BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5155

Length=1975
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794988.1|  PREDICTED: F-box protein At2g26850-like            533   0.0      Nicotiana sylvestris
ref|XP_009590639.1|  PREDICTED: F-box protein At2g32560                 529   7e-180   Nicotiana tomentosiformis
ref|XP_011080446.1|  PREDICTED: F-box protein At2g32560-like            528   2e-179   Sesamum indicum [beniseed]
gb|EYU46183.1|  hypothetical protein MIMGU_mgv1a007435mg                521   1e-176   Erythranthe guttata [common monkey flower]
ref|XP_004250900.1|  PREDICTED: F-box protein At2g32560 isoform X2      520   2e-176   Solanum lycopersicum
emb|CDP09613.1|  unnamed protein product                                518   7e-176   Coffea canephora [robusta coffee]
ref|XP_011090175.1|  PREDICTED: F-box protein At2g32560-like            516   6e-175   Sesamum indicum [beniseed]
ref|XP_010313246.1|  PREDICTED: F-box protein At2g32560 isoform X1      515   2e-174   Solanum lycopersicum
ref|XP_007015245.1|  F-box family protein isoform 1                     510   2e-172   
ref|XP_006356347.1|  PREDICTED: F-box protein At2g32560-like            510   2e-172   Solanum tuberosum [potatoes]
ref|XP_007212266.1|  hypothetical protein PRUPE_ppa006669mg             507   3e-171   Prunus persica
ref|XP_009350006.1|  PREDICTED: F-box protein At2g26850-like            506   5e-171   Pyrus x bretschneideri [bai li]
ref|XP_008227257.1|  PREDICTED: F-box protein At2g26850-like            506   6e-171   Prunus mume [ume]
ref|XP_002263423.1|  PREDICTED: F-box protein At2g32560 isoform X2      501   4e-169   Vitis vinifera
ref|XP_002533285.1|  conserved hypothetical protein                     501   1e-168   Ricinus communis
emb|CBI24276.3|  unnamed protein product                                497   8e-168   Vitis vinifera
ref|XP_010651536.1|  PREDICTED: F-box protein At2g32560 isoform X1      497   2e-167   Vitis vinifera
gb|KHG08627.1|  hypothetical protein F383_10185                         494   2e-166   Gossypium arboreum [tree cotton]
ref|XP_008359219.1|  PREDICTED: F-box protein At2g26850-like isof...    494   3e-166   
ref|XP_002314008.1|  F-box family protein                               494   3e-166   Populus trichocarpa [western balsam poplar]
ref|XP_012065843.1|  PREDICTED: F-box protein At2g26850 isoform X1      492   2e-165   Jatropha curcas
gb|KJB55449.1|  hypothetical protein B456_009G077900                    492   2e-165   Gossypium raimondii
ref|XP_010246180.1|  PREDICTED: F-box protein At2g32560-like            489   3e-164   Nelumbo nucifera [Indian lotus]
gb|AHB08886.1|  F-box family protein                                    488   8e-164   Suaeda glauca
ref|XP_008449641.1|  PREDICTED: F-box protein At2g32560                 486   4e-163   Cucumis melo [Oriental melon]
ref|XP_003519507.1|  PREDICTED: F-box protein At2g26850-like            486   5e-163   Glycine max [soybeans]
gb|KDO54745.1|  hypothetical protein CISIN_1g015516mg                   486   6e-163   Citrus sinensis [apfelsine]
ref|XP_011009173.1|  PREDICTED: F-box protein At2g32560-like            486   6e-163   Populus euphratica
ref|XP_007141515.1|  hypothetical protein PHAVU_008G202600g             485   1e-162   Phaseolus vulgaris [French bean]
ref|XP_010673781.1|  PREDICTED: F-box protein At2g32560                 484   2e-162   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010088960.1|  F-box protein                                      482   2e-162   
ref|XP_010031705.1|  PREDICTED: F-box protein At2g26850                 483   6e-162   Eucalyptus grandis [rose gum]
ref|XP_003617213.1|  F-box family protein                               483   1e-161   Medicago truncatula
