRRLQELLGTSSTDALS-STSDIWLLGKCYKLSPEES-S  127

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
                    G A+F+EDFSSRI ITYRKGF  IG+SK+T+D  WGCM+RSSQMLVAQALLFH
Sbjct  128   GGTDHGNGSAAFLEDFSSRIWITYRKGFDAIGDSKFTSDVRWGCMIRSSQMLVAQALLFH  187

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK  +K  +  Y+EIL+LFGDSE  A+SIHNLL+AGKAY L+   WVGPYAMCR
Sbjct  188   HLGRSWRKPSQKPHDSKYIEILHLFGDSEACAFSIHNLLEAGKAYGLAAREWVGPYAMCR  247

Query  970   TWETLACCKREDAE  1011
             TWET+   KRE A+
Sbjct  248   TWETITRAKREQAD  261



>ref|XP_009382779.1| PREDICTED: cysteine protease ATG4B-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=418

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 146/195 (75%), Gaps = 8/195 (4%)
 Frame = +1

Query  445   KHYAIGWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVA-QDDSPS  609
             K  + GWT+A+R+ + SGS+     RILG ++    S++ + IW LG CYK++ ++ S  
Sbjct  72    KSRSYGWTTAVRKVVTSGSMRRLQERILGTSRFDNLSMT-SQIWFLGKCYKLSLEESSQC  130

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
             +DP  S  +A+F+EDFSSRI ITYRKGF PIGESK+T D  WGCM+RSSQMLVAQAL+ H
Sbjct  131   SDPGNS--YAAFLEDFSSRIWITYRKGFEPIGESKFTCDVNWGCMIRSSQMLVAQALILH  188

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK L+K  +  Y+E+L+LFGDS   A+SIHNLLQAG+ Y L+ GSW+GPYA+CR
Sbjct  189   HLGRSWRKPLQKPYDLQYVEVLHLFGDSSTCAFSIHNLLQAGRGYGLAAGSWLGPYAICR  248

Query  970   TWETLACCKREDAEN  1014
             TWETLA   +E AE+
Sbjct  249   TWETLARANKEQAEH  263



>ref|XP_010037856.1| PREDICTED: cysteine protease ATG4 isoform X1 [Eucalyptus grandis]
 ref|XP_010037857.1| PREDICTED: cysteine protease ATG4 isoform X1 [Eucalyptus grandis]
 gb|KCW49636.1| hypothetical protein EUGRSUZ_K03157 [Eucalyptus grandis]
Length=485

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 9/187 (5%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQ  630
             WT+A+R+ +  GS+ RI    LG  +TGI S   +DIWLLG CYK++QD+S      +  
Sbjct  78    WTTAVRKVVTGGSMRRIQERVLGTGRTGI-SNPTSDIWLLGVCYKISQDESSGD---EVP  133

Query  631   GFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR  810
             G  +F +DFSSRI+ITYRKGF  I +S YT+D GWGCMLRSSQMLVAQALLFH LGRSWR
Sbjct  134   GLPAFEQDFSSRIIITYRKGFEAI-DSNYTSDVGWGCMLRSSQMLVAQALLFHHLGRSWR  192

Query  811   KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLAC  990
             K+  K  E  Y +IL+LFGDS  S +SIHNL++AGKAYDL+ GSWVGPYA CR+WE+L  
Sbjct  193   KTSYKPCEPKYADILHLFGDSNASPFSIHNLIRAGKAYDLAAGSWVGPYATCRSWESLVR  252

Query  991   CKREDAE  1011
              KRE A+
Sbjct  253   SKREAAD  259



>ref|XP_006397591.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39044.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
Length=386

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 137/180 (76%), Gaps = 6/180 (3%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++     R+LG N+TG+PS + +D+WLLG CYK+++D++ S +       A+F +D
Sbjct  1     MTSGAIRRFQERVLGPNRTGLPS-TTSDVWLLGVCYKISEDEA-SGETDDGSVLAAFKQD  58

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             +SSRILITYRKGF PI ++ YT+D  WGCMLRSSQML AQALLFHRLGRSWR    +  E
Sbjct  59    YSSRILITYRKGFEPIKDTTYTSDVNWGCMLRSSQMLFAQALLFHRLGRSWRTKKSEPPE  118

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             Q YLE L LFGDSE SA+SIHNL+  G++Y L+ GSW+GPYA+CR+WE+LAC KR+  ++
Sbjct  119   QEYLETLELFGDSEASAFSIHNLILVGESYGLAAGSWIGPYAICRSWESLACKKRKQTDS  178



>ref|XP_009382778.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 146/195 (75%), Gaps = 8/195 (4%)
 Frame = +1

Query  445   KHYAIGWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVA-QDDSPS  609
             K  + GWT+A+R+ + SGS+     RILG ++    S++ + IW LG CYK++ ++ S  
Sbjct  72    KSRSYGWTTAVRKVVTSGSMRRLQERILGTSRFDNLSMT-SQIWFLGKCYKLSLEESSQC  130

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
             +DP  S  +A+F+EDFSSRI ITYRKGF PIGESK+T D  WGCM+RSSQMLVAQAL+ H
Sbjct  131   SDPGNS--YAAFLEDFSSRIWITYRKGFEPIGESKFTCDVNWGCMIRSSQMLVAQALILH  188

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK L+K  +  Y+E+L+LFGDS   A+SIHNLLQAG+ Y L+ GSW+GPYA+CR
Sbjct  189   HLGRSWRKPLQKPYDLQYVEVLHLFGDSSTCAFSIHNLLQAGRGYGLAAGSWLGPYAICR  248

Query  970   TWETLACCKREDAEN  1014
             TWETLA   +E AE+
Sbjct  249   TWETLARANKEQAEH  263



>ref|XP_009382776.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382777.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 146/195 (75%), Gaps = 8/195 (4%)
 Frame = +1

Query  445   KHYAIGWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVA-QDDSPS  609
             K  + GWT+A+R+ + SGS+     RILG ++    S++ + IW LG CYK++ ++ S  
Sbjct  72    KSRSYGWTTAVRKVVTSGSMRRLQERILGTSRFDNLSMT-SQIWFLGKCYKLSLEESSQC  130

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
             +DP  S  +A+F+EDFSSRI ITYRKGF PIGESK+T D  WGCM+RSSQMLVAQAL+ H
Sbjct  131   SDPGNS--YAAFLEDFSSRIWITYRKGFEPIGESKFTCDVNWGCMIRSSQMLVAQALILH  188

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK L+K  +  Y+E+L+LFGDS   A+SIHNLLQAG+ Y L+ GSW+GPYA+CR
Sbjct  189   HLGRSWRKPLQKPYDLQYVEVLHLFGDSSTCAFSIHNLLQAGRGYGLAAGSWLGPYAICR  248

Query  970   TWETLACCKREDAEN  1014
             TWETLA   +E AE+
Sbjct  249   TWETLARANKEQAEH  263



>gb|KEH23421.1| cysteine protease ATG4B [Medicago truncatula]
Length=395

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG  +T + S S+ DIWLLG C+K++Q +S + D      FA+F +DF SRILITYRK
Sbjct  7     RVLGSCRTDVSS-SDGDIWLLGVCHKISQHES-TGDVDIRNVFAAFEQDFFSRILITYRK  64

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +SKYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK+++K +++ Y++IL LFG
Sbjct  65    GFDAIEDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTVDKPVDKEYIDILQLFG  124

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DSE +A+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  +RE  E
Sbjct  125   DSEAAAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQREKNE  172



>ref|XP_006855548.1| PREDICTED: cysteine protease ATG4 [Amborella trichopoda]
 gb|ERN17015.1| hypothetical protein AMTR_s00057p00218370 [Amborella trichopoda]
Length=494

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 149/227 (66%), Gaps = 12/227 (5%)
 Frame = +1

Query  334   RHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSV---  504
             R S WS    S FS         S         + + ++    W++ALRRA+    +   
Sbjct  43    RTSLWSSLVTSPFS------MFESYNESNSSVKTKVLRNRTYRWSAALRRALAGSPMRLL  96

Query  505   -WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
               RILGL KTG+ S SN DIWLLG CYKV+  +S S+D T + G A+F++D SSRI ITY
Sbjct  97    QERILGLCKTGV-SNSNGDIWLLGVCYKVSSGES-SSDLTHANGKAAFLQDLSSRIWITY  154

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  IG+ K T+D+GWGCM+RSSQMLVAQALL H LGRSW K   K  +  Y+ IL+L
Sbjct  155   RKGFETIGDLKLTSDAGWGCMIRSSQMLVAQALLSHHLGRSWSKPTHKPFDPEYVAILHL  214

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             FGDSE S+ SIHNLL+ GK Y L+ GSW+GPYAMCRTWETLA   RE
Sbjct  215   FGDSEASSLSIHNLLKYGKGYGLAAGSWLGPYAMCRTWETLARISRE  261



>ref|XP_008661518.1| PREDICTED: autophagy-related 4b isoform X2 [Zea mays]
Length=466

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = +1

Query  427   ASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSP  606
             ASS  P   +  W+  LRR + SGS+WR+LG  +     +++ D+W LG CY+V+ ++  
Sbjct  77    ASSTKPPSGSYAWSRILRRFVGSGSMWRLLGCARV----LTSGDVWFLGKCYRVSPEEEE  132

Query  607   STDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLF  786
             S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQMLVAQAL+F
Sbjct  133   SGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQMLVAQALIF  192

Query  787   HRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMC  966
             H LGRSWRK  EK  + +Y+ +L+LFGDSE  A+SIHNLLQAG+ Y L+ GSWVGPYAMC
Sbjct  193   HHLGRSWRKPSEKPYDPDYIRVLHLFGDSEACAFSIHNLLQAGRNYGLAAGSWVGPYAMC  252

Query  967   RTWETLACCKREDAE  1011
             R W+TL    RE A+
Sbjct  253   RAWQTLIRTNREQAD  267



>ref|XP_010532400.1| PREDICTED: cysteine protease ATG4a-like [Tarenaya hassleriana]
Length=355

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 139/181 (77%), Gaps = 7/181 (4%)
 Frame = +1

Query  460  GWTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
            GW +A++R  M SG++ R    +LG ++TGI S + ++IWLLG CYK+++D+S S +   
Sbjct  77   GWIAAVKRVFMASGAIRRFQERVLGPSRTGISS-TTSEIWLLGVCYKISEDES-SAEADA  134

Query  625  SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 +F +DFSS+IL+TYRKGF PIG++ YT+D GWGCMLRSSQML AQALLFH LGRS
Sbjct  135  GSVLTAFKQDFSSKILMTYRKGFDPIGDTTYTSDVGWGCMLRSSQMLFAQALLFHTLGRS  194

Query  805  WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
            WR+   +  E  YLE+L LFGDSE SA+SIHNL+QAG+ Y L+ GSWVGPYA+CR+WE+L
Sbjct  195  WRRKENQPPEPEYLEVLELFGDSEASAFSIHNLIQAGQLYGLAVGSWVGPYAVCRSWESL  254

Query  985  A  987
            A
Sbjct  255  A  255



>ref|XP_010508335.1| PREDICTED: cysteine protease ATG4a isoform X2 [Camelina sativa]
Length=427

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 9/191 (5%)
 Frame = +1

Query  460   GWTSAL--RRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPT  621
             GWT+A   R  M +G++     R+LG N+TG+PS + +DIWLLG CYK+++D++ S D  
Sbjct  31    GWTAAFVKRAFMATGAIRRFQERVLGPNRTGLPSTT-SDIWLLGVCYKISEDEA-SGDTD  88

Query  622   QSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGR  801
                  A+F +DFSS+ILI+YRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGR
Sbjct  89    AGSVLAAFHQDFSSKILISYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGR  148

Query  802   SWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWET  981
             SW +  E L EQ YLE L  FGDSE SA+SIHNL++AG++Y L+ GSW+GPYA+CR+WE+
Sbjct  149   SWTRKSE-LPEQEYLETLEPFGDSESSAFSIHNLIKAGESYGLAAGSWIGPYAICRSWES  207

Query  982   LACCKREDAEN  1014
             LAC KR+  ++
Sbjct  208   LACKKRKQTDS  218



>ref|XP_010518001.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
 ref|XP_010518002.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
Length=472

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 145/190 (76%), Gaps = 8/190 (4%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ ++RA M +G++     R+LG N+TG+PS + +DIWLLG CYK+++D++ S D   
Sbjct  77    GWTAFVKRAFMATGAIRRFQERVLGPNRTGLPSTT-SDIWLLGVCYKISEDEA-SGDTDA  134

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+F  DFSS+ILITYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGRS
Sbjct  135   GSVLAAFHLDFSSKILITYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRS  194

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             W +  E L EQ YLE L  FGDS+ SA+SIHNL++AG++Y L+ GSW+GPYA+CR+WE+L
Sbjct  195   WTRKSE-LPEQEYLETLEPFGDSKTSAFSIHNLIKAGESYGLAAGSWIGPYAICRSWESL  253

Query  985   ACCKREDAEN  1014
             AC KR+  ++
Sbjct  254   ACKKRKQTDS  263



>ref|XP_010508333.1| PREDICTED: cysteine protease ATG4a isoform X1 [Camelina sativa]
Length=474

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 9/191 (5%)
 Frame = +1

Query  460   GWTSAL--RRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPT  621
             GWT+A   R  M +G++     R+LG N+TG+PS + +DIWLLG CYK+++D++ S D  
Sbjct  78    GWTAAFVKRAFMATGAIRRFQERVLGPNRTGLPSTT-SDIWLLGVCYKISEDEA-SGDTD  135

Query  622   QSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGR  801
                  A+F +DFSS+ILI+YRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGR
Sbjct  136   AGSVLAAFHQDFSSKILISYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGR  195

Query  802   SWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWET  981
             SW +  E L EQ YLE L  FGDSE SA+SIHNL++AG++Y L+ GSW+GPYA+CR+WE+
Sbjct  196   SWTRKSE-LPEQEYLETLEPFGDSESSAFSIHNLIKAGESYGLAAGSWIGPYAICRSWES  254

Query  982   LACCKREDAEN  1014
             LAC KR+  ++
Sbjct  255   LACKKRKQTDS  265



>sp|Q75KP8.1|ATG4A_ORYSJ RecName: Full=Cysteine protease ATG4A; AltName: Full=Autophagy-related 
protein 4 homolog A [Oryza sativa Japonica Group]
 gb|AAR87271.1| putative autophagy protein (with alternative splicing) [Oryza 
sativa Japonica Group]
 gb|ABF96366.1| Peptidase family C54 containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ27183.1| hypothetical protein OsJ_11120 [Oryza sativa Japonica Group]
 dbj|BAH01357.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 148/215 (69%), Gaps = 8/215 (4%)
 Frame = +1

Query  367   AFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSV  546
              FSS  +    H   S  +   SL P   +  W+  LRR   +GS+WR LG +K    ++
Sbjct  45    VFSSPFSIFEAHQDSSANR---SLKPHSGSYAWSRFLRRIACTGSMWRFLGASK----AL  97

Query  547   SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
             +++D+W LG CYK++ ++  ++   +S G A+F+EDFSSRI ITYRKGF  I +SKYT+D
Sbjct  98    TSSDVWFLGKCYKLSSEELSNSSDCES-GNAAFLEDFSSRIWITYRKGFDAISDSKYTSD  156

Query  727   SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
               WGCM+RSSQMLVAQAL+FH LGRSWRK  +K     Y+ IL++FGDSE  A+SIHNLL
Sbjct  157   VNWGCMVRSSQMLVAQALIFHHLGRSWRKPSQKPYSPEYIGILHMFGDSEACAFSIHNLL  216

Query  907   QAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             QAGK+Y L+ GSWVGPYAMCR W+TL C  RE  E
Sbjct  217   QAGKSYGLAAGSWVGPYAMCRAWQTLVCTNREHHE  251



>ref|NP_001137489.1| autophagy-related 4b [Zea mays]
 ref|XP_008661516.1| PREDICTED: autophagy-related 4b isoform X1 [Zea mays]
 ref|XP_008661517.1| PREDICTED: autophagy-related 4b isoform X1 [Zea mays]
 gb|ACF84662.1| unknown [Zea mays]
 gb|ACG48147.1| cysteine protease ATG4B [Zea mays]
 gb|ACJ73914.1| autophagy-related 4b variant 1 [Zea mays]
 gb|AFW59939.1| autophagy 4b variant 1Cysteine protease ATG4B [Zea mays]
Length=492

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = +1

Query  427   ASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSP  606
             ASS  P   +  W+  LRR + SGS+WR+LG  +     +++ D+W LG CY+V+ ++  
Sbjct  77    ASSTKPPSGSYAWSRILRRFVGSGSMWRLLGCARV----LTSGDVWFLGKCYRVSPEEEE  132

Query  607   STDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLF  786
             S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQMLVAQAL+F
Sbjct  133   SGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQMLVAQALIF  192

Query  787   HRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMC  966
             H LGRSWRK  EK  + +Y+ +L+LFGDSE  A+SIHNLLQAG+ Y L+ GSWVGPYAMC
Sbjct  193   HHLGRSWRKPSEKPYDPDYIRVLHLFGDSEACAFSIHNLLQAGRNYGLAAGSWVGPYAMC  252

Query  967   RTWETLACCKREDAE  1011
             R W+TL    RE A+
Sbjct  253   RAWQTLIRTNREQAD  267



>gb|AAR87272.1| putative autophagy protein (with alternative splicing) [Oryza 
sativa Japonica Group]
 gb|ABF96367.1| Peptidase family C54 containing protein, expressed [Oryza sativa 
Japonica Group]
Length=505

 Score =   219 bits (558),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 148/215 (69%), Gaps = 8/215 (4%)
 Frame = +1

Query  367   AFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSV  546
              FSS  +    H   S  +   SL P   +  W+  LRR   +GS+WR LG +K    ++
Sbjct  45    VFSSPFSIFEAHQDSSANR---SLKPHSGSYAWSRFLRRIACTGSMWRFLGASK----AL  97

Query  547   SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
             +++D+W LG CYK++ ++  ++   +S G A+F+EDFSSRI ITYRKGF  I +SKYT+D
Sbjct  98    TSSDVWFLGKCYKLSSEELSNSSDCES-GNAAFLEDFSSRIWITYRKGFDAISDSKYTSD  156

Query  727   SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
               WGCM+RSSQMLVAQAL+FH LGRSWRK  +K     Y+ IL++FGDSE  A+SIHNLL
Sbjct  157   VNWGCMVRSSQMLVAQALIFHHLGRSWRKPSQKPYSPEYIGILHMFGDSEACAFSIHNLL  216

Query  907   QAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             QAGK+Y L+ GSWVGPYAMCR W+TL C  RE  E
Sbjct  217   QAGKSYGLAAGSWVGPYAMCRAWQTLVCTNREHHE  251



>gb|AEQ94126.1| putative cysteine protease [Elaeis guineensis]
Length=169

 Score =   209 bits (531),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 127/167 (76%), Gaps = 2/167 (1%)
 Frame = +1

Query  511   ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKG  690
             +LG + T   S S +DIWLLG CYK++ ++S S       G A+F+EDFSSRI ITYRKG
Sbjct  4     LLGTSSTDALS-STSDIWLLGKCYKLSPEES-SGGTDHGNGSAAFLEDFSSRIWITYRKG  61

Query  691   FAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGD  870
             F  IG+SK+T+D  WGCM+RSSQMLVAQALLFH LGRSWRK  +K  +  Y+EIL+LFGD
Sbjct  62    FDAIGDSKFTSDVRWGCMIRSSQMLVAQALLFHHLGRSWRKPSQKPHDSKYIEILHLFGD  121

Query  871   SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             SE  A+SIHNLL+AGKAY L+   WVGPYAMCRTWET+   KRE AE
Sbjct  122   SEACAFSIHNLLEAGKAYGLAAREWVGPYAMCRTWETITRAKREQAE  168



>ref|XP_010506319.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
 ref|XP_010506320.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
 ref|XP_010506321.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
Length=474

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 143/191 (75%), Gaps = 9/191 (5%)
 Frame = +1

Query  460   GWTSAL--RRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPT  621
             GWT+A   R  M +G++     R+LG N+TG+PS + +DIWLLG CYK+++DD+ S D  
Sbjct  78    GWTAAFVKRAFMATGAIRRFQERVLGPNRTGLPSTT-SDIWLLGVCYKISEDDA-SGDTD  135