ref|XP_006446321.1|  hypothetical protein CICLE_v10015455mg             482   2e-161   Citrus clementina [clementine]
ref|XP_003545428.1|  PREDICTED: F-box protein At2g26850-like            482   2e-161   Glycine max [soybeans]
ref|XP_011024991.1|  PREDICTED: F-box protein At2g32560-like            481   4e-161   Populus euphratica
ref|XP_004140188.1|  PREDICTED: F-box protein At2g32560                 480   8e-161   Cucumis sativus [cucumbers]
ref|XP_002298461.1|  hypothetical protein POPTR_0001s28050g             477   5e-160   
ref|XP_004491223.1|  PREDICTED: F-box protein At2g26850-like            478   8e-160   Cicer arietinum [garbanzo]
gb|KJB55450.1|  hypothetical protein B456_009G077900                    476   2e-159   Gossypium raimondii
ref|XP_006470522.1|  PREDICTED: F-box protein At2g32560-like            475   8e-159   Citrus sinensis [apfelsine]
gb|KHN11010.1|  F-box protein                                           472   1e-158   Glycine soja [wild soybean]
gb|KDP43182.1|  hypothetical protein JCGZ_22734                         472   1e-158   Jatropha curcas
ref|XP_003556934.1|  PREDICTED: F-box protein At2g26850-like            474   2e-158   Glycine max [soybeans]
ref|XP_008359220.1|  PREDICTED: F-box protein At2g26850-like isof...    471   2e-158   
gb|KHN27365.1|  F-box protein                                           473   4e-158   Glycine soja [wild soybean]
gb|KHN28192.1|  F-box protein                                           471   4e-157   Glycine soja [wild soybean]
ref|XP_003529497.1|  PREDICTED: F-box protein At2g26850-like            469   1e-156   Glycine max [soybeans]
ref|XP_010271792.1|  PREDICTED: F-box protein At2g32560-like            467   1e-155   Nelumbo nucifera [Indian lotus]
ref|XP_008798380.1|  PREDICTED: F-box protein At2g32560-like            466   2e-155   Phoenix dactylifera
gb|KJB35713.1|  hypothetical protein B456_006G125100                    466   3e-155   Gossypium raimondii
ref|XP_007146143.1|  hypothetical protein PHAVU_006G015900g             466   5e-155   Phaseolus vulgaris [French bean]
gb|ERM99136.1|  hypothetical protein AMTR_s00101p00163380               462   1e-154   Amborella trichopoda
emb|CAN78683.1|  hypothetical protein VITISV_043889                     463   2e-154   Vitis vinifera
ref|XP_010910138.1|  PREDICTED: F-box protein At2g32560-like isof...    464   2e-154   Elaeis guineensis
ref|XP_010557458.1|  PREDICTED: F-box protein At2g32560                 464   2e-154   Tarenaya hassleriana [spider flower]
ref|XP_006836283.2|  PREDICTED: F-box protein At2g32560                 463   2e-154   Amborella trichopoda
ref|XP_004513967.1|  PREDICTED: F-box protein At2g26850-like            461   2e-153   Cicer arietinum [garbanzo]
ref|XP_008794228.1|  PREDICTED: F-box protein At2g32560-like            458   4e-152   Phoenix dactylifera
ref|XP_010922076.1|  PREDICTED: F-box protein At2g32560-like            455   7e-151   Elaeis guineensis
ref|XP_009420968.1|  PREDICTED: F-box protein At2g32560-like            456   1e-150   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393902.1|  PREDICTED: F-box protein At2g32560-like            447   1e-147   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404696.1|  PREDICTED: F-box protein At2g32560-like            444   9e-147   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006430546.1|  hypothetical protein CICLE_v10011910mg             443   1e-146   Citrus clementina [clementine]
ref|XP_009403834.1|  PREDICTED: F-box protein At2g32560-like            441   3e-146   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007028342.1|  F-box family protein isoform 1                     442   3e-146   
ref|XP_010112861.1|  F-box protein                                      439   6e-146   
ref|XP_006482074.1|  PREDICTED: F-box protein At2g32560-like            441   1e-145   Citrus sinensis [apfelsine]
ref|XP_002522176.1|  conserved hypothetical protein                     437   9e-145   
ref|XP_012065844.1|  PREDICTED: F-box protein At2g26850 isoform X2      437   1e-144   
gb|KEH33371.1|  F-box plant-like protein                                436   3e-144   Medicago truncatula
ref|XP_007028345.1|  F-box family protein isoform 4                     437   3e-144   
ref|XP_006430547.1|  hypothetical protein CICLE_v10011910mg             436   8e-144   Citrus clementina [clementine]
gb|EYU35950.1|  hypothetical protein MIMGU_mgv1a008147mg                432   2e-142   Erythranthe guttata [common monkey flower]
ref|XP_004291727.1|  PREDICTED: F-box protein At2g32560 isoform X1      431   3e-142   Fragaria vesca subsp. vesca
ref|XP_010045084.1|  PREDICTED: F-box protein At2g32560-like            432   4e-142   Eucalyptus grandis [rose gum]
gb|ABR18151.1|  unknown                                                 432   7e-142   Picea sitchensis
gb|KDO54744.1|  hypothetical protein CISIN_1g015516mg                   426   6e-140   Citrus sinensis [apfelsine]
ref|XP_002307980.2|  hypothetical protein POPTR_0006s03840g             425   1e-139   Populus trichocarpa [western balsam poplar]
ref|XP_002277192.2|  PREDICTED: F-box protein At2g32560-like isof...    422   2e-137   Vitis vinifera
ref|XP_002323241.2|  hypothetical protein POPTR_0016s03510g             418   4e-137   
ref|XP_008240697.1|  PREDICTED: F-box protein At2g26850-like isof...    419   6e-137   Prunus mume [ume]
ref|XP_012082552.1|  PREDICTED: F-box protein At2g26850-like            418   9e-137   Jatropha curcas
ref|XP_002880840.1|  F-box family protein                               417   1e-136   Arabidopsis lyrata subsp. lyrata
gb|EMT11595.1|  hypothetical protein F775_27187                         418   2e-136   
ref|NP_001042756.1|  Os01g0281000                                       418   3e-136   
gb|KDP29248.1|  hypothetical protein JCGZ_16637                         414   4e-136   Jatropha curcas
ref|XP_004967668.1|  PREDICTED: F-box protein At2g32560-like            416   9e-136   Setaria italica
ref|XP_002455470.1|  hypothetical protein SORBIDRAFT_03g011420          416   1e-135   
ref|XP_007202057.1|  hypothetical protein PRUPE_ppa006765mg             416   1e-135   Prunus persica
ref|XP_011027254.1|  PREDICTED: F-box protein At2g26850-like isof...    414   2e-135   Populus euphratica
ref|NP_850191.1|  F-box protein                                         414   2e-135   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA54206.1|  TPA: cyclin-like F-box                                 414   6e-135   
ref|NP_180253.2|  F-box protein                                         412   9e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879398.1|  F-box family protein                               412   1e-134   Arabidopsis lyrata subsp. lyrata
emb|CDY34614.1|  BnaC08g41730D                                          412   1e-134   Brassica napus [oilseed rape]
ref|XP_006294453.1|  hypothetical protein CARUB_v10023466mg             412   2e-134   Capsella rubella
ref|XP_006417291.1|  hypothetical protein EUTSA_v10007953mg             412   2e-134   Eutrema salsugineum [saltwater cress]
emb|CDY34820.1|  BnaA09g47460D                                          411   3e-134   Brassica napus [oilseed rape]
emb|CDM82916.1|  unnamed protein product                                411   6e-134   Triticum aestivum [Canadian hard winter wheat]
gb|KHG29237.1|  hypothetical protein F383_00101                         411   9e-134   Gossypium arboreum [tree cotton]