Query  622   QSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGR  801
                  A+F +DFSS+ILITYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGR
Sbjct  136   AGSVLAAFHQDFSSKILITYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGR  195

Query  802   SWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWET  981
             SW  + E L EQ YLE L  FGDSE SA+SIHNL+ AG++Y L+ GSW+GPYA+CR+WE+
Sbjct  196   SWTWNSE-LPEQEYLETLEPFGDSETSAFSIHNLIIAGESYGLAAGSWIGPYAICRSWES  254

Query  982   LACCKREDAEN  1014
             LAC KR+  ++
Sbjct  255   LACKKRKQTDS  265



>ref|XP_010508336.1| PREDICTED: cysteine protease ATG4a isoform X3 [Camelina sativa]
 ref|XP_010508337.1| PREDICTED: cysteine protease ATG4a isoform X3 [Camelina sativa]
 ref|XP_010508338.1| PREDICTED: cysteine protease ATG4a isoform X3 [Camelina sativa]
Length=386

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 138/183 (75%), Gaps = 8/183 (4%)
 Frame = +1

Query  466   TSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASF  645
             T A+RR        R+LG N+TG+PS + +DIWLLG CYK+++D++ S D       A+F
Sbjct  3     TGAIRRFQE-----RVLGPNRTGLPS-TTSDIWLLGVCYKISEDEA-SGDTDAGSVLAAF  55

Query  646   VEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEK  825
              +DFSS+ILI+YRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGRSW +  E 
Sbjct  56    HQDFSSKILISYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRSWTRKSE-  114

Query  826   LLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             L EQ YLE L  FGDSE SA+SIHNL++AG++Y L+ GSW+GPYA+CR+WE+LAC KR+ 
Sbjct  115   LPEQEYLETLEPFGDSESSAFSIHNLIKAGESYGLAAGSWIGPYAICRSWESLACKKRKQ  174

Query  1006  AEN  1014
              ++
Sbjct  175   TDS  177



>ref|XP_004492912.1| PREDICTED: cysteine protease ATG4-like isoform X3 [Cicer arietinum]
Length=397

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +1

Query  508  RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
            R+LG ++T I S S+ D+WLLG C+K++Q +S + D      FA+F +DF S+IL+TYRK
Sbjct  7    RVLGSSRTDI-SCSDGDVWLLGVCHKISQQES-TGDVDTRNVFAAFEQDFFSKILVTYRK  64

Query  688  GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
            GF  I +SKYT+D  WGCMLRSSQMLVAQALLFH+LGRSWRK+ +K +++ Y++IL LFG
Sbjct  65   GFDAIEDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTTDKPVDKEYIDILQLFG  124

Query  868  DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKR  999
            DSE +A+SIHNLLQAGK Y L+ GSWVGPYAMCRTWE LA  +R
Sbjct  125  DSEAAAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQR  168



>gb|ADT92194.1| autophagy-related 4b [Zea mays]
Length=595

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = +1

Query  427   ASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSP  606
             ASS  P   +  W+  LRR + SGS+WR+LG  +     +++ D+W LG CY+V+ ++  
Sbjct  77    ASSTKPPSGSYAWSRILRRFVGSGSMWRLLGCARV----LTSGDVWFLGKCYRVSPEEEE  132

Query  607   STDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLF  786
             S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQMLVAQAL+F
Sbjct  133   SGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQMLVAQALIF  192

Query  787   HRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMC  966
             H LGRSWRK  EK  + +Y+ +L+LFGDSE  A+SIHNLLQAG+ Y L+ GSWVGPYAMC
Sbjct  193   HHLGRSWRKPSEKPYDPDYIRVLHLFGDSEACAFSIHNLLQAGRNYGLAAGSWVGPYAMC  252

Query  967   RTWETLACCKREDAE  1011
             R W+TL    RE A+
Sbjct  253   RAWQTLIRTNREQAD  267



>ref|XP_006653040.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4B-like 
[Oryza brachyantha]
Length=480

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 136/184 (74%), Gaps = 5/184 (3%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFA  639
             GW+  LRR + +GS+WR LG++K     ++++D+W LG CYK+  ++S S       G A
Sbjct  75    GWSRVLRRIVCTGSMWRFLGVSKV----LTSSDVWFLGKCYKLVSEESSSDS-DSESGHA  129

Query  640   SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSL  819
             +F+EDFSSRI ITYRKGF  I +SKYT+D  WGCM+RSSQMLVAQALLFH LGRSWRK  
Sbjct  130   AFLEDFSSRIWITYRKGFDAISDSKYTSDVNWGCMVRSSQMLVAQALLFHHLGRSWRKPS  189

Query  820   EKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKR  999
             +K     Y+ IL++FGDSE  A+SIHNLLQAG++Y L+ GSWVGPYAMCR W+TL    R
Sbjct  190   QKPYNPEYIGILHMFGDSEAYAFSIHNLLQAGRSYGLAAGSWVGPYAMCRAWQTLVRTNR  249

Query  1000  EDAE  1011
             E +E
Sbjct  250   EQSE  253



>ref|XP_006294155.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
 gb|EOA27053.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
Length=467

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 143/190 (75%), Gaps = 8/190 (4%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ ++RA M SG++     R+LG N+TG+PS + +DIWLLG CYK+++D++ S D   
Sbjct  74    GWTAFVKRACMASGAIRRFQERVLGPNRTGLPS-TTSDIWLLGVCYKISEDEA-SGDTDA  131

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+F  DFSS+IL+TYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFH+LGRS
Sbjct  132   GSVLAAFQRDFSSKILMTYRKGFQPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHKLGRS  191

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             W K  E L EQ YLE L  FGD+E SA+SIHNL+ AG++Y L+ GSW+GPYA+CR+WE+L
Sbjct  192   WTKKSE-LSEQEYLETLEPFGDAETSAFSIHNLIIAGESYGLAAGSWIGPYAICRSWESL  250

Query  985   ACCKREDAEN  1014
              C +R+  ++
Sbjct  251   VCKRRKQTDS  260



>ref|XP_010506322.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
 ref|XP_010506323.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
 ref|XP_010506325.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
 ref|XP_010506326.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
Length=386

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = +1

Query  466   TSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASF  645
             T A+RR        R+LG N+TG+PS + +DIWLLG CYK+++DD+ S D       A+F
Sbjct  3     TGAIRRFQE-----RVLGPNRTGLPS-TTSDIWLLGVCYKISEDDA-SGDTDAGSVLAAF  55

Query  646   VEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEK  825
              +DFSS+ILITYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGRSW  + E 
Sbjct  56    HQDFSSKILITYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRSWTWNSE-  114

Query  826   LLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             L EQ YLE L  FGDSE SA+SIHNL+ AG++Y L+ GSW+GPYA+CR+WE+LAC KR+ 
Sbjct  115   LPEQEYLETLEPFGDSETSAFSIHNLIIAGESYGLAAGSWIGPYAICRSWESLACKKRKQ  174

Query  1006  AEN  1014
              ++
Sbjct  175   TDS  177



>ref|XP_002881949.1| autophagy 4a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58208.1| autophagy 4a [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 143/190 (75%), Gaps = 8/190 (4%)
 Frame = +1

Query  460   GWTSALRR-AMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ ++R +M +G++     R+LG N+TG+PS + +D+WLLG CYK+++D++ S +   
Sbjct  74    GWTAFVKRVSMATGAIRRFQERVLGPNRTGLPSTT-SDVWLLGVCYKISEDEA-SGETNT  131

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+F +DFSS+IL+TYR+GF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGRS
Sbjct  132   GCVLAAFQQDFSSKILMTYRRGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRS  191

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             W K  E L EQ YLE L  FGDSE SA+SIHNL+ AG +Y L+ GSWVGPYA+CR WE+L
Sbjct  192   WTKKSE-LPEQEYLETLEPFGDSESSAFSIHNLIIAGSSYGLAAGSWVGPYAICRAWESL  250

Query  985   ACCKREDAEN  1014
             AC KR+  ++
Sbjct  251   ACKKRKQTDS  260



>ref|XP_010518003.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
Length=386

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = +1

Query  466   TSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASF  645
             T A+RR        R+LG N+TG+PS + +DIWLLG CYK+++D++ S D       A+F
Sbjct  3     TGAIRRFQE-----RVLGPNRTGLPS-TTSDIWLLGVCYKISEDEA-SGDTDAGSVLAAF  55

Query  646   VEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEK  825
               DFSS+ILITYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGRSW +  E 
Sbjct  56    HLDFSSKILITYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRSWTRKSE-  114

Query  826   LLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             L EQ YLE L  FGDS+ SA+SIHNL++AG++Y L+ GSW+GPYA+CR+WE+LAC KR+ 
Sbjct  115   LPEQEYLETLEPFGDSKTSAFSIHNLIKAGESYGLAAGSWIGPYAICRSWESLACKKRKQ  174

Query  1006  AEN  1014
              ++
Sbjct  175   TDS  177



>ref|XP_003580841.1| PREDICTED: cysteine protease ATG4B-like [Brachypodium distachyon]
Length=493

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 134/187 (72%), Gaps = 5/187 (3%)
 Frame = +1

Query  451   YAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQ  630
             Y   W+ ALRR +  GS+WR LG  K     ++N D+W LG CYK + ++S S+D     
Sbjct  85    YGGAWSRALRRFVGGGSMWRFLGCAKV----LTNGDVWFLGKCYKFSSEES-SSDLDTDS  139

Query  631   GFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR  810
             G A+F+EDFSSRI +TYRKGF  I +SK+T+D  WGCM+RSSQMLVAQAL+FH LGRSWR
Sbjct  140   GHAAFLEDFSSRIWVTYRKGFDAISDSKFTSDVNWGCMVRSSQMLVAQALMFHHLGRSWR  199

Query  811   KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLAC  990
             K  +K     Y+ IL+LFGDSE  A+S+HNLLQAGK+Y L+ GSWVGPYAMCR W+TL  
Sbjct  200   KPSQKPCNPEYIRILHLFGDSEVCAFSVHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIR  259

Query  991   CKREDAE  1011
               RE  E
Sbjct  260   TNREQPE  266



>ref|XP_010037858.1| PREDICTED: cysteine protease ATG4 isoform X2 [Eucalyptus grandis]
 ref|XP_010037859.1| PREDICTED: cysteine protease ATG4 isoform X2 [Eucalyptus grandis]
Length=395

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 128/168 (76%), Gaps = 5/168 (3%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG  +TGI S   +DIWLLG CYK++QD+S      +  G  +F +DFSSRI+ITYRK
Sbjct  7     RVLGTGRTGI-SNPTSDIWLLGVCYKISQDESSGD---EVPGLPAFEQDFSSRIIITYRK  62

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +S YT+D GWGCMLRSSQMLVAQALLFH LGRSWRK+  K  E  Y +IL+LFG
Sbjct  63    GFEAI-DSNYTSDVGWGCMLRSSQMLVAQALLFHHLGRSWRKTSYKPCEPKYADILHLFG  121

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DS  S +SIHNL++AGKAYDL+ GSWVGPYA CR+WE+L   KRE A+
Sbjct  122   DSNASPFSIHNLIRAGKAYDLAAGSWVGPYATCRSWESLVRSKREAAD  169



>ref|NP_001054293.1| Os04g0682000 [Oryza sativa Japonica Group]
 sp|Q7XPW8.1|ATG4B_ORYSJ RecName: Full=Cysteine protease ATG4B; AltName: Full=Autophagy-related 
protein 4 homolog B [Oryza sativa Japonica Group]
 emb|CAE03430.1| OSJNBa0032F06.13 [Oryza sativa Japonica Group]
 gb|ABB77259.1| autophagy 4 [Oryza sativa Indica Group]
 dbj|BAF16207.1| Os04g0682000 [Oryza sativa Japonica Group]
 dbj|BAG91210.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR + SGS+WR LG +K     ++++D+W LG CYK++ ++S S       G A+
Sbjct  77    WSRVLRRIVCSGSMWRFLGTSKV----LTSSDVWFLGKCYKLSSEESSSDS-DSESGHAT  131

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYR+GF  I +SKYT+D  WGCM+RSSQMLVAQAL+FH LGRSWR+ LE
Sbjct  132   FLEDFSSRIWITYRRGFDAISDSKYTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRRPLE  191

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             K     Y+ IL++FGDSE  A+SIHNLLQAG +Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  192   KPYNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYAMCRAWQTLVRTNRE  251

Query  1003  DAE  1011
               E
Sbjct  252   QHE  254



>sp|A2XHJ5.1|ATG4A_ORYSI RecName: Full=Cysteine protease ATG4A; AltName: Full=Autophagy-related 
protein 4 homolog A [Oryza sativa Indica Group]
 gb|EAY90305.1| hypothetical protein OsI_11880 [Oryza sativa Indica Group]
Length=473

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 146/215 (68%), Gaps = 8/215 (4%)
 Frame = +1

Query  367   AFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSV  546
              FSS  +    H   S  +    L P   +  W+  LRR   +GS+WR LG +K    ++
Sbjct  44    VFSSPFSIFEAHQDSSAHR---PLKPHSGSYAWSRFLRRIACTGSMWRFLGASK----AL  96

Query  547   SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
             +++D+W LG CYK++ ++  ++   +S G A+F+EDFSSRI ITYRKGF  I +SKYT+D
Sbjct  97    TSSDVWFLGKCYKLSSEELSNSSDCES-GNAAFLEDFSSRIWITYRKGFDAISDSKYTSD  155

Query  727   SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
               WGCM+RSSQMLVAQAL+FH LGRSWRK  +K     Y+ IL++FGDSE  A+SIHNLL
Sbjct  156   VNWGCMVRSSQMLVAQALIFHHLGRSWRKPSQKPYSPEYIGILHMFGDSEACAFSIHNLL  215

Query  907   QAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             QAGK+Y L+ GSWVGPYAMCR W+TL    RE  E
Sbjct  216   QAGKSYGLAAGSWVGPYAMCRAWQTLVRTNREHHE  250



>ref|NP_973687.1| cysteine protease ATG4a [Arabidopsis thaliana]
 gb|AEC10381.1| cysteine protease ATG4a [Arabidopsis thaliana]
Length=422

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 140/190 (74%), Gaps = 8/190 (4%)
 Frame = +1

Query  460   GWTSALRR-AMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ ++R +M SG++     R+LG N+TG+PS + +D+WLLG CYK++ D++     T 
Sbjct  29    GWTAFVKRVSMASGAIRRFQERVLGPNRTGLPS-TTSDVWLLGVCYKISADENSGETDTG  87

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
             +   A+   DFSS+IL+TYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGR+
Sbjct  88    TV-LAALQLDFSSKILMTYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRA  146

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             W K  E L EQ YLE L  FGDSE SA+SIHNL+ AG +Y L+ GSWVGPYA+CR WE+L
Sbjct  147   WTKKSE-LPEQEYLETLEPFGDSEPSAFSIHNLIIAGASYGLAAGSWVGPYAICRAWESL  205

Query  985   ACCKREDAEN  1014
             AC KR+  ++
Sbjct  206   ACKKRKQTDS  215



>emb|CDY17881.1| BnaC04g03380D [Brassica napus]
Length=454

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 157/228 (69%), Gaps = 18/228 (8%)
 Frame = +1

Query  358   RVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRR-AMNSGSVWR----ILGL  522
             + + +S+S + +  + + S   G   L     A  WTS +++ +M SG++ R    +LG 
Sbjct  32    KCTLWSTSSSVSQPYRESSSTSGRKQLC----AATWTSLVKKVSMASGAIKRFQDRVLGP  87

Query  523   NKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPI  702
             N+ G+PS + +D WLLG CYK+++D+   TD       A+  +DFSSRIL+TYRKGF PI
Sbjct  88    NRIGLPS-TTSDFWLLGVCYKLSEDEE--TD--DGSVVAALKQDFSSRILMTYRKGFEPI  142

Query  703   GESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKL----LEQNYLEILNLFGD  870
              ++ YT+D  WGCM+RSSQML AQALLFHRLGRSWR +  ++     EQ YLE L  FGD
Sbjct  143   KDTSYTSDVNWGCMIRSSQMLFAQALLFHRLGRSWRNNKSEVSSVRPEQEYLETLEPFGD  202

Query  871   SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             SE SA+SIHNL+Q G++Y L+ GSWVGPYA+CR+WE+LAC KR+ +++
Sbjct  203   SEASAFSIHNLIQVGESYGLAAGSWVGPYAICRSWESLACKKRKQSDS  250



>ref|NP_850412.1| cysteine protease ATG4a [Arabidopsis thaliana]
 sp|Q8S929.1|ATG4A_ARATH RecName: Full=Cysteine protease ATG4a; AltName: Full=Autophagy-related 
protein 4 homolog a; Short=AtAPG4a; Short=Protein 
autophagy 4a [Arabidopsis thaliana]
 dbj|BAB88383.1| autophagy 4a [Arabidopsis thaliana]
 dbj|BAE99076.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10380.1| cysteine protease ATG4a [Arabidopsis thaliana]
Length=467

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 140/190 (74%), Gaps = 8/190 (4%)
 Frame = +1

Query  460   GWTSALRR-AMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ ++R +M SG++     R+LG N+TG+PS + +D+WLLG CYK++ D++ S +   
Sbjct  74    GWTAFVKRVSMASGAIRRFQERVLGPNRTGLPS-TTSDVWLLGVCYKISADEN-SGETDT  131

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+   DFSS+IL+TYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFHRLGR+
Sbjct  132   GTVLAALQLDFSSKILMTYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHRLGRA  191

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             W K  E L EQ YLE L  FGDSE SA+SIHNL+ AG +Y L+ GSWVGPYA+CR WE+L
Sbjct  192   WTKKSE-LPEQEYLETLEPFGDSEPSAFSIHNLIIAGASYGLAAGSWVGPYAICRAWESL  250

Query  985   ACCKREDAEN  1014
             AC KR+  ++
Sbjct  251   ACKKRKQTDS  260



>ref|NP_850722.3| peptidase family C54 protein [Arabidopsis thaliana]
 gb|AEE79988.1| peptidase family C54 protein [Arabidopsis thaliana]
Length=360

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 7/189 (4%)
 Frame = +1

Query  463   WTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT  L+ A M SG++ R    +LG ++TGI S S ++IWLLG CYK+++ +S S +    
Sbjct  78    WTVILKTASMASGAIRRFQDRVLGPSRTGISS-STSEIWLLGVCYKISEGES-SEEADAG  135

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
             +  A+F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRS QML AQALLF RLGRSW
Sbjct  136   RVLAAFRQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSW  195

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK   +  ++ YLEIL LFGD+E SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+LA
Sbjct  196   RKKDSEPADEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLA  255

Query  988   CCKREDAEN  1014
                +E+ ++
Sbjct  256   RKNKEETDD  264



>gb|ACJ73913.1| autophagy-related 4a variant 2 [Zea mays]
Length=429

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 134/184 (73%), Gaps = 4/184 (2%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFA  639
             G +  LRR + SGS+WR+LG  +     ++++D+W LG CYKV+ ++  S D     G A
Sbjct  91    GLSRILRRFVGSGSMWRLLGCGRV----LTSSDVWFLGKCYKVSPEEEESGDSESDSGHA  146

Query  640   SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSL  819
             +F+EDFSSRI ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  
Sbjct  147   AFLEDFSSRIWITYRKGFDAISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPP  206

Query  820   EKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKR  999
             EK    +Y+ +L+LFGDSE  A+SIHNLLQAG+ Y L+ GSW+GPYAMCR W+TL    R
Sbjct  207   EKPYNPDYIGVLHLFGDSEACAFSIHNLLQAGRNYGLAAGSWLGPYAMCRAWQTLIRTNR  266

Query  1000  EDAE  1011
             E A+
Sbjct  267   EQAD  270



>ref|XP_008810459.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Phoenix dactylifera]
Length=494

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 141/193 (73%), Gaps = 6/193 (3%)
 Frame = +1

Query  445   KHYAIGWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPST  612
             K  + GWT+A+++ +  GS+     R+LG + T   S++ ++IWLLG  YK++ ++S S 
Sbjct  72    KSRSYGWTTAVKKVVAGGSMRRLQERLLGTSSTDALSLT-SEIWLLGMRYKLSPEES-SG  129

Query  613   DPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHR  792
                   G A+F+EDFSSRI ITYRKGF  IG SK T+D  WGCM+RSSQMLVAQALLFH 
Sbjct  130   GADHGNGSAAFLEDFSSRIWITYRKGFDAIGYSKLTSDVRWGCMIRSSQMLVAQALLFHH  189

Query  793   LGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRT  972
             LGR WRK  +K  +  Y+EIL+LFGDSE  A+S+HNLL+AGK Y L+ GSW+GPYAMCRT
Sbjct  190   LGRYWRKPSQKPHDPKYIEILHLFGDSEACAFSLHNLLEAGKGYGLAAGSWLGPYAMCRT  249

Query  973   WETLACCKREDAE  1011
             WETLA  KRE A+
Sbjct  250   WETLARAKREQAD  262



>ref|XP_006294154.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
 gb|EOA27052.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
Length=384

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 135/180 (75%), Gaps = 7/180 (4%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++     R+LG N+TG+PS + +DIWLLG CYK+++D++ S D       A+F  D
Sbjct  1     MASGAIRRFQERVLGPNRTGLPS-TTSDIWLLGVCYKISEDEA-SGDTDAGSVLAAFQRD  58

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             FSS+IL+TYRKGF P  ++ YT+D  WGCM+RSSQML AQALLFH+LGRSW K  E L E
Sbjct  59    FSSKILMTYRKGFQPFRDTTYTSDVNWGCMIRSSQMLFAQALLFHKLGRSWTKKSE-LSE  117

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             Q YLE L  FGD+E SA+SIHNL+ AG++Y L+ GSW+GPYA+CR+WE+L C +R+  ++
Sbjct  118   QEYLETLEPFGDAETSAFSIHNLIIAGESYGLAAGSWIGPYAICRSWESLVCKRRKQTDS  177



>ref|NP_001118859.1| peptidase family C54 protein [Arabidopsis thaliana]
 dbj|BAD95023.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79990.1| peptidase family C54 protein [Arabidopsis thaliana]
Length=267

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 137/183 (75%), Gaps = 7/183 (4%)
 Frame = +1

Query  466   TSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASF  645
             + A+RR  +     R+LG ++TGI S S ++IWLLG CYK+++ +S S +    +  A+F
Sbjct  3     SGAIRRFQD-----RVLGPSRTGISS-STSEIWLLGVCYKISEGES-SEEADAGRVLAAF  55

Query  646   VEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEK  825
              +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRS QML AQALLF RLGRSWRK   +
Sbjct  56    RQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSWRKKDSE  115

Query  826   LLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
               ++ YLEIL LFGD+E SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+LA   +E+
Sbjct  116   PADEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLARKNKEE  175

Query  1006  AEN  1014
              ++
Sbjct  176   TDD  178



>ref|XP_009385978.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4B-like 
[Musa acuminata subsp. malaccensis]
Length=473

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRI---LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQ  630
             GW ++L + M SG + R+   +    T     S +DIW LG CYK++ ++S S       
Sbjct  72    GWVTSLNKVMTSGPMRRLQECILWTSTADTLRSTSDIWFLGKCYKLSLEES-SHGSDAPN  130

Query  631   GFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR  810
              + +F+EDF SRI ITYRKGF PIG+SK+T D  WGCM+RSSQMLVAQAL+FH LGRSWR
Sbjct  131   SYDAFLEDFLSRIWITYRKGFDPIGDSKFTCDVNWGCMIRSSQMLVAQALIFHHLGRSWR  190

Query  811   KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLAC  990
               L+K  +  Y+EIL+LFGDSE  A+S+HNLLQAG+ Y L+ GSW+GPYAMCRTWETLA 
Sbjct  191   MRLQKPHDPGYIEILHLFGDSEACAFSVHNLLQAGRCYGLAAGSWLGPYAMCRTWETLAH  250

Query  991   CKREDAEN  1014
               +E  E+
Sbjct  251   ANKEQIES  258



>ref|XP_009142995.1| PREDICTED: cysteine protease ATG4a isoform X1 [Brassica rapa]
Length=466

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 155/238 (65%), Gaps = 21/238 (9%)
 Frame = +1

Query  328   EQRHSFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRR-AMNSGSV  504
             + + + WS     + SS      E S  S RK       +  A  WTS +++ +M SG++
Sbjct  35    DNKCTLWSNVFAPSSSSVSQPYRESSSTSGRK-------QLCAATWTSFVKKVSMASGAI  87

Query  505   WR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRIL  672
              R    +LG N+TG+PS + +D WLLG CYK++ D+   TD       A+  +DFSSRIL
Sbjct  88    KRFQDRVLGPNRTGLPS-TTSDFWLLGVCYKLSDDEE--TD--DGSVVAALKQDFSSRIL  142

Query  673   ITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKL----LEQN  840
             +TYRKGF PI ++ YT+D  WGCM+RSSQML AQALLFHRLGRSWR    ++     EQ 
Sbjct  143   MTYRKGFEPIKDTSYTSDVNWGCMIRSSQMLFAQALLFHRLGRSWRNKNSEVSSVQPEQE  202

Query  841   YLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             YLE L  FGDSE SA+SIHNL+  G+ Y L+ GSWVGPYA+CR+WE+LAC KR+ +++
Sbjct  203   YLETLEPFGDSEASAFSIHNLILVGETYGLAAGSWVGPYAICRSWESLACKKRKQSDS  260



>sp|Q2XPP4.2|ATG4B_ORYSI RecName: Full=Cysteine protease ATG4B; AltName: Full=Autophagy-related 
protein 4 homolog B; Short=Protein autophagy 4; AltName: 
Full=OsAtg4 [Oryza sativa Indica Group]
Length=478

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W   LRR + SGS+WR LG +K     ++++D+W LG CYK++ ++S S       G A+
Sbjct  77    WLRVLRRIVCSGSMWRFLGTSKV----LTSSDVWFLGKCYKLSSEESSSDS-DSESGHAT  131

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYR+GF  I +SKYT+D  WGCM+RSSQMLVAQAL+FH LGRSWR+  E
Sbjct  132   FLEDFSSRIWITYRRGFDAISDSKYTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRRPSE  191

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             K     Y+ IL++FGDSE  A+SIHNLLQAG +Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  192   KPYNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYAMCRAWQTLVRTNRE  251

Query  1003  DAE  1011
               E
Sbjct  252   QHE  254



>emb|CDX79779.1| BnaA05g03770D [Brassica napus]
Length=456

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 142/196 (72%), Gaps = 14/196 (7%)
 Frame = +1

Query  454   AIGWTSALRR-AMNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDP  618
             A  WTS +++ +M SG++ R    +LG N+TG+PS + +D WLLG CYK++ D+   TD 
Sbjct  60    AATWTSFVKKVSMASGAIKRFQDRVLGPNRTGLPS-TTSDFWLLGVCYKLSDDEE--TD-  115

Query  619   TQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLG  798
                   A+  +DFSSRIL+TYRKGF PI ++ YT+D  WGCM+RSSQML AQALLFHRLG
Sbjct  116   -DGSVVAALKQDFSSRILMTYRKGFEPIKDTSYTSDVNWGCMIRSSQMLFAQALLFHRLG  174

Query  799   RSWRKSLEKL----LEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMC  966
             RSWR    ++     EQ YLE L  FGDSE SA+SIHNL+  G++Y L+ GSWVGPYA+C
Sbjct  175   RSWRNKNSEVSSVQPEQEYLETLEPFGDSEASAFSIHNLILVGESYGLAAGSWVGPYAIC  234

Query  967   RTWETLACCKREDAEN  1014
             R+WE+LAC KR+ +++
Sbjct  235   RSWESLACKKRKQSDS  250



>ref|NP_001137488.1| autophagy-related 4 [Zea mays]
 ref|XP_008668672.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Zea mays]
 ref|XP_008668673.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Zea mays]
 gb|ACG32144.1| cysteine protease ATG4B [Zea mays]
 gb|ACJ73912.1| autophagy-related 4 variant 1 [Zea mays]
 gb|ACL53549.1| unknown [Zea mays]
 tpg|DAA35300.1| TPA: autophagy 4a variant 2 isoform 1 [Zea mays]
 tpg|DAA35301.1| TPA: autophagy 4a variant 2 isoform 2 [Zea mays]
Length=492

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 140/205 (68%), Gaps = 4/205 (2%)
 Frame = +1

Query  397   EHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGC  576
             +    SP   A S      + G +  LRR + SGS+WR+LG  +     ++++D+W LG 
Sbjct  70    QQGSSSPACDARSTKSSSGSYGLSRILRRFVGSGSMWRLLGCGRV----LTSSDVWFLGK  125

Query  577   CYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSS  756
             CYKV+ ++  S D     G A+F+EDFSSRI ITYRKGF  I +SK T+D  WGCM+RSS
Sbjct  126   CYKVSPEEEESGDSESDSGHAAFLEDFSSRIWITYRKGFDAISDSKLTSDVNWGCMVRSS  185

Query  757   QMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSP  936
             QMLVAQAL+FH LGRSWRK  EK    +Y+ +L+LFGDSE  A+SIHNLLQAG+ Y L+ 
Sbjct  186   QMLVAQALIFHHLGRSWRKPPEKPYNPDYIGVLHLFGDSEACAFSIHNLLQAGRNYGLAA  245

Query  937   GSWVGPYAMCRTWETLACCKREDAE  1011
             GSW+GPYAMCR W+TL    RE A+
Sbjct  246   GSWLGPYAMCRAWQTLIRTNREQAD  270



>gb|EEE61922.1| hypothetical protein OsJ_16662 [Oryza sativa Japonica Group]
Length=892

 Score =   215 bits (547),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR + SGS+WR LG +K     ++++D+W LG CYK++ ++S S       G A+
Sbjct  77    WSRVLRRIVCSGSMWRFLGTSKV----LTSSDVWFLGKCYKLSSEESSSDS-DSESGHAT  131

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYR+GF  I +SKYT+D  WGCM+RSSQMLVAQAL+FH LGRSWR+ LE
Sbjct  132   FLEDFSSRIWITYRRGFDAISDSKYTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRRPLE  191

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             K     Y+ IL++FGDSE  A+SIHNLLQAG +Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  192   KPYNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYAMCRAWQTLVRTNRE  251

Query  1003  DAE  1011
               E
Sbjct  252   QHE  254



>ref|XP_004960034.1| PREDICTED: cysteine protease ATG4B-like [Setaria italica]
Length=480

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 130/187 (70%), Gaps = 11/187 (6%)
 Frame = +1

Query  460   GWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQG--  633
             GW+  LRR + S S+WR+LG  K     ++++D+W LG CYK    +SP      S    
Sbjct  78    GWSRILRRIVGSTSMWRLLGCAKV----LTSSDVWFLGKCYK----ESPEESSGGSDSES  129

Query  634   -FASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR  810
               A+F+EDFSSRI ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWR
Sbjct  130   GHAAFLEDFSSRIWITYRKGFDVISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWR  189

Query  811   KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLAC  990
             K  EK     Y+ +L+LFGDSE  A+SIHNLLQAGK Y L+ GSWVGPYAMCR W+TL  
Sbjct  190   KPPEKPYNPEYIGVLHLFGDSEACAFSIHNLLQAGKGYGLAAGSWVGPYAMCRAWQTLIR  249

Query  991   CKREDAE  1011
               RE A+
Sbjct  250   TNREQAD  256



>ref|NP_191554.1| peptidase family C54 protein [Arabidopsis thaliana]
 sp|Q9M1Y0.1|ATG4B_ARATH RecName: Full=Cysteine protease ATG4b; AltName: Full=Autophagy-related 
protein 4 homolog b; Short=AtAPG4b; Short=Protein 
autophagy 4b [Arabidopsis thaliana]
 emb|CAB75814.1| putative protein [Arabidopsis thaliana]
 dbj|BAB88384.1| autophagy 4b [Arabidopsis thaliana]
 dbj|BAE99003.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79989.1| peptidase family C54 protein [Arabidopsis thaliana]
Length=477

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 7/189 (4%)
 Frame = +1

Query  463   WTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT  L+ A M SG++ R    +LG ++TGI S S ++IWLLG CYK+++ +S S +    
Sbjct  78    WTVILKTASMASGAIRRFQDRVLGPSRTGISS-STSEIWLLGVCYKISEGES-SEEADAG  135

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
             +  A+F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRS QML AQALLF RLGRSW
Sbjct  136   RVLAAFRQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSW  195

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK   +  ++ YLEIL LFGD+E SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+LA
Sbjct  196   RKKDSEPADEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLA  255

Query  988   CCKREDAEN  1014
                +E+ ++
Sbjct  256   RKNKEETDD  264



>ref|XP_009398483.1| PREDICTED: cysteine protease ATG4B-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 135/193 (70%), Gaps = 8/193 (4%)
 Frame = +1

Query  445   KHYAIGWTSALRRAMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKV-AQDDSPS  609
             K  + G ++A+   M SG +     RILG  +    S S ++IWLLG CY   A++ S  
Sbjct  72    KPTSYGLSTAVSNVMISGPIRRLQERILGTTRMEALS-STSEIWLLGKCYNASAEESSGG  130

Query  610   TDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
              DP  S  +A F+EDFSSRI ITYRKGF PIG++K+T+D  WGCM+RSSQMLVAQALL H
Sbjct  131   EDPGNS--YAEFLEDFSSRIWITYRKGFEPIGDTKFTSDVNWGCMIRSSQMLVAQALLSH  188

Query  790   RLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCR  969
              LGRSWRK  +K  +  Y+EIL LFGDSE  A+S+HNLL+AG+ Y L+ GSW+GPYAMCR
Sbjct  189   HLGRSWRKPSQKPYDPKYIEILQLFGDSEACAFSVHNLLRAGRHYGLAAGSWLGPYAMCR  248

Query  970   TWETLACCKREDA  1008
             TWET+    RE A
Sbjct  249   TWETITRANREQA  261



>gb|EEC78268.1| hypothetical protein OsI_17962 [Oryza sativa Indica Group]
Length=912

 Score =   211 bits (538),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W   LRR + SGS+WR LG +K     ++++D+W LG CYK++ ++S S       G A+
Sbjct  77    WLRVLRRIVCSGSMWRFLGTSKV----LTSSDVWFLGKCYKLSSEESSSDS-DSESGHAT  131

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYR+GF  I +SKYT+D  WGCM+RSSQMLVAQAL+FH LGRSWR+  E
Sbjct  132   FLEDFSSRIWITYRRGFDAISDSKYTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRRPSE  191

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             K     Y+ IL++FGDSE  A+SIHNLLQAG +Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  192   KPYNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYAMCRAWQTLVRTNRE  251

Query  1003  DAE  1011
               E
Sbjct  252   QHE  254



>ref|XP_009142996.1| PREDICTED: cysteine protease ATG4a isoform X2 [Brassica rapa]
Length=385

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 9/173 (5%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG N+TG+PS + +D WLLG CYK++ D+   TD       A+  +DFSSRIL+TYRK
Sbjct  12    RVLGPNRTGLPS-TTSDFWLLGVCYKLSDDEE--TD--DGSVVAALKQDFSSRILMTYRK  66

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKL----LEQNYLEIL  855
             GF PI ++ YT+D  WGCM+RSSQML AQALLFHRLGRSWR    ++     EQ YLE L
Sbjct  67    GFEPIKDTSYTSDVNWGCMIRSSQMLFAQALLFHRLGRSWRNKNSEVSSVQPEQEYLETL  126

Query  856   NLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
               FGDSE SA+SIHNL+  G+ Y L+ GSWVGPYA+CR+WE+LAC KR+ +++
Sbjct  127   EPFGDSEASAFSIHNLILVGETYGLAAGSWVGPYAICRSWESLACKKRKQSDS  179



>ref|XP_006292861.1| hypothetical protein CARUB_v10019120mg [Capsella rubella]
 gb|EOA25759.1| hypothetical protein CARUB_v10019120mg [Capsella rubella]
Length=474

 Score =   205 bits (522),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = +1

Query  463   WTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT  L+ A M SG++     R+LG ++TGI S S ++IWL+G CYK+++ +S S +    
Sbjct  77    WTVILKTASMASGAIRRFQERVLGPSRTGISS-STSEIWLMGVCYKISEGES-SEEADSG  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
                 +F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSW
Sbjct  135   HVLTAFGQDFSSLILMTYRRGFGPIGDTTYTSDVNWGCMLRSSQMLFAQALLFQRLGRSW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK   +  E+ YL IL  FGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L 
Sbjct  195   RKKESETPEEEYLGILEHFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLV  254

Query  988   CCKREDAE  1011
               KRE+ +
Sbjct  255   RKKREETD  262



>ref|XP_010469250.1| PREDICTED: cysteine protease ATG4b isoform X1 [Camelina sativa]
Length=476

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 138/189 (73%), Gaps = 7/189 (4%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT  L+ A M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +   
Sbjct  76    GWTVILKTASMASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEADS  133

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                  +F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRS
Sbjct  134   GHVLTAFGQDFSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRS  193

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             WRK   +  E+ YL IL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L
Sbjct  194   WRKKESEPPEEEYLGILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESL  253

Query  985   ACCKREDAE  1011
                KRE+ +
Sbjct  254   VRKKREETD  262



>emb|CDX89039.1| BnaA04g01470D [Brassica napus]
Length=425

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 140/189 (74%), Gaps = 16/189 (8%)
 Frame = +1

Query  460   GWTSALRRA--MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPT  621
             GWT  +  A  M SG++ R    +LG ++TGIPS + ++IWLLG CYK+++         
Sbjct  30    GWTVIVNTASSMASGAIRRFQDRVLGPSRTGIPS-TTSEIWLLGVCYKISE--------A  80

Query  622   QSQGFA-SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLG  798
             +S G A +F +DFSS ILITYR+GF PIGE+ YT+D GWGCMLRS QML AQALLF RLG
Sbjct  81    ESLGEADAFRQDFSSLILITYRRGFEPIGETTYTSDVGWGCMLRSGQMLFAQALLFQRLG  140

Query  799   RSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWE  978
             RSWRK   +L E+ Y EIL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE
Sbjct  141   RSWRKKESELSEEEYFEILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWE  200

Query  979   TLACCKRED  1005
             +LA  KRE+
Sbjct  201   SLARKKREE  209



>ref|XP_010469251.1| PREDICTED: cysteine protease ATG4b isoform X2 [Camelina sativa]
Length=476

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 138/189 (73%), Gaps = 7/189 (4%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT  L+ A M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +   
Sbjct  76    GWTVILKTASMASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEADS  133

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                  +F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRS
Sbjct  134   GHVLTAFGQDFSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRS  193

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             WRK   +  E+ YL IL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L
Sbjct  194   WRKKESEPPEEEYLGILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESL  253

Query  985   ACCKREDAE  1011
                KRE+ +
Sbjct  254   IRKKREETD  262



>emb|CAJ86292.1| H0124B04.9 [Oryza sativa Indica Group]
Length=1216

 Score =   211 bits (537),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 132/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W   LRR + SGS+WR LG +K     ++++D+W LG CYK++ ++S S       G A+
Sbjct  348   WLRVLRRIVCSGSMWRFLGTSKV----LTSSDVWFLGKCYKLSSEESSSDS-DSESGHAT  402

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYR+GF  I +SKYT+D  WGCM+RSSQMLVAQAL+FH LGRSWR+  E
Sbjct  403   FLEDFSSRIWITYRRGFDAISDSKYTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRRPSE  462

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             K     Y+ IL++FGDSE  A+SIHNLLQAG +Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  463   KPYNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYAMCRAWQTLVRTNRE  522

Query  1003  DAE  1011
               E
Sbjct  523   QHE  525



>ref|XP_002878306.1| autophagy 4b [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54565.1| autophagy 4b [Arabidopsis lyrata subsp. lyrata]
Length=476

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 138/188 (73%), Gaps = 7/188 (4%)
 Frame = +1

Query  463   WTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT  L+ A M SG++ R    +LG ++TGI S S ++IWLLG CYK+++ +S   +    
Sbjct  77    WTVILKTASMASGAIRRFQDRVLGPSRTGISS-STSEIWLLGVCYKISEAES-FEEADAG  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
             +  A+F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRS QML AQALLF RLGRSW
Sbjct  135   RVLAAFRQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK   +   + YLEIL LFGD+E SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+LA
Sbjct  195   RKKDSEPPNEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLA  254