ref|XP_009148635.1|  PREDICTED: F-box protein At2g32560-like            410   1e-133   Brassica rapa
emb|CDY30036.1|  BnaC05g09840D                                          408   4e-133   Brassica napus [oilseed rape]
emb|CDP09596.1|  unnamed protein product                                409   6e-133   Coffea canephora [robusta coffee]
ref|XP_010509997.1|  PREDICTED: F-box protein At2g32560                 407   8e-133   
ref|NP_001151624.1|  cyclin-like F-box                                  408   1e-132   
ref|XP_006296486.1|  hypothetical protein CARUB_v10025671mg             407   1e-132   Capsella rubella
ref|XP_011000416.1|  PREDICTED: F-box protein At2g26850-like            407   1e-132   Populus euphratica
ref|XP_001785923.1|  predicted protein                                  404   2e-132   
ref|XP_007015246.1|  F-box family protein isoform 2                     406   2e-132   
ref|XP_003567352.1|  PREDICTED: F-box protein At2g32560-like            408   2e-132   Brachypodium distachyon [annual false brome]
ref|XP_009118163.1|  PREDICTED: F-box protein At2g32560-like            406   2e-132   Brassica rapa
ref|XP_010469573.1|  PREDICTED: F-box protein At2g32560-like            406   3e-132   Camelina sativa [gold-of-pleasure]
dbj|BAJ88045.1|  predicted protein                                      404   4e-131   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX98095.1|  BnaA06g08460D                                          403   4e-131   
ref|XP_009618519.1|  PREDICTED: F-box protein At2g26850-like isof...    403   6e-131   Nicotiana tomentosiformis
ref|XP_010413981.1|  PREDICTED: F-box protein At2g32560-like isof...    402   1e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010910139.1|  PREDICTED: F-box protein At2g32560-like isof...    401   2e-130   Elaeis guineensis
ref|XP_001777099.1|  predicted protein                                  397   1e-129   
ref|XP_004290535.1|  PREDICTED: F-box protein At2g32560-like            400   1e-129   Fragaria vesca subsp. vesca
ref|XP_010413980.1|  PREDICTED: F-box protein At2g32560-like isof...    400   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_009618518.1|  PREDICTED: F-box protein At2g26850-like isof...    399   4e-129   Nicotiana tomentosiformis
ref|XP_010055882.1|  PREDICTED: F-box protein At2g26850-like            395   6e-128   Eucalyptus grandis [rose gum]
gb|EEC70414.1|  hypothetical protein OsI_01411                          395   1e-127   Oryza sativa Indica Group [Indian rice]
gb|EEE54342.1|  hypothetical protein OsJ_01321                          394   1e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768151.1|  PREDICTED: F-box protein At2g26850-like isof...    394   1e-127   Nicotiana sylvestris
emb|CAN79391.1|  hypothetical protein VITISV_034661                     391   2e-127   Vitis vinifera
ref|XP_008392525.1|  PREDICTED: F-box protein At2g26850-like            394   3e-127   
gb|KCW51070.1|  hypothetical protein EUGRSUZ_J00678                     390   7e-127   Eucalyptus grandis [rose gum]
gb|KJB55451.1|  hypothetical protein B456_009G077900                    392   9e-127   Gossypium raimondii
ref|XP_006362270.1|  PREDICTED: F-box protein At2g26850-like isof...    392   1e-126   Solanum tuberosum [potatoes]
ref|XP_010417831.1|  PREDICTED: F-box protein At2g26850-like            391   2e-126   Camelina sativa [gold-of-pleasure]
gb|EPS60658.1|  hypothetical protein M569_14143                         391   2e-126   Genlisea aurea
ref|XP_009345151.1|  PREDICTED: F-box protein At2g26850-like            390   8e-126   Pyrus x bretschneideri [bai li]
ref|XP_009768150.1|  PREDICTED: F-box protein At2g26850-like isof...    389   1e-125   Nicotiana sylvestris