Query  988   CCKREDAE  1011
                +E+ +
Sbjct  255   RKNKEETD  262



>gb|EMS55294.1| hypothetical protein TRIUR3_04442 [Triticum urartu]
Length=511

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR +  GS+WR LG  K    +++  D+  LG CYK++ ++S S       G A+
Sbjct  82    WSRVLRRFVGGGSMWRFLGCGK----ALTAADVQFLGKCYKLSSEESSSDS-DSEGGHAA  136

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  +
Sbjct  137   FLEDFSSRIWITYRKGFDAISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPAQ  196

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
                   Y+ IL+LFGDSE  A+SIHNLLQAGK+Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  197   NPSNPEYIRILHLFGDSEACAFSIHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIRTNRE  256

Query  1003  DAE  1011
               E
Sbjct  257   QPE  259



>gb|AGW81780.1| autophagy-related protein 4b [Triticum aestivum]
Length=484

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 131/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR +  GS+WR LG  K    +++  D+W LG CYK++ ++S S   ++  G A+
Sbjct  80    WSRVLRRFVGGGSMWRFLGCGK----ALTAADVWFLGKCYKLSSEESSSDSDSEG-GHAA  134

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSR+ ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  +
Sbjct  135   FLEDFSSRVWITYRKGFDAISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPAQ  194

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
                +  +  IL+LFGDSE  A+SIHNLLQAGK+Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  195   SPSDPEHTRILHLFGDSEVCAFSIHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIRTNRE  254

Query  1003  DAE  1011
               E
Sbjct  255   QPE  257



>ref|XP_010512286.1| PREDICTED: cysteine protease ATG4b-like isoform X1 [Camelina 
sativa]
Length=477

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = +1

Query  463   WTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT  L+ A M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +    
Sbjct  78    WTVILKTASMASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEADSG  135

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
                 +F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSW
Sbjct  136   HVLTAFGQDFSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRSW  195

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK   +  E+ YL IL LFGDSE SA+SIHNL+QAG++Y L+ GSWVGPYA+CR+WE+L 
Sbjct  196   RKKESEPPEEEYLGILELFGDSEASAFSIHNLIQAGESYGLAAGSWVGPYAVCRSWESLV  255

Query  988   CCKREDAE  1011
               K E+ +
Sbjct  256   RKKSEETD  263



>gb|ACN76571.1| cysteine proteinase [Triticum aestivum]
Length=486

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 130/183 (71%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR +  GS+WR LG  K    +++  D+  LG CYK++ ++S S   ++  G A+
Sbjct  82    WSRVLRRFVGGGSMWRFLGCGK----ALTAADVQFLGKCYKLSSEESSSDSDSEG-GHAA  136

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSRI ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  +
Sbjct  137   FLEDFSSRIWITYRKGFDAISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPAQ  196

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
                   Y+ IL+LFGDSE  A+SIHNLLQAGK+Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  197   NPSNPEYIRILHLFGDSEACAFSIHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIRTNRE  256

Query  1003  DAE  1011
               E
Sbjct  257   QPE  259



>ref|XP_004290339.1| PREDICTED: cysteine protease ATG4-like [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 133/180 (74%), Gaps = 18/180 (10%)
 Frame = +1

Query  463  WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
            WT+A+ R ++     R++G ++   P  S++D+WLLG CY          D ++S   A 
Sbjct  5    WTAAVMRRIHE----RVVGSSRAA-PISSSSDVWLLGVCYNF--------DESESSPLA-  50

Query  643  FVEDFSSRILITYRKGFAPI--GESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKS  816
            F +DFSSRIL+TYR+GF  I  G+SK+T+D  WGCM+RSSQMLVAQALLFHRLGRSWR+ 
Sbjct  51   FEQDFSSRILMTYRRGFDLIEGGDSKFTSDVNWGCMIRSSQMLVAQALLFHRLGRSWRRP  110

Query  817  LEKL--LEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLAC  990
            ++K   LEQ Y++IL LFGDSE + +SIHNL+QAGK Y+L+ GSWVGPYAMCR+WETL C
Sbjct  111  VDKSCGLEQEYVKILRLFGDSEAAVFSIHNLIQAGKGYNLAAGSWVGPYAMCRSWETLVC  170



>gb|ACN76570.1| cysteine proteinase [Triticum aestivum]
Length=484

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 131/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR +  GS+WR LG  K    +++  D+W LG CYK++ ++S S   ++  G A+
Sbjct  80    WSRVLRRFVGGGSMWRFLGCGK----ALTAGDVWFLGKCYKLSSEESSSDSDSEG-GHAA  134

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSR+ ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  +
Sbjct  135   FLEDFSSRVWITYRKGFDVISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPAQ  194

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
                +  +  IL+LFGDSE  A+SIHNLLQAGK+Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  195   NPSDPEHTRILHLFGDSEVCAFSIHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIRTNRE  254

Query  1003  DAE  1011
               E
Sbjct  255   QPE  257



>gb|AGW81779.1| autophagy-related protein 4a [Triticum aestivum]
Length=483

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 131/183 (72%), Gaps = 5/183 (3%)
 Frame = +1

Query  463   WTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFAS  642
             W+  LRR +  GS+WR LG  K    +++  D+W LG CYK++ ++S S   ++  G A+
Sbjct  79    WSRVLRRFVGGGSMWRFLGCGK----ALTAGDVWFLGKCYKLSSEESSSDSDSEG-GHAA  133

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F+EDFSSR+ ITYRKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  +
Sbjct  134   FLEDFSSRVWITYRKGFDVISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPAQ  193

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
                +  +  IL+LFGDSE  A+SIHNLLQAGK+Y L+ GSWVGPYAMCR W+TL    RE
Sbjct  194   NPSDPEHTRILHLFGDSEVCAFSIHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIRTNRE  253

Query  1003  DAE  1011
               E
Sbjct  254   QPE  256



>ref|XP_008810461.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 127/168 (76%), Gaps = 2/168 (1%)
 Frame = +1

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             R+LG + T   S++ ++IWLLG  YK++ ++S S       G A+F+EDFSSRI ITYRK
Sbjct  7     RLLGTSSTDALSLT-SEIWLLGMRYKLSPEES-SGGADHGNGSAAFLEDFSSRIWITYRK  64

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IG SK T+D  WGCM+RSSQMLVAQALLFH LGR WRK  +K  +  Y+EIL+LFG
Sbjct  65    GFDAIGYSKLTSDVRWGCMIRSSQMLVAQALLFHHLGRYWRKPSQKPHDPKYIEILHLFG  124

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DSE  A+S+HNLL+AGK Y L+ GSW+GPYAMCRTWETLA  KRE A+
Sbjct  125   DSEACAFSLHNLLEAGKGYGLAAGSWLGPYAMCRTWETLARAKREQAD  172



>ref|XP_010413618.1| PREDICTED: cysteine protease ATG4b-like isoform X1 [Camelina 
sativa]
Length=476

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 136/188 (72%), Gaps = 7/188 (4%)
 Frame = +1

Query  463   WTSALRRA-MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT   + A M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +    
Sbjct  77    WTVIFKTASMASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEGDSG  134

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
                 +F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSW
Sbjct  135   HVLTAFGQDFSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRSW  194

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK   +  E+ YL IL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L 
Sbjct  195   RKKESEPPEEEYLGILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLV  254

Query  988   CCKREDAE  1011
               KRE+ +
Sbjct  255   RKKREETD  262



>ref|XP_010512287.1| PREDICTED: cysteine protease ATG4b-like isoform X2 [Camelina 
sativa]
Length=391

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +        +F +D
Sbjct  1     MASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEADSGHVLTAFGQD  58

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             FSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSWRK   +  E
Sbjct  59    FSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRSWRKKESEPPE  118

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             + YL IL LFGDSE SA+SIHNL+QAG++Y L+ GSWVGPYA+CR+WE+L   K E+ +
Sbjct  119   EEYLGILELFGDSEASAFSIHNLIQAGESYGLAAGSWVGPYAVCRSWESLVRKKSEETD  177



>ref|XP_010469252.1| PREDICTED: cysteine protease ATG4b isoform X3 [Camelina sativa]
 ref|XP_010469253.1| PREDICTED: cysteine protease ATG4b isoform X3 [Camelina sativa]
Length=391

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +        +F +D
Sbjct  1     MASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEADSGHVLTAFGQD  58

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             FSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSWRK   +  E
Sbjct  59    FSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRSWRKKESEPPE  118

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             + YL IL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L   KRE+ +
Sbjct  119   EEYLGILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLVRKKREETD  177



>ref|XP_010469254.1| PREDICTED: cysteine protease ATG4b isoform X4 [Camelina sativa]
 ref|XP_010469255.1| PREDICTED: cysteine protease ATG4b isoform X4 [Camelina sativa]
 ref|XP_010469256.1| PREDICTED: cysteine protease ATG4b isoform X4 [Camelina sativa]
Length=391

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +        +F +D
Sbjct  1     MASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEADSGHVLTAFGQD  58

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             FSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSWRK   +  E
Sbjct  59    FSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRSWRKKESEPPE  118

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             + YL IL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L   KRE+ +
Sbjct  119   EEYLGILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLIRKKREETD  177



>gb|AFK45336.1| unknown [Lotus japonicus]
Length=489

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +1

Query  565   LLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCM  744
              LG C+K +Q +S + D   S  FA+F +DFSS+IL+TYRKGF  IG+SKYT+D  WGCM
Sbjct  118   FLGVCHKFSQQES-TGDVDNSTVFAAFEQDFSSKILLTYRKGFDAIGDSKYTSDVNWGCM  176

Query  745   LRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAY  924
             LRSSQMLVAQALLFH+LGR WRK+ +K L++ YL+IL  FGDSE S++SIHNLLQAGK Y
Sbjct  177   LRSSQMLVAQALLFHKLGRMWRKTTDKPLDKEYLDILQHFGDSEASSFSIHNLLQAGKGY  236

Query  925   DLSPGSWVGPYAMCRTWETLACCKRE  1002
              L+ GSWVGPYAMCR+WE LA  +RE
Sbjct  237   GLAVGSWVGPYAMCRSWEVLARNQRE  262



>ref|XP_010413619.1| PREDICTED: cysteine protease ATG4b-like isoform X2 [Camelina 
sativa]
Length=391

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++     R+LG ++TGI S S ++IWLLG CYK++  +S S +        +F +D
Sbjct  1     MASGAIRRFQERVLGPSRTGISS-STSEIWLLGVCYKISDGES-SEEGDSGHVLTAFGQD  58

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             FSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQALLF RLGRSWRK   +  E
Sbjct  59    FSSLILMTYRRGFEPIGDTAYTSDVNWGCMLRSSQMLFAQALLFQRLGRSWRKKESEPPE  118

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             + YL IL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L   KRE+ +
Sbjct  119   EEYLGILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLVRKKREETD  177



>emb|CDY45773.1| BnaC04g22590D [Brassica napus]
Length=427

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 140/190 (74%), Gaps = 8/190 (4%)
 Frame = +1

Query  460   GWTSALRRA--MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPT  621
             GWT  +  A  M SG++ R    +LG ++TGIPS + ++IWLLG CYK+++ +S S +  
Sbjct  27    GWTVIVNTASSMASGAIRRFQDRVLGPSRTGIPS-TTSEIWLLGVCYKISEAES-SEEAD  84

Query  622   QSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGR  801
                   +F +DFSS ILITYR+GF PIGE+ YT+D GWGCMLRS QML AQALLF RLGR
Sbjct  85    AGSVLDAFRQDFSSLILITYRRGFEPIGETTYTSDVGWGCMLRSGQMLFAQALLFQRLGR  144

Query  802   SWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWET  981
             SWRK   +  E+ YLEIL LFGDS  SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+
Sbjct  145   SWRKKESEPSEEEYLEILELFGDSGASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWES  204

Query  982   LACCKREDAE  1011
             LA  KRE+ +
Sbjct  205   LARKKREETD  214



>ref|XP_009138889.1| PREDICTED: cysteine protease ATG4b isoform X1 [Brassica rapa]
Length=419

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 140/189 (74%), Gaps = 16/189 (8%)
 Frame = +1

Query  460   GWTSALRRA--MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPT  621
             GWT  +  A  M SG++ R    +LG ++TGIPS + ++IWLLG CYK+++         
Sbjct  30    GWTVIVNTATSMASGAIRRFQDRVLGPSRTGIPS-TTSEIWLLGVCYKISE--------A  80

Query  622   QSQGFA-SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLG  798
             +S G A +F +DFSS ILITYR+GF PIGE+ YT+D GWGCMLRS QML AQALLF RLG
Sbjct  81    ESLGEADAFRQDFSSLILITYRRGFEPIGETTYTSDVGWGCMLRSGQMLFAQALLFQRLG  140

Query  799   RSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWE  978
             RSWRK   +  E+ YLEIL LFGDSE SA+SIH+L+ AG++Y L+ GSWVGPYA+CR+WE
Sbjct  141   RSWRKKESEPSEEEYLEILELFGDSEASAFSIHSLILAGESYGLAAGSWVGPYAVCRSWE  200

Query  979   TLACCKRED  1005
             +LA  KRE+
Sbjct  201   SLARKKREE  209



>ref|XP_009138890.1| PREDICTED: cysteine protease ATG4b isoform X2 [Brassica rapa]
Length=379

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 15/181 (8%)
 Frame = +1

Query  466   TSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFA-S  642
             + A+RR  +     R+LG ++TGIPS + ++IWLLG CYK+++         +S G A +
Sbjct  3     SGAIRRFQD-----RVLGPSRTGIPS-TTSEIWLLGVCYKISE--------AESLGEADA  48

Query  643   FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLE  822
             F +DFSS ILITYR+GF PIGE+ YT+D GWGCMLRS QML AQALLF RLGRSWRK   
Sbjct  49    FRQDFSSLILITYRRGFEPIGETTYTSDVGWGCMLRSGQMLFAQALLFQRLGRSWRKKES  108

Query  823   KLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
             +  E+ YLEIL LFGDSE SA+SIH+L+ AG++Y L+ GSWVGPYA+CR+WE+LA  KRE
Sbjct  109   EPSEEEYLEILELFGDSEASAFSIHSLILAGESYGLAAGSWVGPYAVCRSWESLARKKRE  168

Query  1003  D  1005
             +
Sbjct  169   E  169



>gb|EMT18890.1| hypothetical protein F775_28054 [Aegilops tauschii]
Length=392

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 123/170 (72%), Gaps = 5/170 (3%)
 Frame = +1

Query  502   VWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITY  681
             +WR LG  K    +++  D+W LG CYK++ ++S S   ++  G A+F+EDFSSR+ ITY
Sbjct  1     MWRFLGCGK----ALTAADVWFLGKCYKLSSEESSSDSDSEG-GHAAFLEDFSSRVWITY  55

Query  682   RKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNL  861
             RKGF  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRSWRK  +   +  +  IL+L
Sbjct  56    RKGFDAISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSWRKPAQSPSDPEHTRILHL  115

Query  862   FGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             FGDSE  A+SIHNLLQAGK+Y L+ GSWVGPYAMCR W+TL    RE  E
Sbjct  116   FGDSEVCAFSIHNLLQAGKSYGLAAGSWVGPYAMCRAWQTLIRTNREQPE  165



>ref|XP_006402637.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
 gb|ESQ44090.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
Length=474

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 140/189 (74%), Gaps = 7/189 (4%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT  L+ A M SG++ R    +LG ++ GIPS S ++IWLLG CYK+++ +S S +   
Sbjct  76    GWTVILKTASMASGAIRRFQDRVLGPSRIGIPS-STSEIWLLGVCYKISESES-SEEADS  133

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+F +DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQA LF RLGRS
Sbjct  134   GLVLAAFRQDFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSSQMLFAQAFLFQRLGRS  193

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             WRK   +  E+ YLEIL LF DSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+L
Sbjct  194   WRKKESEPPEEEYLEILELFCDSESSAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESL  253

Query  985   ACCKREDAE  1011
             A  KRE+ +
Sbjct  254   ARQKREETD  262



>ref|XP_001758116.1| predicted protein [Physcomitrella patens]
 gb|EDQ76938.1| predicted protein, partial [Physcomitrella patens]
Length=356

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = +1

Query  511   ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKG  690
             +LG   T   + S ++IW+LG CYKV+ D  P+ +    Q F  F+ DF+SRI ITYRKG
Sbjct  10    LLGPRFTAANASSGSEIWVLGLCYKVSAD--PNNETLSVQAFEEFISDFTSRIWITYRKG  67

Query  691   FAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGD  870
             F  +G+SK T+D GWGCMLRS QML+AQAL+ H LGRSWR+   +   Q YL+IL  FGD
Sbjct  68    FECVGQSKLTSDVGWGCMLRSGQMLLAQALVCHYLGRSWRREPGQPCSQAYLQILQTFGD  127

Query  871   SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAEN  1014
             SE   +SIHNLL+AG  + L+ GSW+GPYA+CRT E LA   RE ++ 
Sbjct  128   SESCPFSIHNLLEAGHPFGLAAGSWLGPYALCRTLEALARADREQSQK  175



>emb|CDY41195.1| BnaA09g38200D [Brassica napus]
Length=447

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 134/189 (71%), Gaps = 14/189 (7%)
 Frame = +1

Query  460   GWTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT  L+ A M SG++ R    +LG ++TGIPS S ++IWLLG CYK+++ +S       
Sbjct  59    GWTVILKTASMASGAIKRLQDRVLGPSRTGIPS-STSEIWLLGVCYKISESES-------  110

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
             S+   +F +DFSS +L+TYR+GF  IG++ YT+D  WGCMLRS QML AQALLF RLGRS
Sbjct  111   SEVVDAFRQDFSSLVLMTYRRGFEAIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRS  170

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
             WRK  +   E+     L LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE L
Sbjct  171   WRKDSQPPEEEYLEI-LELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWEAL  229

Query  985   ACCKREDAE  1011
                +RE+ +
Sbjct  230   VRKRREETD  238



>ref|XP_006397589.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 ref|XP_006397590.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39042.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39043.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
Length=365

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (67%), Gaps = 29/181 (16%)
 Frame = +1

Query  487   MNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDD-SPSTDPTQSQGFASFVE  651
             M SG++     R+LG N+TG+PS + +D+WLLG CYK+++D+ S  TD            
Sbjct  1     MTSGAIRRFQERVLGPNRTGLPS-TTSDVWLLGVCYKISEDEASGETD------------  47

Query  652   DFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLL  831
                         GF PI ++ YT+D  WGCMLRSSQML AQALLFHRLGRSWR    +  
Sbjct  48    -----------DGFEPIKDTTYTSDVNWGCMLRSSQMLFAQALLFHRLGRSWRTKKSEPP  96

Query  832   EQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             EQ YLE L LFGDSE SA+SIHNL+  G++Y L+ GSW+GPYA+CR+WE+LAC KR+  +
Sbjct  97    EQEYLETLELFGDSEASAFSIHNLILVGESYGLAAGSWIGPYAICRSWESLACKKRKQTD  156

Query  1012  N  1014
             +
Sbjct  157   S  157



>ref|XP_008441686.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Cucumis melo]
Length=455

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 132/225 (59%), Gaps = 42/225 (19%)
 Frame = +1

Query  340   SFWSGFRVSAFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSV----W  507
             S WSGF  S FS       +H K S          +H    W + +R+ M SGS+     
Sbjct  42    SLWSGFFSSNFS-----ICDHHKDSSVSEKKVFHSRHNV--WAT-VRKVMTSGSMRRIQE  93

Query  508   RILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRK  687
             RILG  ++G+ + S  DIWLLG C+K++QD  P  D   S G A F +DFSSRIL+TYRK
Sbjct  94    RILGSRRSGVYT-SGGDIWLLGVCHKISQDHLPD-DAASSTGVAGFEQDFSSRILMTYRK  151

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  I +SKYT+D  WGCMLRSSQMLV+QALLFHRLGRSWRK  +K              
Sbjct  152   GFNVIQDSKYTSDVNWGCMLRSSQMLVSQALLFHRLGRSWRKPSQK--------------  197

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRE  1002
                           AG+AYDL+ GSWVGPYAMCR+WETL   KRE
Sbjct  198   --------------AGRAYDLAAGSWVGPYAMCRSWETLVRSKRE  228



>ref|XP_006402636.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
 gb|ESQ44089.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
Length=389

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 134/180 (74%), Gaps = 7/180 (4%)
 Frame = +1

Query  472   ALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVE  651
             A+RR  +     R+LG ++ GIPS S ++IWLLG CYK+++ +S S +       A+F +
Sbjct  5     AIRRFQD-----RVLGPSRIGIPS-STSEIWLLGVCYKISESES-SEEADSGLVLAAFRQ  57

Query  652   DFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLL  831
             DFSS IL+TYR+GF PIG++ YT+D  WGCMLRSSQML AQA LF RLGRSWRK   +  
Sbjct  58    DFSSLILMTYRRGFEPIGDTTYTSDVNWGCMLRSSQMLFAQAFLFQRLGRSWRKKESEPP  117

Query  832   EQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             E+ YLEIL LF DSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE+LA  KRE+ +
Sbjct  118   EEEYLEILELFCDSESSAFSIHNLILAGESYGLAAGSWVGPYAVCRSWESLARQKREETD  177



>ref|XP_009116671.1| PREDICTED: cysteine protease ATG4b isoform X1 [Brassica rapa]
Length=442

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (73%), Gaps = 14/186 (8%)
 Frame = +1

Query  463   WTSALRRA-MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQS  627
             WT  L+ A M SG++ R    +LG ++ GIPS S ++IWLLG CYK+++ +S       S
Sbjct  60    WTVILKTASMASGAIKRLQDRVLGPSRIGIPS-STSEIWLLGVCYKISESES-------S  111

Query  628   QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
             +   +F +DFSS +L+TYR+GF  IG++ YT+D  WGCMLRS QML AQALLF RLGRSW
Sbjct  112   ELAGAFRQDFSSLVLMTYRRGFEAIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSW  171

Query  808   RKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             RK  +   E+ YLEIL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE L 
Sbjct  172   RKDSQP-PEEEYLEILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWEALV  230

Query  988   CCKRED  1005
               +RE+
Sbjct  231   RKRREE  236



>gb|AAC23418.1| unknown protein [Arabidopsis thaliana]
Length=451

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 24/190 (13%)
 Frame = +1

Query  460   GWTSALRR-AMNSGSV----WRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQ  624
             GWT+ ++R +M SG++     R+LG N+TG+PS + +D+WLLG CYK++ D++ S +   
Sbjct  74    GWTAFVKRVSMASGAIRRFQERVLGPNRTGLPS-TTSDVWLLGVCYKISADEN-SGETDT  131

Query  625   SQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRS  804
                 A+   DFSS+IL+TYRKGF P  ++ YT+D  WGCM+RSSQML AQ          
Sbjct  132   GTVLAALQLDFSSKILMTYRKGFEPFRDTTYTSDVNWGCMIRSSQMLFAQ----------  181

Query  805   WRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETL  984
                    L EQ YLE L  FGDSE SA+SIHNL+ AG +Y L+ GSWVGPYA+CR WE+L
Sbjct  182   -------LPEQEYLETLEPFGDSEPSAFSIHNLIIAGASYGLAAGSWVGPYAICRAWESL  234

Query  985   ACCKREDAEN  1014
             AC KR+  ++
Sbjct  235   ACKKRKQTDS  244



>ref|XP_008661519.1| PREDICTED: autophagy-related 4b isoform X3 [Zea mays]
 gb|ACF82474.1| unknown [Zea mays]
 gb|AFW59940.1| autophagy 4b variant 3 [Zea mays]
Length=462

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +1

Query  583   KVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQM  762
             +V+ ++  S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQM
Sbjct  95    RVSPEEEESGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQM  154

Query  763   LVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGS  942
             LVAQAL+FH LGRSWRK  EK  + +Y+ +L+LFGDSE  A+SIHNLLQAG+ Y L+ GS
Sbjct  155   LVAQALIFHHLGRSWRKPSEKPYDPDYIRVLHLFGDSEACAFSIHNLLQAGRNYGLAAGS  214

Query  943   WVGPYAMCRTWETLACCKREDAE  1011
             WVGPYAMCR W+TL    RE A+
Sbjct  215   WVGPYAMCRAWQTLIRTNREQAD  237



>ref|XP_009116672.1| PREDICTED: cysteine protease ATG4b isoform X2 [Brassica rapa]
Length=374

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (73%), Gaps = 13/177 (7%)
 Frame = +1

Query  487   MNSGSVWR----ILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVED  654
             M SG++ R    +LG ++ GIPS S ++IWLLG CYK+++ +S       S+   +F +D
Sbjct  1     MASGAIKRLQDRVLGPSRIGIPS-STSEIWLLGVCYKISESES-------SELAGAFRQD  52

Query  655   FSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLE  834
             FSS +L+TYR+GF  IG++ YT+D  WGCMLRS QML AQALLF RLGRSWRK  +   E
Sbjct  53    FSSLVLMTYRRGFEAIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSWRKDSQPPEE  112

Query  835   QNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKRED  1005
             +  LEIL LFGDSE SA+SIHNL+ AG++Y L+ GSWVGPYA+CR+WE L   +RE+
Sbjct  113   EY-LEILELFGDSEASAFSIHNLILAGESYGLAAGSWVGPYAVCRSWEALVRKRREE  168



>ref|XP_001770869.1| predicted protein [Physcomitrella patens]
 gb|EDQ64393.1| predicted protein, partial [Physcomitrella patens]
Length=346

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = +1

Query  541  SVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYT  720
            S S  +IW+LG CYKV+ D   + +   +  F  F+ DFSSRI ITYRKGF  +GESK T
Sbjct  4    SSSGGEIWVLGICYKVSAD--ANDEAVSAHAFEEFLNDFSSRIWITYRKGFESLGESKLT  61

Query  721  NDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHN  900
            +D GWGCMLRS Q+L+AQAL+ H LGR+WR++  +   Q YL+IL  FGDSE  ++SIHN
Sbjct  62   SDVGWGCMLRSGQILLAQALVCHYLGRTWRRNACQECLQEYLQILQSFGDSESCSFSIHN  121

Query  901  LLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            LL+AG+ + L+ GSW+GPYA+CRT E LA
Sbjct  122  LLEAGRPFGLAAGSWLGPYALCRTLEALA  150



>ref|XP_002975752.1| hypothetical protein SELMODRAFT_54753, partial [Selaginella moellendorffii]
 gb|EFJ23381.1| hypothetical protein SELMODRAFT_54753, partial [Selaginella moellendorffii]
Length=358

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 122/188 (65%), Gaps = 17/188 (9%)
 Frame = +1

Query  463  WTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDP----  618
            WT+A+RRA+  G V RI    +G+ + G    S + IWLLG CY++    + STD     
Sbjct  1    WTAAVRRAV--GPVRRIQECLMGM-RGGNGISSGSAIWLLGACYRMGASSTSSTDEEAKE  57

Query  619  ---TQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
               +  +  A F+ DFSSRI ITYR+GF  IGESK+T+D GWGCM+RS QML AQAL+ H
Sbjct  58   STSSSPEAVADFLLDFSSRIWITYRQGFEAIGESKFTSDVGWGCMIRSGQMLFAQALVCH  117

Query  790  RLGRSWRKSLEKLLEQNYLEILNLFGDSEESA--YSIHNLLQAGKAYDLSPGSWVGPYAM  963
            RLGR WR+  E+   + YLEIL+ F DS   A  +SIHN ++AG  Y L+ GSW+GPYA+
Sbjct  118  RLGRGWRRG-EQPYAREYLEILHSFVDSPSPACPFSIHNFIRAGSPYGLAAGSWLGPYAL  176

Query  964  CRTWETLA  987
            C   E LA
Sbjct  177  CHAIEALA  184



>ref|XP_002973701.1| hypothetical protein SELMODRAFT_54035, partial [Selaginella moellendorffii]
 gb|EFJ25361.1| hypothetical protein SELMODRAFT_54035, partial [Selaginella moellendorffii]
Length=358

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 122/188 (65%), Gaps = 17/188 (9%)
 Frame = +1

Query  463  WTSALRRAMNSGSVWRI----LGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDP----  618
            WT+A+RRA+  G V RI    +G+ + G    S + IWLLG CY++    + STD     
Sbjct  1    WTAAVRRAV--GPVRRIQECLMGM-RGGNGISSGSAIWLLGACYRMGASSTSSTDEEAKE  57

Query  619  ---TQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFH  789
               +  +  A F+ DFSSRI ITYR+GF  IGESK+T+D GWGCM+RS QML AQAL+ H
Sbjct  58   STSSSPEAVADFLLDFSSRIWITYRQGFEAIGESKFTSDVGWGCMIRSGQMLFAQALVCH  117

Query  790  RLGRSWRKSLEKLLEQNYLEILNLFGDSEESA--YSIHNLLQAGKAYDLSPGSWVGPYAM  963
            RLGR WR+  E+   + YLEIL+ F DS   A  +SIHN ++AG  Y L+ GSW+GPYA+
Sbjct  118  RLGRGWRRG-EQPYAREYLEILHSFVDSPSPACPFSIHNFIRAGSPYGLAAGSWLGPYAL  176

Query  964  CRTWETLA  987
            C   E LA
Sbjct  177  CHAIEALA  184



>ref|XP_008668674.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Zea mays]
Length=486

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 129/205 (63%), Gaps = 10/205 (5%)
 Frame = +1

Query  397   EHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGC  576
             +    SP   A S      + G +  LRR + SGS+WR+LG  +     ++++D+W LG 
Sbjct  70    QQGSSSPACDARSTKSSSGSYGLSRILRRFVGSGSMWRLLGCGRV----LTSSDVWFLGK  125

Query  577   CYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSS  756
             CYKV+ ++  S D     G A+F+EDFSSRI ITYRKGF  I +SK T+D  WGCM+RSS
Sbjct  126   CYKVSPEEEESGDSESDSGHAAFLEDFSSRIWITYRKGFDAISDSKLTSDVNWGCMVRSS  185

Query  757   QMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSP  936
             QMLVAQAL+FH LGRSWRK  EK+ E      + L    +E   +  +++ AG+ Y L+ 
Sbjct  186   QMLVAQALIFHHLGRSWRKPPEKVRE------IWLDHQCKEKMRNFCSVIVAGRNYGLAA  239

Query  937   GSWVGPYAMCRTWETLACCKREDAE  1011
             GSW+GPYAMCR W+TL    RE A+
Sbjct  240   GSWLGPYAMCRAWQTLIRTNREQAD  264



>gb|KJB46919.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=345

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  688   GFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFG  867
             GF  IGE+K T+D+ WGCMLRSSQMLVAQALLFHRLGRSWRK  +K  +  Y+EIL+ FG
Sbjct  12    GFDAIGETKITSDASWGCMLRSSQMLVAQALLFHRLGRSWRKPSQKPFDLAYIEILHQFG  71

Query  868   DSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             DSE SA+SIHNL++AGK Y L+ GSWVGPYAMCR+WE+LA  KRE+ +
Sbjct  72    DSEASAFSIHNLVEAGKNYGLAAGSWVGPYAMCRSWESLARSKREEID  119



>gb|AAR06350.1| putative autophagy, 3'-partial [Oryza sativa Japonica Group]
Length=207

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 113/170 (66%), Gaps = 8/170 (5%)
 Frame = +1

Query  367  AFSSSGATAAEHSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSV  546
             FSS  +    H   S  +   SL P   +  W+  LRR   +GS+WR LG +K    ++
Sbjct  45   VFSSPFSIFEAHQDSSANR---SLKPHSGSYAWSRFLRRIACTGSMWRFLGASK----AL  97

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            +++D+W LG CYK++ ++  ++   +S G A+F+EDFSSRI ITYRKGF  I +SKYT+D
Sbjct  98   TSSDVWFLGKCYKLSSEELSNSSDCES-GNAAFLEDFSSRIWITYRKGFDAISDSKYTSD  156

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSE  876
              WGCM+RSSQMLVAQAL+FH LGRSWRK  +K     Y+ IL++FGDSE
Sbjct  157  VNWGCMVRSSQMLVAQALIFHHLGRSWRKPSQKPYSPEYIGILHMFGDSE  206



>ref|XP_006441972.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
 gb|ESR55212.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
Length=314

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  742  MLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKA  921
            MLRSSQMLVAQALLFHRLGR WRK L+K  ++ Y+EIL+LFGDSE S +SIHNLLQAGKA
Sbjct  1    MLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKA  60

Query  922  YDLSPGSWVGPYAMCRTWETLACCKR  999
            Y L+ GSWVGPYAMCR+WE LA C+R
Sbjct  61   YGLAAGSWVGPYAMCRSWEALARCQR  86



>gb|ACJ73916.1| autophagy-related 4b variant 4 [Zea mays]
Length=208

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = +1

Query  427  ASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSP  606
            ASS  P   +  W+  LRR + SGS+WR+LG  +     +++ D+W LG CY+V+ ++  
Sbjct  77   ASSTKPPSGSYAWSRILRRFVGSGSMWRLLGCARV----LTSGDVWFLGKCYRVSPEEEE  132

Query  607  STDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLF  786
            S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQMLVAQAL+F
Sbjct  133  SGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQMLVAQALIF  192

Query  787  HRLGRSWRKSLEK  825
            H LGRSWRK  EK
Sbjct  193  HHLGRSWRKPSEK  205



>gb|ACJ73918.1| autophagy-related 4b variant 6 [Zea mays]
Length=271

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = +1

Query  427  ASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSP  606
            ASS  P   +  W+  LRR + SGS+WR+LG  +     +++ D+W LG CY+V+ ++  
Sbjct  77   ASSTKPPSGSYAWSRILRRFVGSGSMWRLLGCARV----LTSGDVWFLGKCYRVSPEEEE  132

Query  607  STDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLF  786
            S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQMLVAQAL+F
Sbjct  133  SGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQMLVAQALIF  192

Query  787  HRLGRSWRKSLEKL  828
            H LGRSWRK  EKL
Sbjct  193  HHLGRSWRKPSEKL  206



>gb|ACJ73917.1| autophagy-related 4b variant 5 [Zea mays]
Length=292

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = +1

Query  427  ASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSP  606
            ASS  P   +  W+  LRR + SGS+WR+LG  +     +++ D+W LG CY+V+ ++  
Sbjct  77   ASSTKPPSGSYAWSRILRRFVGSGSMWRLLGCARV----LTSGDVWFLGKCYRVSPEEEE  132

Query  607  STDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLF  786
            S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQMLVAQAL+F
Sbjct  133  SGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQMLVAQALIF  192

Query  787  HRLGRSWRKSLEKL  828
            H LGRSWRK  EKL
Sbjct  193  HHLGRSWRKPSEKL  206



>tpg|DAA48004.1| TPA: hypothetical protein ZEAMMB73_510335 [Zea mays]
 tpg|DAA48023.1| TPA: hypothetical protein ZEAMMB73_786179 [Zea mays]
Length=472

 Score =   143 bits (361),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +1

Query  691   FAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGD  870
             F  I +SK T+D  WGCM+RSSQMLVAQAL+FH LGRS RK  EK    +Y+ +L+LFGD
Sbjct  34    FDAISDSKLTSDVNWGCMVRSSQMLVAQALIFHHLGRSCRKPPEKPYNPDYIGVLHLFGD  93

Query  871   SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             SE  A+SIHNLLQAG+ Y L+ GSW+GPYAMCR W+TL    RE A+
Sbjct  94    SEACAFSIHNLLQAGRNYGLAAGSWLGPYAMCRAWQTLIHTNREQAD  140



>emb|CDX71857.1| BnaC08g30170D [Brassica napus]
Length=130

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 95/137 (69%), Gaps = 15/137 (11%)
 Frame = +1

Query  466  TSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASF  645
            + A+RR  +     R+LG ++TGIPS S ++IWLLG CYK+++ +S       SQ   +F
Sbjct  3    SGAIRRLQD-----RVLGPSRTGIPS-STSEIWLLGVCYKISESES-------SQVADAF  49

Query  646  VEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEK  825
             +DFSS +L+TYR+GF  IG++ YT+D  WGCMLRS QML AQALLF RLGRSWRK   +
Sbjct  50   TQDFSSFVLMTYRRGFEAIGDTTYTSDVNWGCMLRSGQMLFAQALLFQRLGRSWRKKESE  109

Query  826  LLEQNYLEILN--LFGD  870
              E+ YLEIL+  LF D
Sbjct  110  PPEEGYLEILDHMLFVD  126



>gb|AFW57899.1| hypothetical protein ZEAMMB73_419246 [Zea mays]
Length=290

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +1

Query  715   YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             Y + +G GCM+RSSQMLVAQAL+FH LGRSWRK  EK    +Y+ +L LFGDSE  A+SI
Sbjct  12    YGSLTGKGCMVRSSQMLVAQALIFHHLGRSWRKPPEKPYNPDYIGVLRLFGDSEACAFSI  71

Query  895   HNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCKREDAE  1011
             HNLLQA + Y L+ GSW+GPYAMCR W+TL    RE A+
Sbjct  72    HNLLQARRNYGLAAGSWLGPYAMCRAWQTLIRTNREQAD  110



>ref|XP_002158689.2| PREDICTED: cysteine protease ATG4C-like [Hydra vulgaris]
Length=442

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 91/162 (56%), Gaps = 13/162 (8%)
 Frame = +1

Query  517  GLNKTGIPSV-SNTDIWLLGCCYKVAQDDSPSTDPTQS-----QGFASFVEDFSSRILIT  678
            G N    PS  S++ IWLLG CY   Q +  S +  Q+      G   F EDFSS I ++
Sbjct  52   GFNVPYKPSFDSDSPIWLLGRCYYAKQAEYDSKNAVQNTQYKIHGIDCFFEDFSSLIYLS  111

Query  679  YRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYL--EI  852
            YRK F+ +  S  T+DSGWGCMLR+ QML+A ALL H L   WR S  K  E+NY+   I
Sbjct  112  YRKHFSQLANSNLTSDSGWGCMLRTGQMLLANALLIHMLKEGWRISERKYTEKNYIYRMI  171

Query  853  LNLFGD--SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRT  972
            L  F D  S+ S +S+H L++ G      PG W GP ++  T
Sbjct  172  LRFFNDENSDNSPFSLHELVRIGSK---KPGEWYGPTSVAHT  210



>ref|XP_005651667.1| peptidase C54 [Coccomyxa subellipsoidea C-169]
 gb|EIE27123.1| peptidase C54 [Coccomyxa subellipsoidea C-169]
Length=362

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +1

Query  628  QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
            Q   + + D  SRI +TYR+GF PI  S  T+D GWGC LRS QML+AQAL++H +GR W
Sbjct  15   QVLNAILSDLMSRIWMTYRRGFPPICGSGITSDVGWGCTLRSGQMLLAQALVYHLVGRQW  74

Query  808  RKSLEKLLEQNYLEILNLFGDS--EESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRT  972
            R+ LE    +   ++L  FGD   E+  +SIHN+   G+ + +  G W+GP  +C T
Sbjct  75   RRKLEAAYPEEVAQVLQWFGDQACEQRPFSIHNMCTTGQTHGVKAGDWLGPSGLCHT  131



>ref|XP_008483713.1| PREDICTED: cysteine protease ATG4B-like [Diaphorina citri]
Length=173

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = +1

Query  649  EDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKL  828
             D +SR+  TYRKGF PIG+S  T D GWGCMLR  QM++AQALLF  LGR W+ ++   
Sbjct  28   RDITSRLWFTYRKGFVPIGDSGLTTDKGWGCMLRCGQMVIAQALLFLHLGRDWQWNVNS-  86

Query  829  LEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             E+ YL+IL +F D   + YSIH +   G +   + G W GP  + +    LA
Sbjct  87   KEEAYLKILKMFEDRRTAPYSIHQIALTGASEGKAVGEWFGPNTVAQVLRKLA  139



>ref|NP_001019605.1| cysteine protease ATG4A [Danio rerio]
 gb|AAH95617.1| Zgc:111958 [Danio rerio]
Length=375

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 80/147 (54%), Gaps = 12/147 (8%)
 Frame = +1

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            ++  +W+LG CY V    S              + D  SR+  TYRK F+PIG +  ++D
Sbjct  22   TDEPVWILGACYNVKTKKS------------ELLSDVRSRLWFTYRKKFSPIGGTGPSSD  69

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
            +GWGCMLR  QM++AQAL+   LGR WR   EK   + Y  IL+ F D ++S YSIH + 
Sbjct  70   AGWGCMLRCGQMILAQALICSHLGRDWRWDPEKHQPKEYQRILDCFLDKKDSCYSIHQMA  129