ref|XP_010510850.1|  PREDICTED: F-box protein At2g26850-like            388   2e-125   Camelina sativa [gold-of-pleasure]
gb|KDO54746.1|  hypothetical protein CISIN_1g015516mg                   387   4e-125   Citrus sinensis [apfelsine]
ref|XP_010473070.1|  PREDICTED: F-box protein At2g26850-like            387   5e-125   Camelina sativa [gold-of-pleasure]
ref|XP_006362269.1|  PREDICTED: F-box protein At2g26850-like isof...    387   6e-125   Solanum tuberosum [potatoes]
ref|XP_001775579.1|  predicted protein                                  384   8e-125   
ref|XP_008387444.1|  PREDICTED: F-box protein At2g26850-like            387   1e-124   Malus domestica [apple tree]
gb|KEH28371.1|  F-box plant-like protein                                385   1e-124   Medicago truncatula
gb|KDO54747.1|  hypothetical protein CISIN_1g015516mg                   385   2e-124   Citrus sinensis [apfelsine]
ref|XP_010327750.1|  PREDICTED: F-box protein At2g26850-like isof...    385   3e-124   Solanum lycopersicum
ref|XP_006446322.1|  hypothetical protein CICLE_v10015455mg             382   5e-123   
ref|XP_004249133.1|  PREDICTED: F-box protein At2g26850-like isof...    381   2e-122   Solanum lycopersicum
gb|KJB46204.1|  hypothetical protein B456_007G352500                    381   2e-122   Gossypium raimondii
ref|XP_003624978.1|  F-box protein                                      380   6e-122   
gb|ABD33039.1|  Cyclin-like F-box                                       380   8e-122   Medicago truncatula
gb|AFK37960.1|  unknown                                                 380   9e-122   Medicago truncatula
ref|XP_003521127.1|  PREDICTED: F-box protein At2g32560-like            377   2e-120   Glycine max [soybeans]
ref|NP_001044567.1|  Os01g0806200                                       377   3e-120   
ref|XP_003554122.1|  PREDICTED: F-box protein At2g32560-like            376   3e-120   Glycine max [soybeans]
ref|XP_011459459.1|  PREDICTED: F-box protein At2g32560 isoform X2      373   5e-120   Fragaria vesca subsp. vesca
ref|XP_006294440.1|  hypothetical protein CARUB_v10023454mg             374   7e-120   Capsella rubella
gb|KHN08884.1|  F-box protein                                           372   7e-120   Glycine soja [wild soybean]
ref|XP_006294441.1|  hypothetical protein CARUB_v10023454mg             372   7e-120   
dbj|BAK00229.1|  predicted protein                                      372   7e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004493395.1|  PREDICTED: F-box protein At2g26850-like            372   8e-119   Cicer arietinum [garbanzo]
gb|KJB35714.1|  hypothetical protein B456_006G125100                    370   2e-118   Gossypium raimondii
ref|XP_008464952.1|  PREDICTED: F-box protein At2g26850-like            371   2e-118   Cucumis melo [Oriental melon]
gb|ACL53470.1|  unknown                                                 372   2e-118   Zea mays [maize]
ref|NP_001147974.1|  cyclin-like F-box precursor                        372   3e-118   
gb|ACN33240.1|  unknown                                                 370   9e-118   Zea mays [maize]
ref|XP_010554766.1|  PREDICTED: F-box protein At2g41170 isoform X2      365   4e-117   Tarenaya hassleriana [spider flower]
ref|XP_004141125.1|  PREDICTED: F-box protein At2g26850-like            367   6e-117   Cucumis sativus [cucumbers]
ref|XP_008672833.1|  PREDICTED: cyclin-like F-box isoform X1            367   1e-116   Zea mays [maize]
ref|XP_010554764.1|  PREDICTED: F-box protein At2g41170 isoform X1      365   2e-116   
ref|XP_010673037.1|  PREDICTED: F-box protein At2g26850-like isof...    365   3e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007162078.1|  hypothetical protein PHAVU_001G121900g             363   2e-115   Phaseolus vulgaris [French bean]