Query  907  QAGKAYDLSPGSWVGPYAMCRTWETLA  987
            Q G     S G W GP  + +  + LA
Sbjct  130  QMGVGEGKSVGEWYGPNTVAQVLKKLA  156



>ref|XP_006679571.1| hypothetical protein BATDEDRAFT_35298 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79772.1| hypothetical protein BATDEDRAFT_35298 [Batrachochytrium dendrobatidis 
JAM81]
Length=441

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 78/140 (56%), Gaps = 12/140 (9%)
 Frame = +1

Query  604  PSTDPTQ-----SQGFAS-----FVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRS  753
            P+ DP       +Q ++S     F++DF SR+ +TYRKGFA I  + YT DSGWGCMLRS
Sbjct  115  PTLDPNSPIVFLAQTYSSLAHPHFLDDFHSRLWMTYRKGFAAIKPTGYTCDSGWGCMLRS  174

Query  754  SQMLVAQALLFHRLGRSWR--KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYD  927
             QMLVA ALLFH LGR WR   S ++     Y  IL  F D   S YSI  +   G  +D
Sbjct  175  GQMLVANALLFHELGRDWRLGDSNDRDTWLTYCSILTKFLDVNTSPYSIQRIATLGIRFD  234

Query  928  LSPGSWVGPYAMCRTWETLA  987
               G W GP  + +  + L 
Sbjct  235  KQIGEWFGPSTISQVLKVLV  254



>ref|XP_008193420.1| PREDICTED: cysteine protease ATG4D isoform X2 [Tribolium castaneum]
Length=428

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 89/160 (56%), Gaps = 30/160 (19%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQ------------------SQGFASFVEDFSSRILITYR  684
            +WLLG CY+  + +SPS+D T+                   +GF  F +DF SR+ +TYR
Sbjct  43   VWLLGKCYR--RIESPSSDSTELGTDVAAFQSQSEIASSDDEGFEGFKKDFISRLWLTYR  100

Query  685  KGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR-------KSLEKLLE-QN  840
            + F  +  S Y++D GWGCMLRS QML+AQAL+ H LGR WR        + E  +E  N
Sbjct  101  REFPILNGSNYSSDCGWGCMLRSGQMLIAQALVCHILGRDWRWQPDHQPTTRESFIEVVN  160

Query  841  YLEILNLFGD--SEESAYSIHNLLQAGKAYDLSPGSWVGP  954
            + +I+  FGD  S  S +SIH L+  G+A     G W GP
Sbjct  161  HRKIIKWFGDKPSRNSPFSIHTLVALGEASGKKAGDWYGP  200



>ref|XP_971091.2| PREDICTED: cysteine protease ATG4D isoform X1 [Tribolium castaneum]
 gb|EFA11495.1| hypothetical protein TcasGA2_TC014208 [Tribolium castaneum]
Length=453

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 89/160 (56%), Gaps = 30/160 (19%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQ------------------SQGFASFVEDFSSRILITYR  684
            +WLLG CY+  + +SPS+D T+                   +GF  F +DF SR+ +TYR
Sbjct  68   VWLLGKCYR--RIESPSSDSTELGTDVAAFQSQSEIASSDDEGFEGFKKDFISRLWLTYR  125

Query  685  KGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR-------KSLEKLLE-QN  840
            + F  +  S Y++D GWGCMLRS QML+AQAL+ H LGR WR        + E  +E  N
Sbjct  126  REFPILNGSNYSSDCGWGCMLRSGQMLIAQALVCHILGRDWRWQPDHQPTTRESFIEVVN  185

Query  841  YLEILNLFGD--SEESAYSIHNLLQAGKAYDLSPGSWVGP  954
            + +I+  FGD  S  S +SIH L+  G+A     G W GP
Sbjct  186  HRKIIKWFGDKPSRNSPFSIHTLVALGEASGKKAGDWYGP  225



>dbj|BAN21584.1| autophagy-specific protein, putative, partial [Riptortus pedestris]
Length=355

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 14/151 (9%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
            IP ++   +W+LG  Y    D            F +  +D  SR+  +YRKGFAPIG+S 
Sbjct  40   IP-LTKDPVWILGKKYSAVND------------FEAIRKDIRSRLWFSYRKGFAPIGDSS  86

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
            YT+D GWGCMLR  QML+AQAL+F  LGR W  +     +  Y  IL++F D + + YSI
Sbjct  87   YTSDKGWGCMLRCGQMLIAQALIFLHLGRDWEWTPSS-RDTWYFRILSMFEDRKSAPYSI  145

Query  895  HNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H +   G +     G W GP  + +  + LA
Sbjct  146  HQIALTGASEGKQVGDWFGPNTVAQVLKKLA  176



>ref|XP_002107680.1| hypothetical protein TRIADDRAFT_20340 [Trichoplax adhaerens]
 gb|EDV28478.1| hypothetical protein TRIADDRAFT_20340 [Trichoplax adhaerens]
Length=385

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 74/142 (52%), Gaps = 12/142 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +WLLGCCY   ++            F   + D +S+   TYRK + PIG    T+D GWG
Sbjct  25   VWLLGCCYNPLEE------------FDKLIADINSKFWFTYRKNYPPIGGIGPTSDKGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM++ QAL+   LGR WR    K    NY +IL LF DS++S YSIH + Q G 
Sbjct  73   CMLRCGQMILGQALVMRHLGRDWRWFKNKEQLANYWKILKLFLDSKDSLYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETL  984
            +       W GP    +  + L
Sbjct  133  SEGKKISQWFGPNTAAQVLKKL  154



>ref|XP_006814857.1| PREDICTED: cysteine protease ATG4B-like [Saccoglossus kowalevskii]
Length=357

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
             P +  T +W+LG  Y + +D S              + D  SRI ITYRK F+ IG + 
Sbjct  24   FPRIDET-VWILGKAYHLIRDRS------------ELLADIKSRIWITYRKNFSAIGGTG  70

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             T+D+GWGCMLR  QM++AQALL   LGR WR    +   + Y +IL LF D ++S YSI
Sbjct  71   PTSDNGWGCMLRCGQMILAQALLCKHLGREWRWESREHQNETYCKILKLFLDRKDSCYSI  130

Query  895  HNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H + Q G     S G W GP  + +    L 
Sbjct  131  HQIAQMGVGEGKSIGQWFGPNTVAQVLRKLT  161



>gb|ERL94645.1| hypothetical protein D910_11920, partial [Dendroctonus ponderosae]
Length=399

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 18/150 (12%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTD------PTQSQ---------GFASFVEDFSSRILITYRKGF  693
            +WLLG CY+  +  + ST+        QSQ         G   F +DF S++ +TYR+ F
Sbjct  74   VWLLGMCYRKLEPPNESTELGTDVAAFQSQSDISCSDEEGLEGFKKDFISKLWLTYRREF  133

Query  694  APIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNY-LEILNLFGD  870
              +  S Y++D GWGCM+RS QML+ QAL+FH LGR WR + E+     Y  +I+  FGD
Sbjct  134  PILNGSTYSSDCGWGCMIRSGQMLIGQALVFHFLGRDWRYAPEQKETTVYHRKIIKWFGD  193

Query  871  --SEESAYSIHNLLQAGKAYDLSPGSWVGP  954
              S  S  S+H+L++ GK     PG W GP
Sbjct  194  KPSRNSPLSLHSLVRIGKGLGKKPGDWYGP  223



>gb|KFB38709.1| AGAP008497-PA-like protein [Anopheles sinensis]
Length=388

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 15/152 (10%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
            IP  + T +WLLG  Y  ++D              +  +D  SR+  TYR+GF PIG + 
Sbjct  21   IPKTNET-VWLLGKQYNASED------------LEAIRDDVQSRLWCTYRRGFVPIGSTT  67

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             T D GWGCMLR  QM++AQAL+   LGR WR SL+  +++ YL+I+N F DS+++ +S+
Sbjct  68   LTTDKGWGCMLRCGQMVLAQALIQLHLGRDWRWSLDT-MDETYLKIVNRFEDSKQAPFSL  126

Query  895  HNL-LQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H + L    + +   G W GP  + +  + L 
Sbjct  127  HQIALMGDSSEEKRIGEWFGPNTVAQVLKKLV  158



>ref|XP_008187638.1| PREDICTED: cysteine protease ATG4B-like, partial [Acyrthosiphon 
pisum]
Length=241

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 75/143 (52%), Gaps = 13/143 (9%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y    D                  D  SR+  TYRKGF  IG + +T+D GWG
Sbjct  47   VWILGKKYSTIID------------LQQIRNDIQSRLWFTYRKGFVQIGNTNFTSDRGWG  94

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM++ QAL+F  LGR WR   +K  + +YL+IL +F D   + YSIH +   G 
Sbjct  95   CMLRCGQMVIGQALIFLHLGRDWRWDPDK-RDIDYLKILRMFEDKRSAPYSIHQIALMGV  153

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
            ++    G W GP  + +  + LA
Sbjct  154  SHGKQVGEWFGPNTIAQVLKKLA  176



>ref|XP_001968241.1| GG24763 [Drosophila erecta]
 gb|EDV57300.1| GG24763 [Drosophila erecta]
Length=411

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF+P+GE + T D 
Sbjct  47   NTDVWVLGKKYNAIQE------------LELIRRDIQSRLWCTYRHGFSPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + +   +  YL+I+N F D   S YSIH + Q
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTAD-CRDATYLKIVNRFEDVRNSFYSIHQIAQ  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>gb|ENN76867.1| hypothetical protein YQE_06708, partial [Dendroctonus ponderosae]
Length=447

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 18/150 (12%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTD------PTQSQ---------GFASFVEDFSSRILITYRKGF  693
            +WLLG CY+  +  + ST+        QSQ         G   F +DF S++ +TYR+ F
Sbjct  74   VWLLGMCYRKLEPPNESTELGTDVAAFQSQSDISCSDEEGLEGFKKDFISKLWLTYRREF  133

Query  694  APIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNY-LEILNLFGD  870
              +  S Y++D GWGCM+RS QML+ QAL+FH LGR WR + E+     Y  +I+  FGD
Sbjct  134  PILNGSTYSSDCGWGCMIRSGQMLIGQALVFHFLGRDWRYAPEQKETTVYHRKIIKWFGD  193

Query  871  --SEESAYSIHNLLQAGKAYDLSPGSWVGP  954
              S  S  S+H+L++ GK     PG W GP
Sbjct  194  KPSRNSPLSLHSLVRIGKGLGKKPGDWYGP  223



>ref|XP_011407948.1| PREDICTED: cysteine protease ATG4A-like [Amphimedon queenslandica]
Length=516

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            ++LLG  Y + +D             ASFVED  SR   TYRK F PIG++ YT+DSGWG
Sbjct  45   VYLLGVKYDLPRDG------------ASFVEDLQSRFWFTYRKNFRPIGDTGYTSDSGWG  92

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            C LR  QML+   LL   LGR WR S     +  Y +IL +F D  +S YSI  +   G 
Sbjct  93   CTLRCGQMLLGHTLLLRHLGRDWRWSPSSSNDYKYQKILRMFLDYRDSEYSIQMIALQGA  152

Query  919  AYDLSPGSWVGPYAMCRTWETLAC  990
             +  S G W GP  + +  + LA 
Sbjct  153  DFGRSVGQWFGPNNVAQAIKRLAV  176



>ref|XP_004521908.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Ceratitis 
capitata]
Length=384

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 88/168 (52%), Gaps = 15/168 (9%)
 Frame = +1

Query  484  AMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSS  663
             M +G+V   +G     IP V NTD+W+LG  Y   Q+                  D  S
Sbjct  13   GMLAGAVAGAVG-EPDDIPKV-NTDVWVLGKRYNAIQE------------LELIRRDIQS  58

Query  664  RILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNY  843
            R+  TYR+GF P+G  + T D GWGCMLR  QM++AQAL+   LGR W  + E + +  Y
Sbjct  59   RLWCTYRRGFVPLGAPQLTTDKGWGCMLRCGQMVLAQALIDLHLGREWFWTPE-IRDGTY  117

Query  844  LEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            L+I+N F DS +S +SIH +   G + D   G W GP  + +  + L 
Sbjct  118  LKIVNRFEDSRKSYFSIHQIALMGDSEDKKVGQWFGPNTVAQVLKKLV  165



>emb|CDQ77825.1| unnamed protein product [Oncorhynchus mykiss]
Length=422

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 82/147 (56%), Gaps = 12/147 (8%)
 Frame = +1

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            ++  +W+LG CY V  + +              + D  SR+  TYRK F+PIG +  ++D
Sbjct  32   TDEPVWVLGECYSVKTEKT------------ELLSDVHSRLWFTYRKKFSPIGGTGPSSD  79

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
            +GWGCMLR  QM++AQAL+  +LGR+WR   E    + Y  IL+ F D ++S YS+H + 
Sbjct  80   TGWGCMLRCGQMILAQALVCSQLGRAWRWRAEGGQPEEYHRILHCFLDRKDSCYSVHQMA  139

Query  907  QAGKAYDLSPGSWVGPYAMCRTWETLA  987
            Q G     S G W GP  + +  + LA
Sbjct  140  QMGVGEGKSVGEWYGPNTVAQVLKKLA  166



>ref|XP_002077704.1| GD23066 [Drosophila simulans]
 gb|EDX03289.1| GD23066 [Drosophila simulans]
Length=411

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF+P+GE + T D 
Sbjct  47   NTDVWVLGKKYNAIQE------------LELIRRDIQSRLWCTYRHGFSPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + +   +  YL+I+N F D   S YSIH + Q
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTPD-CRDATYLKIVNRFEDVRNSFYSIHQIAQ  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>ref|NP_608563.1| Autophagy-specific gene 4a, isoform A [Drosophila melanogaster]
 gb|AAF51423.1| Autophagy-specific gene 4a, isoform A [Drosophila melanogaster]
 gb|AAL13802.1| LD26292p [Drosophila melanogaster]
 gb|ACL85446.1| Atg4-PA, partial [synthetic construct]
 gb|ACL90364.1| Atg4-PA [synthetic construct]
Length=411

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF+P+GE + T D 
Sbjct  47   NTDVWVLGKKYNAIQE------------LELIRRDIQSRLWCTYRHGFSPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + +   +  YL+I+N F D   S YSIH + Q
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTPD-CRDATYLKIVNRFEDVRNSFYSIHQIAQ  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>ref|NP_001259852.1| Autophagy-specific gene 4a, isoform B [Drosophila melanogaster]
 gb|AGB92389.1| Autophagy-specific gene 4a, isoform B [Drosophila melanogaster]
Length=410

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF+P+GE + T D 
Sbjct  47   NTDVWVLGKKYNAIQE------------LELIRRDIQSRLWCTYRHGFSPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + +   +  YL+I+N F D   S YSIH + Q
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTPD-CRDATYLKIVNRFEDVRNSFYSIHQIAQ  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>ref|XP_011294432.1| PREDICTED: cysteine protease ATG4B isoform X2 [Musca domestica]
Length=386

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 81/151 (54%), Gaps = 14/151 (9%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
            IP+V NT +W+LG  Y   Q+                  D  SR+  TYR+GF P+GE +
Sbjct  33   IPNV-NTTVWILGKSYNAIQE------------LELIRRDVQSRLWCTYRRGFVPLGEPQ  79

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             T D GWGC LR  QM++AQAL+   LGR W  + E   +Q YL+I+N F DS +S +SI
Sbjct  80   LTTDKGWGCTLRCGQMVLAQALIDLHLGRDWFWTPET-RDQTYLKIVNRFEDSRKSFFSI  138

Query  895  HNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H +   G + D   G W GP  + +  + L 
Sbjct  139  HQIALMGDSEDKKVGQWFGPNTVAQVLKKLV  169



>ref|XP_002087497.1| GE17286 [Drosophila yakuba]
 gb|EDW87209.1| GE17286 [Drosophila yakuba]
Length=411

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF+P+GE + T D 
Sbjct  47   NTDVWVLGKKYNAIQE------------LELIRRDIQSRLWCTYRHGFSPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  +     +  YL+I+N F D   S YSIH + Q
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWT-SDCRDATYLKIVNRFEDVRNSYYSIHQIAQ  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G+  + + G W+GP  + +  + L 
Sbjct  154  MGETQNKAVGEWLGPNTVAQILKKLV  179



>ref|XP_004521907.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Ceratitis 
capitata]
Length=468

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 81/151 (54%), Gaps = 14/151 (9%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
            IP V NTD+W+LG  Y   Q+                  D  SR+  TYR+GF P+G  +
Sbjct  29   IPKV-NTDVWVLGKRYNAIQE------------LELIRRDIQSRLWCTYRRGFVPLGAPQ  75

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             T D GWGCMLR  QM++AQAL+   LGR W  + E + +  YL+I+N F DS +S +SI
Sbjct  76   LTTDKGWGCMLRCGQMVLAQALIDLHLGREWFWTPE-IRDGTYLKIVNRFEDSRKSYFSI  134

Query  895  HNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H +   G + D   G W GP  + +  + L 
Sbjct  135  HQIALMGDSEDKKVGQWFGPNTVAQVLKKLV  165



>ref|XP_001637280.1| predicted protein [Nematostella vectensis]
 gb|EDO45217.1| predicted protein [Nematostella vectensis]
Length=368

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 81/147 (55%), Gaps = 11/147 (7%)
 Frame = +1

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            +  D+W+LG  Y + Q D          G+ +   D  SRI +TYRK F  IG +  T D
Sbjct  26   TEEDVWILGKRYNILQGD---------MGYLN--TDVRSRIWLTYRKNFPKIGGTGPTTD  74

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
            SGWGCMLR  QM++AQAL+   LGR W+   E      Y++IL  F D ++S YSIH + 
Sbjct  75   SGWGCMLRCGQMMLAQALVCRHLGRDWQWDPENNTTPEYMQILEAFLDKKDSLYSIHQIA  134

Query  907  QAGKAYDLSPGSWVGPYAMCRTWETLA  987
            Q G +   + GSW GP  + +  + L+
Sbjct  135  QMGVSEGKAVGSWFGPNTVAQVLKKLS  161



>ref|XP_002059283.1| GJ16311 [Drosophila virilis]
 gb|EDW71341.1| GJ16311 [Drosophila virilis]
Length=397

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 79/146 (54%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+WLLG  Y   Q+                  D  SR+  TYR GF P+GE + T D 
Sbjct  41   NTDVWLLGKRYNAIQE------------LELIRRDIQSRLWCTYRHGFVPLGEVQLTTDK  88

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  +     +  YL+I+N F D+ +S YSIH +  
Sbjct  89   GWGCMLRCGQMVLAQALIELHLGRDWFWT-PDCRDATYLKIVNRFEDTRKSFYSIHQIAL  147

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  148  TGESQNKAVGEWLGPNTVAQILKILV  173



>ref|XP_002003544.1| GI17971 [Drosophila mojavensis]
 gb|EDW12986.1| GI17971 [Drosophila mojavensis]
Length=382

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NT++WLLG  Y   Q+  P               D  SR+  TYR GF P+GE + T D 
Sbjct  41   NTNVWLLGKRYNAIQELEP------------IRRDIQSRLWCTYRHGFVPLGEVQLTTDK  88

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  +     +  YL+I+N F D+ +S YSIH +  
Sbjct  89   GWGCMLRCGQMVLAQALIDLHLGRDWFWT-PDCRDATYLKIVNRFEDTRKSYYSIHQIAL  147

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  148  MGESQNKAVGEWLGPNTVAQILKILV  173



>ref|XP_001961821.1| GF15159 [Drosophila ananassae]
 gb|EDV31042.1| GF15159 [Drosophila ananassae]
Length=402

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 80/146 (55%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GFAP+GE + T D 
Sbjct  47   NTDVWVLGKRYNAIQE------------LELIRRDIQSRLWCTYRCGFAPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + E   +  YL+I+N F D + S YSIH +  
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTPE-CRDATYLKIVNRFEDVKNSCYSIHQIAL  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>gb|EMF09037.1| putative cysteine protease atg4 [Sphaerulina musiva SO2202]
Length=447

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 76/139 (55%), Gaps = 26/139 (19%)
 Frame = +1

Query  637  ASFVEDFSSRILITYRKGFAPIGESK----------------------YTNDSGWGCMLR  750
            + F++DF SRI ITYR GF PI +S                       +T+D+GWGCM+R
Sbjct  110  SDFIDDFESRIWITYRDGFPPIAKSTDPAAGSKMSFTTKLRSLTNQQGFTSDTGWGCMIR  169