ref|XP_008240698.1|  PREDICTED: F-box protein At2g26850-like isof...    362   2e-115   Prunus mume [ume]
ref|XP_004970298.1|  PREDICTED: F-box protein At2g41170-like isof...    361   3e-114   Setaria italica
gb|AAC32240.1|  unknown protein                                         357   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564433.1|  PREDICTED: F-box protein At2g32560-like isof...    359   2e-113   Brachypodium distachyon [annual false brome]
ref|NP_850347.1|  F-box protein                                         356   7e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517604.1|  PREDICTED: F-box protein At2g41170-like            355   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010508750.1|  PREDICTED: F-box protein At2g41170-like isof...    354   3e-112   Camelina sativa [gold-of-pleasure]
dbj|BAD94811.1|  hypothetical protein                                   354   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881759.1|  F-box family protein                               353   7e-112   Arabidopsis lyrata subsp. lyrata
gb|KFK36964.1|  hypothetical protein AALP_AA4G195400                    351   9e-112   Arabis alpina [alpine rockcress]
ref|XP_010232469.1|  PREDICTED: F-box protein At2g32560-like isof...    354   1e-111   Brachypodium distachyon [annual false brome]
ref|XP_010112853.1|  F-box protein                                      352   1e-111   
ref|XP_009421118.1|  PREDICTED: F-box protein At2g32560-like isof...    353   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM84605.1|  unnamed protein product                                353   2e-111   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010505881.1|  PREDICTED: F-box protein At2g41170-like            351   6e-111   Camelina sativa [gold-of-pleasure]
gb|EYU35951.1|  hypothetical protein MIMGU_mgv1a008147mg                348   3e-110   Erythranthe guttata [common monkey flower]
emb|CDY23870.1|  BnaC04g01670D                                          350   4e-110   Brassica napus [oilseed rape]
ref|XP_002967788.1|  hypothetical protein SELMODRAFT_88058              347   6e-110   
ref|XP_002992630.1|  hypothetical protein SELMODRAFT_135657             347   6e-110   
ref|XP_002458655.1|  hypothetical protein SORBIDRAFT_03g037510          350   7e-110   Sorghum bicolor [broomcorn]
emb|CDX79953.1|  BnaA05g02030D                                          348   8e-110   
ref|XP_009142728.1|  PREDICTED: F-box protein At2g41170                 348   1e-109   Brassica rapa
ref|XP_010112851.1|  F-box protein                                      345   3e-109   Morus notabilis
gb|KJB55452.1|  hypothetical protein B456_009G077900                    344   3e-109   Gossypium raimondii
gb|KEH33372.1|  F-box plant-like protein                                344   2e-108   Medicago truncatula
ref|XP_006411383.1|  hypothetical protein EUTSA_v10016802mg             343   8e-108   Eutrema salsugineum [saltwater cress]
ref|XP_006446320.1|  hypothetical protein CICLE_v10015455mg             339   6e-107   
ref|XP_009421126.1|  PREDICTED: F-box protein At2g32560-like isof...    340   2e-106   
ref|XP_004970297.1|  PREDICTED: F-box protein At2g41170-like isof...    342   2e-106   
gb|EEE55551.1|  hypothetical protein OsJ_03804                          334   5e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010653619.1|  PREDICTED: F-box protein At2g32560-like isof...    333   2e-103   Vitis vinifera
ref|XP_006644069.1|  PREDICTED: F-box protein At2g32560-like            324   3e-103   
emb|CBI32779.3|  unnamed protein product                                328   7e-103   Vitis vinifera
gb|KDO53603.1|  hypothetical protein CISIN_1g040396mg                   321   1e-101   Citrus sinensis [apfelsine]
ref|XP_011027255.1|  PREDICTED: F-box protein At2g32560-like isof...    325   3e-101   Populus euphratica
gb|KHN30351.1|  F-box protein                                           320   2e-100   Glycine soja [wild soybean]
ref|XP_002975888.1|  hypothetical protein SELMODRAFT_104188             322   5e-100   
ref|XP_002968595.1|  hypothetical protein SELMODRAFT_409561             322   8e-100   
ref|XP_010521562.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    333   5e-99    
ref|XP_007028346.1|  F-box family protein isoform 5                     314   2e-97    
ref|XP_007028343.1|  F-box family protein isoform 2                     312   6e-97    
ref|XP_011075626.1|  PREDICTED: F-box protein At2g32560-like            312   6e-96    
ref|XP_006646414.1|  PREDICTED: F-box protein At2g26850-like            307   4e-95    Oryza brachyantha
ref|XP_010112850.1|  F-box protein                                      300   1e-91    
gb|EPS66079.1|  hypothetical protein M569_08700                         300   2e-91    Genlisea aurea
gb|EMS62261.1|  hypothetical protein TRIUR3_33055                       291   7e-91    Triticum urartu
ref|XP_010112859.1|  F-box protein                                      295   1e-89    
gb|AAC25938.1|  unknown protein                                         289   3e-89    Arabidopsis thaliana [mouse-ear cress]
gb|ADE76919.1|  unknown                                                 284   7e-86    Picea sitchensis
ref|XP_010673039.1|  PREDICTED: F-box protein At2g32560-like isof...    280   3e-84    
ref|XP_003537295.1|  PREDICTED: F-box protein At2g26850-like            274   2e-82    Glycine max [soybeans]
ref|XP_004970296.1|  PREDICTED: F-box protein At2g41170-like isof...    273   3e-80    
gb|EMT27387.1|  hypothetical protein F775_17219                         263   6e-80    
gb|AAD11995.1|  unknown protein                                         252   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520488.1|  PREDICTED: F-box protein At2g26850-like isof...    251   3e-73    Glycine max [soybeans]
ref|XP_004970295.1|  PREDICTED: F-box protein At2g41170-like isof...    254   1e-72    
ref|XP_007162082.1|  hypothetical protein PHAVU_001G122300g             248   3e-72    Phaseolus vulgaris [French bean]
ref|XP_007162085.1|  hypothetical protein PHAVU_001G122600g             245   3e-71    Phaseolus vulgaris [French bean]
gb|KDO54749.1|  hypothetical protein CISIN_1g015516mg                   243   3e-71    Citrus sinensis [apfelsine]
ref|XP_007145513.1|  hypothetical protein PHAVU_007G244800g             245   4e-71    Phaseolus vulgaris [French bean]
ref|XP_003520491.1|  PREDICTED: F-box protein At2g26850-like            244   4e-71    Glycine max [soybeans]
ref|XP_003624987.1|  F-box protein                                      244   5e-71    Medicago truncatula
ref|XP_003520490.1|  PREDICTED: F-box protein At2g32560-like            239   4e-69    
ref|XP_010508751.1|  PREDICTED: F-box protein At2g41170-like isof...    236   1e-67    Camelina sativa [gold-of-pleasure]
ref|XP_007162081.1|  hypothetical protein PHAVU_001G122200g             235   2e-67    Phaseolus vulgaris [French bean]
ref|XP_003624981.1|  F-box protein                                      230   1e-65    Medicago truncatula
gb|KHN32241.1|  F-box protein                                           226   3e-64    Glycine soja [wild soybean]
gb|AFK35889.1|  unknown                                                 220   5e-62    Lotus japonicus
ref|XP_004499916.1|  PREDICTED: F-box protein At2g26850-like isof...    214   2e-59    Cicer arietinum [garbanzo]
ref|XP_007145514.1|  hypothetical protein PHAVU_007G244800g             207   2e-57    Phaseolus vulgaris [French bean]