Query  751  SSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAG-KAYD  927
            S Q L+A  +L HRLGR WRK  ++   +N   IL+LF D+ E+ +SIH  ++ G +A  
Sbjct  170  SGQSLLANTILLHRLGRDWRKGQKQEEHKN---ILSLFADTPEAPFSIHKFVEHGAQACG  226

Query  928  LSPGSWVGPYAMCRTWETL  984
              PG W GP A  R    L
Sbjct  227  TYPGEWFGPNATARCLRAL  245



>ref|XP_011294428.1| PREDICTED: cysteine protease ATG4B isoform X1 [Musca domestica]
Length=491

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 81/151 (54%), Gaps = 14/151 (9%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
            IP+V NT +W+LG  Y   Q+                  D  SR+  TYR+GF P+GE +
Sbjct  33   IPNV-NTTVWILGKSYNAIQE------------LELIRRDVQSRLWCTYRRGFVPLGEPQ  79

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             T D GWGC LR  QM++AQAL+   LGR W  + E   +Q YL+I+N F DS +S +SI
Sbjct  80   LTTDKGWGCTLRCGQMVLAQALIDLHLGRDWFWTPET-RDQTYLKIVNRFEDSRKSFFSI  138

Query  895  HNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H +   G + D   G W GP  + +  + L 
Sbjct  139  HQIALMGDSEDKKVGQWFGPNTVAQVLKKLV  169



>emb|CDQ73539.1| unnamed protein product [Oncorhynchus mykiss]
Length=441

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 80/147 (54%), Gaps = 12/147 (8%)
 Frame = +1

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            ++  +W+LG CY                G    + D  SR+  TYRK F+PIG +  ++D
Sbjct  53   TDEPVWVLGECYNA------------KTGKTELLSDVHSRLWFTYRKKFSPIGGTGPSSD  100

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
            +GWGCMLR  QM++AQAL+  +LGR+WR   E    + Y  IL+ F D ++S YSIH + 
Sbjct  101  AGWGCMLRCGQMILAQALVCSQLGRAWRWRAEGGQPEKYHRILHCFLDRKDSCYSIHQMA  160

Query  907  QAGKAYDLSPGSWVGPYAMCRTWETLA  987
            Q G     S G W GP  + +  + LA
Sbjct  161  QMGVGEGKSVGEWYGPNTVAQVLKKLA  187



>ref|XP_005432870.1| PREDICTED: cysteine protease ATG4B-like, partial [Falco cherrug]
Length=189

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  36   VWILGRKYSVFTEKE------------DILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  83

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  +LN F D ++S YSIH + Q G 
Sbjct  84   CMLRCGQMIFAQALVCRHLGRDWRWIKGKRQMDNYFNVLNAFIDKKDSYYSIHQIAQMGV  143

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  144  GEGKSIGQWYGPNTVAQVLKKLA  166



>ref|XP_010893023.1| PREDICTED: cysteine protease ATG4A [Esox lucius]
Length=415

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 80/147 (54%), Gaps = 12/147 (8%)
 Frame = +1

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            ++  +W+LG CY    + +              + D  SR+  TYRK F+PIG +  ++D
Sbjct  25   TDEPVWILGECYNAKTEKT------------ELLSDVHSRLWFTYRKKFSPIGGTGPSSD  72

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
            +GWGCMLR  QM++AQAL+  +LGR+WR   +    + Y  IL  F D ++S YSIH + 
Sbjct  73   AGWGCMLRCGQMILAQALVCSQLGRAWRWKADAGQPEEYQRILQCFLDRKDSCYSIHQMA  132

Query  907  QAGKAYDLSPGSWVGPYAMCRTWETLA  987
            Q G     S G W GP  + +  + LA
Sbjct  133  QMGVGEGKSVGEWYGPNTVAQVLKKLA  159



>gb|EFB16574.1| hypothetical protein PANDA_012287, partial [Ailuropoda melanoleuca]
Length=369

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 76/143 (53%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y +  +                + D +SR+  TYRK F PIG +  T+D+GWG
Sbjct  23   VWILGRKYSIFTEKD------------EILSDVASRLWFTYRKNFPPIGGTGPTSDTGWG  70

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  71   CMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFNVLNAFIDRKDSYYSIHQIAQMGV  130

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  131  GEGKSIGQWYGPNTVAQVLKKLA  153



>ref|XP_001947296.2| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_003243448.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_003243449.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_003243450.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_008181456.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
Length=402

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 75/143 (52%), Gaps = 13/143 (9%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y    D                  D  SR+  TYRKGF  IG + +T+D GWG
Sbjct  47   VWILGKKYSTIID------------LQQIRNDIQSRLWFTYRKGFVQIGNTNFTSDRGWG  94

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM++ QAL+F  LGR WR   +K  + +YL+IL +F D   + YSIH +   G 
Sbjct  95   CMLRCGQMVIGQALIFLHLGRDWRWDPDK-RDIDYLKILRMFEDKRSAPYSIHQIALMGV  153

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
            ++    G W GP  + +  + LA
Sbjct  154  SHGKQVGEWFGPNTIAQVLKKLA  176



>ref|XP_001356996.1| GA18177 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL34062.1| GA18177 [Drosophila pseudoobscura pseudoobscura]
Length=409

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 79/146 (54%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF P+GE + T D 
Sbjct  47   NTDVWVLGRRYNAIQE------------LEVIRRDIQSRLWCTYRHGFMPLGEVQLTTDR  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + E   +  YL+I+N F D  +S YSIH +  
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTPE-CQDATYLKIVNRFEDVRKSYYSIHQIAL  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>ref|XP_002020652.1| GL15485 [Drosophila persimilis]
 gb|EDW39645.1| GL15485 [Drosophila persimilis]
Length=409

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 79/146 (54%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            NTD+W+LG  Y   Q+                  D  SR+  TYR GF P+GE + T D 
Sbjct  47   NTDVWVLGRRYNAIQE------------LEVIRRDIQSRLWCTYRHGFMPLGEVQLTTDR  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  + E   +  YL+I+N F D  +S YSIH +  
Sbjct  95   GWGCMLRCGQMVLAQALIDLHLGRDWFWTPE-CQDATYLKIVNRFEDVRKSYYSIHQIAL  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKKLV  179



>ref|XP_011228071.1| PREDICTED: cysteine protease ATG4B isoform X1 [Ailuropoda melanoleuca]
Length=399

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 76/143 (53%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y +  +                + D +SR+  TYRK F PIG +  T+D+GWG
Sbjct  47   VWILGRKYSIFTEKD------------EILSDVASRLWFTYRKNFPPIGGTGPTSDTGWG  94

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  95   CMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFNVLNAFIDRKDSYYSIHQIAQMGV  154

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  155  GEGKSIGQWYGPNTVAQVLKKLA  177



>ref|XP_003744760.1| PREDICTED: cysteine protease ATG4D-like [Metaseiulus occidentalis]
Length=488

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 111/207 (54%), Gaps = 32/207 (15%)
 Frame = +1

Query  412  SPRKG--ASSLIPKHYAIGWTSALR---RAMNSGSVWRILGLNKTGIPSVSNTD-IWLLG  573
            SP +G  ++S   K+   GW + ++    AMNSG+        +  I  +S  D I+LLG
Sbjct  82   SPGQGQESTSEAVKNRVRGWWANMKYGWNAMNSGA--------QIDISDLSGADPIYLLG  133

Query  574  CCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRS  753
              Y          +   S  F +F  DFS+R+  TYR+ F P+  + +T+DSGWGCMLRS
Sbjct  134  HVYH---------NKNNSASFKNFFADFSTRLWFTYRQDFQPMQSTGHTSDSGWGCMLRS  184

Query  754  SQMLVAQALLFHRLGRSWRKSLEKLLEQN--YLEILNLFG---DSEESAYSIHNLLQAGK  918
            +QM++A+A +FH LGR WR   ++  +++  + +I+  F    D+ E+ +S+HN+++A  
Sbjct  185  AQMMLAEAFIFHLLGRQWRWCPQQQQQEHGVHRKIIKWFSDDPDTTEAPFSVHNMVRAAA  244

Query  919  AYDLSPGSWVGP----YAMCRTWETLA  987
                  G W GP    Y + R  E  A
Sbjct  245  HCGKKAGDWFGPSTAAYLLKRCLEEAA  271



>ref|XP_011228072.1| PREDICTED: cysteine protease ATG4B isoform X2 [Ailuropoda melanoleuca]
Length=414

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 76/143 (53%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y +  +                + D +SR+  TYRK F PIG +  T+D+GWG
Sbjct  47   VWILGRKYSIFTEKD------------EILSDVASRLWFTYRKNFPPIGGTGPTSDTGWG  94

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  95   CMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFNVLNAFIDRKDSYYSIHQIAQMGV  154

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  155  GEGKSIGQWYGPNTVAQVLKKLA  177



>ref|XP_007893162.1| PREDICTED: cysteine protease ATG4A-like [Callorhinchus milii]
Length=563

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 89/177 (50%), Gaps = 21/177 (12%)
 Frame = +1

Query  484  AMNSGSVWRILGLNKTGIPSVSN-------TD--IWLLGCCYKVAQDDSPSTDPTQSQGF  636
            A++   V ++L   +  IP  S        TD   W+LG CY +  +             
Sbjct  44   AVHLFCVLQVLAKCENQIPGFSELLEDFPETDEPAWILGKCYHLKTEK------------  91

Query  637  ASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKS  816
               + D  SR+  TYRK F+PIG +  ++DSGWGCMLR  QM++AQAL+  RLGR WR  
Sbjct  92   LELLSDVKSRLWFTYRKKFSPIGGTGPSSDSGWGCMLRCGQMILAQALICRRLGRDWRWE  151

Query  817  LEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
              K   ++Y  IL  F D ++S YSIH + Q G     S G W GP  + +  + L 
Sbjct  152  KGKWQPEDYHRILQCFLDRKDSCYSIHQMAQMGVGEGKSVGEWYGPNTVAQVLKKLT  208



>ref|XP_010159254.1| PREDICTED: cysteine protease ATG4B-like, partial [Eurypyga helias]
Length=174

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 74/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYR+ F  IG +  T+D+GWG
Sbjct  21   VWILGRKYSVFTEKE------------EILLDVTSRLWFTYRRNFPAIGGTGPTSDTGWG  68

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  +LN F D ++S YSIH + Q G 
Sbjct  69   CMLRCGQMIFAQALVCRHLGRDWRWIKGKRQMDNYFNVLNAFVDKKDSYYSIHQIAQMGV  128

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  129  GEGKSIGQWYGPNTVAQVLKKLA  151



>gb|KFB41311.1| AGAP004023-PA-like protein [Anopheles sinensis]
Length=603

 Score =   106 bits (265),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 97/193 (50%), Gaps = 18/193 (9%)
 Frame = +1

Query  400  HSKGSPRKGASSLIPKHYAIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCC  579
            H K +P     S +    A G    L    N  +V+   G N    P  + TD       
Sbjct  131  HQKTTPVASMESSVELGTA-GPDGQLTELRNVPTVYLTEGTNSP--PEETGTD-------  180

Query  580  YKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQ  759
               A +DS      + +G  +F  DF SRI +TYR+ F  + +S YT+D GWGCM+RS Q
Sbjct  181  ---AIEDSSPEAIIEEEGIDAFRRDFISRIWMTYRREFQTMDDSNYTSDCGWGCMIRSGQ  237

Query  760  MLVAQALLFHRLGRSWRKSLEKLL---EQNYLEILNLFGD--SEESAYSIHNLLQAGKAY  924
            ML+AQ L+ H LGRSWR  +   L   E  + +++  FGD  S+ S +SIH L+  GK  
Sbjct  238  MLLAQGLVAHFLGRSWRWDVSMFLAYEESIHRKVIRWFGDTSSKTSPFSIHTLVALGKES  297

Query  925  DLSPGSWVGPYAM  963
               PG W GP A+
Sbjct  298  GKKPGDWYGPGAV  310



>gb|ACJ73915.1| autophagy-related 4b variant 3 [Zea mays]
Length=178

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  583  KVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQM  762
            +V+ ++  S       G A+F+EDFSSRI ITYRKGF  I  SK T+D  WGCM+RSSQM
Sbjct  95   RVSPEEEESGGSDSDSGHAAFLEDFSSRIWITYRKGFDAIPGSKLTSDVNWGCMVRSSQM  154

Query  763  LVAQALLFHRLGRSWRKSLEK  825
            LVAQAL+FH LGRSWRK  EK
Sbjct  155  LVAQALIFHHLGRSWRKPSEK  175



>ref|XP_004695794.1| PREDICTED: cysteine protease ATG4B-like, partial [Condylura cristata]
Length=283

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 12/132 (9%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V+ +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  157  VWILGRRYSVSAERD------------EILSDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  204

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +YL +L+ F D ++S YSIH + Q G 
Sbjct  205  CMLRCGQMIFAQALVCRHLGRDWRWAQRKRQPDSYLGVLSAFVDRKDSCYSIHQIAQMGV  264

Query  919  AYDLSPGSWVGP  954
                S G W GP
Sbjct  265  GEGKSIGQWYGP  276



>dbj|GAM28128.1| hypothetical protein SAMD00019534_113040, partial [Acytostelium 
subglobosum LB1]
Length=409

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +1

Query  622  QSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGR  801
            Q    + F+ DFS+R+  +YR+GF  IG+S Y ND GWGCMLRS QML++  LL ++LG 
Sbjct  90   QPSFISDFLSDFSNRLWFSYRQGFECIGDSIYENDCGWGCMLRSGQMLLSNLLLQNKLGN  149

Query  802  SWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWET  981
             W+K+ ++   Q  +E++ LF D   + +SIHN+   G+A   + G W GP  +    +T
Sbjct  150  DWKKTNDEYPTQ-VIEVIKLFLDKATAPFSIHNIALCGRAQGKNIGEWFGPSTITHAIKT  208

Query  982  LA  987
            L 
Sbjct  209  LV  210



>ref|XP_002592932.1| hypothetical protein BRAFLDRAFT_275700 [Branchiostoma floridae]
 gb|EEN48943.1| hypothetical protein BRAFLDRAFT_275700 [Branchiostoma floridae]
Length=380

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 76/143 (53%), Gaps = 15/143 (10%)
 Frame = +1

Query  562  WLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGC  741
            W+LG  Y   +D                  D SSR+  TYRK F PIG +   +D GWGC
Sbjct  32   WILGVGYNTVKDRQ------------ELQNDISSRLWFTYRKNFTPIGGTGPMSDQGWGC  79

Query  742  MLRSSQMLVAQALLFHRLGRSWR-KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            MLR  QM++ QAL+   LGR WR KS   + + +Y +IL LF D ++S YSIH + Q G 
Sbjct  80   MLRCGQMMLGQALICRHLGRDWRWKS--AVYDNDYTKILQLFLDKKDSCYSIHQIAQMGV  137

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
            +   S G W GP  + +  + LA
Sbjct  138  SEGKSVGQWFGPNTVAQVLKKLA  160



>ref|XP_010133175.1| PREDICTED: cysteine protease ATG4B-like, partial [Buceros rhinoceros 
silvestris]
Length=148

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 69/132 (52%), Gaps = 12/132 (9%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  21   VWILGRKYSVFTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  68

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  +LN F D ++S YSIH + Q G 
Sbjct  69   CMLRCGQMIFAQALVCRHLGRDWRWIKGKRQMDNYFNVLNAFIDKKDSYYSIHQIAQMGV  128

Query  919  AYDLSPGSWVGP  954
                S G W GP
Sbjct  129  GEGKSIGQWYGP  140



>ref|XP_007085129.1| PREDICTED: cysteine protease ATG4B [Panthera tigris altaica]
Length=348

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 78/147 (53%), Gaps = 12/147 (8%)
 Frame = +1

Query  547  SNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTND  726
            ++  +W+LG  Y ++ +                + D +SR+  TYRK F  IG +  T+D
Sbjct  21   TSEPVWILGRKYSISTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSD  68

Query  727  SGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLL  906
            +GWGCMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + 
Sbjct  69   TGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSHYSIHQIA  128

Query  907  QAGKAYDLSPGSWVGPYAMCRTWETLA  987
            Q G     S G W GP  + +  + LA
Sbjct  129  QMGVGEGKSIGQWYGPNTVAQVLKKLA  155



>gb|EHH55320.1| hypothetical protein EGM_04504, partial [Macaca fascicularis]
Length=268

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y +  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  26   VWILGRKYSIFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  73

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  74   CMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGV  133

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  134  GEGKSIGQWYGPNTVAQVLKKLA  156



>ref|XP_007541517.1| PREDICTED: cysteine protease ATG4B [Poecilia formosa]
Length=391

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 0/116 (0%)
 Frame = +1

Query  640  SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSL  819
              + D +SR+  TYRK F PIG +  T+D+GWGCMLR  QM++ +AL+   LGR WR + 
Sbjct  41   EILSDVTSRLWFTYRKNFPPIGGTGPTSDTGWGCMLRCGQMILGEALMCRHLGRDWRWAR  100

Query  820  EKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            E+   + Y+ ILN F D ++S YSIH + Q G       G W GP  + +  + LA
Sbjct  101  EQKQREEYISILNAFIDKKDSYYSIHQIAQMGVGEGKPIGQWYGPNTVAQVLKKLA  156



>ref|XP_006760601.1| PREDICTED: cysteine protease ATG4B isoform X2 [Myotis davidii]
Length=402

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  44   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  91

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  92   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  151

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  152  GEGKSIGQWYGPNTVAQVLKKLA  174



>ref|XP_008405954.1| PREDICTED: cysteine protease ATG4B [Poecilia reticulata]
Length=391

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 0/116 (0%)
 Frame = +1

Query  640  SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSL  819
              + D +SR+  TYRK F PIG +  T+D+GWGCMLR  QM++ +AL+   LGR WR + 
Sbjct  41   EILSDVTSRLWFTYRKNFPPIGGTGPTSDTGWGCMLRCGQMILGEALMCRHLGRDWRWAR  100

Query  820  EKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            E+   + Y+ ILN F D ++S YSIH + Q G       G W GP  + +  + LA
Sbjct  101  EQKQREEYISILNAFIDKKDSYYSIHQIAQMGVGEGKPIGQWYGPNTVAQVLKKLA  156



>ref|XP_006935825.1| PREDICTED: cysteine protease ATG4B isoform X1 [Felis catus]
Length=395

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 76/143 (53%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y ++ +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGRKYSISTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLKKLA  155



>emb|CDJ26739.1| cysteine peptidase 1 family C54 protein [Tityus serrulatus]
Length=408

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (53%), Gaps = 17/150 (11%)
 Frame = +1

Query  544  VSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTN  723
            V+   +WLLG  Y    +              S  +D  SR+  TYRKGF+PIG +  T 
Sbjct  23   VTEEPVWLLGKQYNAIHN------------LESLRDDVRSRLWFTYRKGFSPIGGTGPTT  70

Query  724  DSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQN--YLEILNLFGDSEESAYSIH  897
            D+GWGCMLR  QM++AQAL+   LGR W    E   E+N  Y +IL LF D++ S YSIH
Sbjct  71   DAGWGCMLRCGQMVLAQALINRHLGRDWTWKAE---EKNSIYCQILKLFQDTKNSIYSIH  127

Query  898  NLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             + Q G +   + G W GP  +    + L 
Sbjct  128  QIAQMGVSEGKNIGEWFGPNTVAHVLKKLV  157



>ref|XP_005811409.1| PREDICTED: cysteine protease ATG4B-like [Xiphophorus maculatus]
Length=391

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 0/116 (0%)
 Frame = +1

Query  640  SFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSL  819
              + D +SR+  TYRK F PIG +  T+D+GWGCMLR  QM++ +AL+   LGR WR + 
Sbjct  41   EILSDVTSRLWFTYRKNFPPIGGTGPTSDTGWGCMLRCGQMILGEALMCRHLGRDWRWAR  100

Query  820  EKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            E+   + Y+ ILN F D ++S YSIH + Q G       G W GP  + +  + LA
Sbjct  101  EQKQREEYISILNAFIDKKDSYYSIHQIAQMGVGEGKPIGQWYGPNTVAQVLKKLA  156



>ref|XP_009694027.1| PREDICTED: cysteine protease ATG4B [Cariama cristata]
Length=458

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 83/172 (48%), Gaps = 13/172 (8%)
 Frame = +1

Query  472  ALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVE  651
             L+  +NS   +  L       P  +   +W+LG  Y V  +                + 
Sbjct  62   GLQEELNSTLTYDTLRFEYEDFPE-TKEPVWILGRKYSVFTEKE------------EILL  108

Query  652  DFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLL  831
            D +SR+  TYRK F  IG +  T+D+GWGCMLR  QM+ AQAL+   LGR WR    K  
Sbjct  109  DVTSRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWIKGKRQ  168

Query  832  EQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
              NY  +LN F D ++S YSIH + Q G     S G W GP  + +  + LA
Sbjct  169  TDNYFNVLNAFIDKKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLA  220



>ref|XP_005857739.1| PREDICTED: cysteine protease ATG4B isoform X7 [Myotis brandtii]
Length=411

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  44   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  91

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  92   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  151

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  152  GEGKSIGQWYGPNTVAQVLKKLA  174



>ref|XP_006760600.1| PREDICTED: cysteine protease ATG4B isoform X1 [Myotis davidii]
Length=411

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  44   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  91

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  92   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  151

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  152  GEGKSIGQWYGPNTVAQVLKKLA  174



>ref|XP_005295819.1| PREDICTED: cysteine protease ATG4B isoform X2 [Chrysemys picta 
bellii]
Length=382

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGRTYSVFTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  ILN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWVKGKRQTDNYFNILNAFIDKKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +    LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLRKLA  155



>ref|XP_002001327.1| GI10728 [Drosophila mojavensis]
 gb|EDW16788.1| GI10728 [Drosophila mojavensis]
Length=682

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 69/116 (59%), Gaps = 7/116 (6%)
 Frame = +1

Query  628  QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
            +G   F  DF SRI +TYR+ F  +  S YT+D GWGCMLRS QML+AQ L+ H LGRSW
Sbjct  274  EGIEGFRRDFYSRIWMTYRREFPTMNGSNYTSDCGWGCMLRSGQMLLAQGLICHFLGRSW  333

Query  808  RKSLEKLLEQNYLE-----ILNLFGD--SEESAYSIHNLLQAGKAYDLSPGSWVGP  954
            R   E  L   Y +     I+  FGD  S+ S +SIH L++ G+     PG W GP
Sbjct  334  RYDAESQLHSTYEDNMHKKIIKWFGDSSSKNSPFSIHALVRLGEQLGKKPGDWYGP  389



>gb|ELK32675.1| Cysteine protease ATG4B [Myotis davidii]
Length=394

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  27   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  74

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  75   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  134

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  135  GEGKSIGQWYGPNTVAQVLKKLA  157



>ref|XP_008136708.1| PREDICTED: cysteine protease ATG4B isoform X2 [Eptesicus fuscus]
Length=393

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  26   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  73

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  74   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  133

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  134  GEGKSIGQWYGPNTVAQVLKKLA  156



>ref|XP_005295820.1| PREDICTED: cysteine protease ATG4B isoform X3 [Chrysemys picta 
bellii]
Length=365

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGRTYSVFTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  ILN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWVKGKRQTDNYFNILNAFIDKKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +    LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLRKLA  155



>ref|XP_006083076.1| PREDICTED: cysteine protease ATG4B isoform X3 [Myotis lucifugus]
Length=393

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  26   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  73

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  74   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  133

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  134  GEGKSIGQWYGPNTVAQVLKKLA  156



>ref|XP_008136707.1| PREDICTED: cysteine protease ATG4B isoform X1 [Eptesicus fuscus]
Length=411

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  44   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  91

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  92   CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  151

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  152  GEGKSIGQWYGPNTVAQVLKKLA  174



>ref|XP_007884820.1| PREDICTED: cysteine protease ATG4B [Callorhinchus milii]
Length=396

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 76/143 (53%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y    D        + + FA    D +SR+  TYR+ F+PIG +  T+D+GWG
Sbjct  26   VWILGTEYSALTD--------KDEIFA----DVTSRLWFTYRRNFSPIGGTGPTSDNGWG  73

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K     Y  ILN F D ++S YSIH + Q G 
Sbjct  74   CMLRCGQMIFAQALICRHLGREWRWVNRKQQRDEYYNILNAFLDKKDSYYSIHQIAQMGV  133

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + L 
Sbjct  134  GEGKSIGQWYGPNTVAQVLKKLT  156



>ref|XP_007247106.1| PREDICTED: cysteine protease ATG4A-like [Astyanax mexicanus]
Length=402

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 81/153 (53%), Gaps = 14/153 (9%)
 Frame = +1

Query  535  IPSVSNTD--IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGE  708
            +  + +TD  +W+LG  Y V  + S              + D  SR+  TYRK F+PIG 
Sbjct  19   LEDIPDTDEPVWILGAYYNVKTEKS------------ELLLDVRSRLWFTYRKKFSPIGG  66

Query  709  SKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAY  888
            +  ++D+GWGCMLR  QM++AQAL+   LGR WR   +      Y  IL+ F D ++S Y
Sbjct  67   TGPSSDTGWGCMLRCGQMILAQALVCRHLGRDWRWVADGTQPVEYQRILHCFLDRKDSCY  126

Query  889  SIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            SIH + Q G     S G W GP  + +  + LA
Sbjct  127  SIHQMAQMGVGEGKSFGEWYGPNTVAQVLKKLA  159



>ref|XP_005826417.1| hypothetical protein GUITHDRAFT_143439 [Guillardia theta CCMP2712]
 gb|EKX39437.1| hypothetical protein GUITHDRAFT_143439 [Guillardia theta CCMP2712]
Length=332

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 95/186 (51%), Gaps = 11/186 (6%)
 Frame = +1

Query  454  AIGWTSALRRAMNSGSVWRILGLNKTGIPSVSNTDIWLLGCCYKVA------QDDSPSTD  615
            A+G   AL R++ S  +  +  L+   +       +WLLG  Y +A      + +   T+
Sbjct  37   ALGALYALGRSVKS--ILTMEALSDVLLEHKLPHTVWLLGVRYTLAPPPMGQRGEGRETE  94

Query  616  PTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRL  795
             T      +F  D  SR+  +YR  F PI  ++ T D+GWGCM+RS QML+ QAL+ H L
Sbjct  95   QTVVDESQNFKLDMWSRLWFSYRYNFHPISGTELTTDTGWGCMIRSGQMLIGQALVHHHL  154

Query  796  GRSWR---KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGPYAMC  966
            GR WR    S    L  +Y ++L +F D   +  SIH+ ++AG+      G+W GP  +C
Sbjct  155  GRDWRLSHTSKYNELPSDYRKVLEMFLDHPCAPLSIHSFVRAGQQVGKKAGTWFGPNTVC  214

Query  967  RTWETL  984
              +  L
Sbjct  215  SAFSKL  220



>gb|EFX83634.1| hypothetical protein DAPPUDRAFT_194862 [Daphnia pulex]
Length=389

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 81/150 (54%), Gaps = 14/150 (9%)
 Frame = +1

Query  544  VSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTN  723
            V++  +W+LG  Y    D     D   S        D  SR+L+TYR+ F PIG+S  T+
Sbjct  48   VNDEPVWILGREY----DTKTKLDELNS--------DVKSRLLLTYRRNFPPIGDSGMTS  95

Query  724  DSGWGCMLRSSQMLVAQALLFHRLGRS--WRKSLEKLLEQNYLEILNLFGDSEESAYSIH  897
            D GWGCMLR  QM+VAQAL+   LGR   W    ++   ++Y +IL LF D + + YSIH
Sbjct  96   DRGWGCMLRCGQMVVAQALINQHLGRQPFWPVGDDQRTTESYKKILKLFEDKKTAVYSIH  155

Query  898  NLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
             L Q G +     G W GP  + +  + L+
Sbjct  156  QLAQMGVSEGKEIGQWFGPNTVAQVLKKLS  185



>ref|XP_007440506.1| PREDICTED: cysteine protease ATG4B-like [Python bivittatus]
Length=152

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = +1

Query  652  DFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLL  831
            D +SR+  TYRKGF  IG +  T+D+GWGCMLR  QM+ AQAL+   LGR WR    K  
Sbjct  44   DVTSRLWFTYRKGFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVGRHLGRDWRWMKGKKQ  103

Query  832  EQNYLEILNLFGDSEESAYSIHNLLQAGKAYDLSPGSWVGP  954
              NY  + N F D ++S YSIH + Q G     S G W GP
Sbjct  104  TDNYYNVWNAFIDKKDSYYSIHQIAQMGVGEGKSIGQWYGP  144



>ref|XP_001994383.1| GH16873 [Drosophila grimshawi]
 gb|EDV91012.1| GH16873 [Drosophila grimshawi]
Length=673

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 69/116 (59%), Gaps = 7/116 (6%)
 Frame = +1

Query  628  QGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSW  807
            +G   F  DF SRI +TYR+ F  +  S YT+D GWGCMLRS QML+AQ L+ H LGRSW
Sbjct  265  EGIEGFRRDFYSRIWMTYRREFPIMNGSNYTSDCGWGCMLRSGQMLIAQGLICHFLGRSW  324

Query  808  RKSLEKLLEQNYLE-----ILNLFGD--SEESAYSIHNLLQAGKAYDLSPGSWVGP  954
            R   E  L   Y +     I+  FGD  S+ S +SIH L++ G+     PG W GP
Sbjct  325  RYDPESQLHSTYEDNMHKKIIKWFGDSSSKNSPFSIHALVRLGEQLGKKPGDWYGP  380



>ref|XP_007067442.1| PREDICTED: cysteine protease ATG4B [Chelonia mydas]
Length=393

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 74/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGRTYSVFTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  ILN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWVKGKRQTDNYFNILNAFIDKKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLKKLA  155



>ref|XP_004453683.1| PREDICTED: cysteine protease ATG4B-like [Dasypus novemcinctus]
Length=255

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 77/143 (54%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            IW+LG  Y +  +              + + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  98   IWILGRKYSIFTEKD------------AILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  145

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y+ +L+ F D ++S YSIH + Q G 
Sbjct  146  CMLRCGQMIFAQALVCRHLGRDWRWTQHKRQPDSYVSVLHAFLDRKDSYYSIHQIAQMGV  205

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  206  GEGKSIGQWYGPNTVAQVLKKLA  228



>ref|XP_005295818.1| PREDICTED: cysteine protease ATG4B isoform X1 [Chrysemys picta 
bellii]
Length=393

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 73/143 (51%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGRTYSVFTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  ILN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWVKGKRQTDNYFNILNAFIDKKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +    LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLRKLA  155



>ref|XP_011190462.1| PREDICTED: cysteine protease ATG4B isoform X2 [Bactrocera cucurbitae]
Length=385

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 80/151 (53%), Gaps = 14/151 (9%)
 Frame = +1

Query  535  IPSVSNTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESK  714
            IP V N+ +W+LG  Y   Q+                  D  SR+  TYR+GF P+G  +
Sbjct  29   IPKV-NSAVWVLGKRYNAIQE------------VDLIRRDIQSRLWCTYRRGFVPLGAPQ  75

Query  715  YTNDSGWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSI  894
             T D GWGCMLR  QM++AQAL+   LGR W  + E + +  YL+I+N F DS +S +SI
Sbjct  76   LTTDKGWGCMLRCGQMVLAQALIDLHLGREWFWTPE-IRDATYLKIVNRFEDSRKSYFSI  134

Query  895  HNLLQAGKAYDLSPGSWVGPYAMCRTWETLA  987
            H +   G + D   G W GP  + +  + L 
Sbjct  135  HQIALMGDSEDKKVGQWFGPNTVAQVLKKLV  165



>ref|XP_009897776.1| PREDICTED: cysteine protease ATG4B [Picoides pubescens]
Length=407

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  26   VWILGRKYSVLTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  73

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    NY  +LN F D ++S YSIH + Q G 
Sbjct  74   CMLRCGQMIFAQALVCRHLGRDWRWTKGKRQMDNYFNVLNAFIDKKDSYYSIHQIAQMGV  133

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  134  GEGKSIGQWYGPNTVAQVLKKLA  156



>ref|XP_001993206.1| GH13687 [Drosophila grimshawi]
 gb|EDV99131.1| GH13687 [Drosophila grimshawi]
Length=393

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = +1

Query  550  NTDIWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDS  729
            N ++WLLG  Y   Q+                  D  SR+  TYR GF P+GE + T D 
Sbjct  47   NANVWLLGKRYNAIQE------------LEVIRRDIQSRLWCTYRHGFVPLGEVQLTTDK  94

Query  730  GWGCMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQ  909
            GWGCMLR  QM++AQAL+   LGR W  +     +  YL+I+N F D+ +S YSIH +  
Sbjct  95   GWGCMLRCGQMVLAQALIELHLGRDWFWT-PDCRDTTYLKIVNRFEDTRKSFYSIHQIAL  153

Query  910  AGKAYDLSPGSWVGPYAMCRTWETLA  987
             G++ + + G W+GP  + +  + L 
Sbjct  154  MGESQNKAVGEWLGPNTVAQILKILV  179



>ref|XP_005857738.1| PREDICTED: cysteine protease ATG4B isoform X6 [Myotis brandtii]
 gb|EPQ02375.1| Cysteine protease ATG4B [Myotis brandtii]
Length=420

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  53   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  100

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  101  CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  160

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  161  GEGKSIGQWYGPNTVAQVLKKLA  183



>ref|XP_006083075.1| PREDICTED: cysteine protease ATG4B isoform X2 [Myotis lucifugus]
Length=471

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  113  VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  160

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  161  CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  220

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  221  GEGKSIGQWYGPNTVAQVLKKLA  243



>ref|XP_009067746.1| PREDICTED: cysteine protease ATG4B, partial [Acanthisitta chloris]
Length=389

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  21   VWILGQKYSVFTEKE------------EILSDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  68

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  +LN F D ++S YSIH + Q G 
Sbjct  69   CMLRCGQMIFAQALVCRHLGRDWRWMKGKRQMDNYFNVLNAFIDKKDSYYSIHQIAQMGV  128

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  129  GEGKSIGQWYGPNTVAQVLKKLA  151



>ref|XP_002424782.1| Cysteine protease ATG4A, putative [Pediculus humanus corporis]
 gb|EEB12044.1| Cysteine protease ATG4A, putative [Pediculus humanus corporis]
Length=388

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 77/144 (53%), Gaps = 15/144 (10%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y   +D              +   D  S++  TYRKGF PIG+S  T+D GWG
Sbjct  28   VWILGRKYDAGRD------------VTAIRSDIKSKLWFTYRKGFVPIGDSGLTSDKGWG  75

Query  739  CMLRSSQMLVAQALLFHRLGRSWR-KSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAG  915
            CMLR  QM++AQAL+   LGR WR K   K  E  YL IL +F D++ + YSIH +   G
Sbjct  76   CMLRCGQMVLAQALVCLHLGRDWRWKKDSK--EPEYLRILKMFEDTKTATYSIHQIALMG  133

Query  916  KAYDLSPGSWVGPYAMCRTWETLA  987
             +     G W GP  + +  + L+
Sbjct  134  VSEGKDVGQWFGPNTVTQVLKKLS  157



>ref|XP_554420.4| AGAP004023-PA [Anopheles gambiae str. PEST]
 gb|EAL39379.4| AGAP004023-PA [Anopheles gambiae str. PEST]
Length=606

 Score =   104 bits (259),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = +1

Query  589  AQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLV  768
            A +DS      + +G  +F  DF SRI +TYR+ F  + +S YT+D GWGCM+RS QML+
Sbjct  181  AIEDSSPEAIVEEEGIDAFRRDFISRIWMTYRREFQTMDDSNYTSDCGWGCMIRSGQMLL  240

Query  769  AQALLFHRLGRSWRKSLEKLL---EQNYLEILNLFGD--SEESAYSIHNLLQAGKAYDLS  933
            AQ L+ H LGRSWR  +       E  + +++  FGD  S+ S +SIH L+  GK     
Sbjct  241  AQGLVAHFLGRSWRWDVSMFTAYEESIHRKVIRWFGDTSSKTSPFSIHTLVALGKESGKK  300

Query  934  PGSWVGPYAM  963
            PG W GP A+
Sbjct  301  PGDWYGPGAV  310



>gb|KFV66587.1| Cysteine protease ATG4B, partial [Picoides pubescens]
Length=393

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGRKYSVLTEKE------------EILLDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    NY  +LN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWTKGKRQMDNYFNVLNAFIDKKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLKKLA  155



>gb|EAW71280.1| ATG4 autophagy related 4 homolog B (S. cerevisiae), isoform CRA_c, 
partial [Homo sapiens]
Length=354

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y +  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  26   VWILGRKYSIFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  73

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  74   CMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGV  133

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  134  GEGKSIGQWYGPNTVAQVLKKLA  156



>ref|XP_005857735.1| PREDICTED: cysteine protease ATG4B isoform X3 [Myotis brandtii]
Length=469

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  102  VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  149

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  150  CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  209

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  210  GEGKSIGQWYGPNTVAQVLKKLA  232



>ref|XP_005857736.1| PREDICTED: cysteine protease ATG4B isoform X4 [Myotis brandtii]
Length=454

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  87   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  134

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  135  CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  194

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  195  GEGKSIGQWYGPNTVAQVLKKLA  217



>ref|XP_005857737.1| PREDICTED: cysteine protease ATG4B isoform X5 [Myotis brandtii]
Length=440

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  73   VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  120

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  121  CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  180

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  181  GEGKSIGQWYGPNTVAQVLKKLA  203



>gb|KFP75007.1| Cysteine protease ATG4B, partial [Acanthisitta chloris]
Length=393

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  25   VWILGQKYSVFTEKE------------EILSDVTSRLWFTYRKNFPAIGGTGPTSDTGWG  72

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQAL+   LGR WR    K    NY  +LN F D ++S YSIH + Q G 
Sbjct  73   CMLRCGQMIFAQALVCRHLGRDWRWMKGKRQMDNYFNVLNAFIDKKDSYYSIHQIAQMGV  132

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  133  GEGKSIGQWYGPNTVAQVLKKLA  155



>ref|XP_006083074.1| PREDICTED: cysteine protease ATG4B isoform X1 [Myotis lucifugus]
Length=480

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = +1

Query  559  IWLLGCCYKVAQDDSPSTDPTQSQGFASFVEDFSSRILITYRKGFAPIGESKYTNDSGWG  738
            +W+LG  Y V  +                + D +SR+  TYRK F  IG +  T+D+GWG
Sbjct  113  VWILGRKYSVFTEKD------------EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWG  160

Query  739  CMLRSSQMLVAQALLFHRLGRSWRKSLEKLLEQNYLEILNLFGDSEESAYSIHNLLQAGK  918
            CMLR  QM+ AQALL   LGR WR +  K    +Y  +LN F D ++S YSIH + Q G 
Sbjct  161  CMLRCGQMIFAQALLCRHLGRDWRWTQRKRQPDSYFHVLNAFIDRKDSYYSIHQIAQMGV  220

Query  919  AYDLSPGSWVGPYAMCRTWETLA  987
                S G W GP  + +  + LA
Sbjct  221  GEGKSIGQWYGPNTVAQVLKKLA  243



>emb|CBJ33424.1| Autophagy-related protein 4 [Ectocarpus siliculosus]
Length=546

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 74/125 (59%), Gaps = 12/125 (10%)
 Frame = +1

Query  652   DFSSRILITYRKGFAPIGESKYTNDSGWGCMLRSSQMLVAQALLFHRLGRSWR--KSLEK  825
             D  S + ITYR GF  +    YT+DSGWGCMLRS+QML+ QAL  H LGRSWR  ++LE+
Sbjct  55    DVFSTMWITYRSGFPKMEPYGYTDDSGWGCMLRSAQMLMTQALQRHTLGRSWRVPRTLEE  114

Query  826   LLE-QNYLEILNLFGD--SEESAYSIHNLLQAGKAYDLSPGSWVGPYAMCRTWETLACCK  996
              L    Y  ++ LF D   E + +SIHN+ Q G  YD  PG W GP        T AC  
Sbjct  115   RLRVPEYRTLVRLFADHPGEANLFSIHNMCQVGIRYDKLPGEWYGP-------TTAACVL  167

Query  997   REDAE  1011
             R+ +E
Sbjct  168   RDISE  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2556976323508