ref|XP_007145512.1|  hypothetical protein PHAVU_007G244800g             200   4e-55    Phaseolus vulgaris [French bean]
gb|KHN30352.1|  F-box protein                                           200   6e-55    Glycine soja [wild soybean]
gb|EYU18616.1|  hypothetical protein MIMGU_mgv1a0077792mg               192   8e-54    Erythranthe guttata [common monkey flower]
gb|KDO54748.1|  hypothetical protein CISIN_1g015516mg                   194   1e-52    Citrus sinensis [apfelsine]
gb|ABD33044.1|  Cyclin-like F-box                                       188   4e-50    Medicago truncatula
gb|AES81202.2|  F-box plant-like protein                                188   5e-50    Medicago truncatula
ref|XP_003624984.1|  F-box protein                                      188   8e-50    
ref|XP_003624986.1|  F-box protein                                      185   4e-49    
gb|KHN30354.1|  F-box protein                                           174   5e-46    Glycine soja [wild soybean]
ref|XP_007162079.1|  hypothetical protein PHAVU_001G122000g             168   4e-44    Phaseolus vulgaris [French bean]
gb|KEH26010.1|  F-box plant-like protein                                169   2e-43    Medicago truncatula
gb|ACI23490.1|  putative cyclin-like F-box                              146   5e-38    Triticum monococcum [einkorn wheat]
ref|XP_006576778.1|  PREDICTED: F-box protein At2g26850-like isof...    146   5e-37    
gb|ACI23489.1|  putative cyclin-like F-box                              141   3e-36    Secale cereale
gb|EYU18617.1|  hypothetical protein MIMGU_mgv1a0077791mg               145   1e-35    Erythranthe guttata [common monkey flower]
gb|KDO36595.1|  hypothetical protein CISIN_1g038508mg                   112   4e-25    Citrus sinensis [apfelsine]
ref|XP_002489168.1|  hypothetical protein SORBIDRAFT_0015s008030      91.3    7e-17    
gb|AFW62003.1|  hypothetical protein ZEAMMB73_746738                  90.5    1e-15    
gb|KEH15446.1|  F-box plant-like protein                              75.5    2e-12    Medicago truncatula
ref|XP_005847662.1|  hypothetical protein CHLNCDRAFT_134034           76.3    2e-11    Chlorella variabilis
gb|KEH26011.1|  F-box plant-like protein                              73.2    6e-11    Medicago truncatula
gb|AAC25939.1|  unknown protein                                       57.4    1e-06    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003624970.1|  F-box protein                                    58.5    1e-06    
gb|ABD33029.1|  Cyclin-like F-box                                     57.0    2e-06    Medicago truncatula
gb|AFK38205.1|  unknown                                               53.1    6e-05    Lotus japonicus



>ref|XP_009794988.1| PREDICTED: F-box protein At2g26850-like [Nicotiana sylvestris]
Length=397

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 301/384 (78%), Gaps = 5/384 (1%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKD-LSLLTLVRKNLFS--LIPLRMLAMRSKPGGCS  747
             YKSL+ K +P W+SE RL L    WKD L LL   +K       I      M  +    S
Sbjct  16    YKSLSLKPLPLWSSEVRL-LSIHFWKDFLILLNPFKKGFLEAGFIHFITSRMSIRRKSFS  74

Query  748   KADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
                ++V+  + +MSVLDLP+L L+CILE++PPEGLC++ASVCS L+E+C SD+LWERH+K
Sbjct  75    SRVENVDPNL-EMSVLDLPELALDCILERLPPEGLCNMASVCSFLKEKCKSDYLWERHMK  133

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
             +KWG +IGPAAYREWQWHIA R DS  FNQAK++G  +YLS+ WP+S++   N     K+
Sbjct  134   EKWGRVIGPAAYREWQWHIASRNDSSFFNQAKQRGFMTYLSQFWPISLVSRSNFSISIKK  193

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
              +   +DSVM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYP
Sbjct  194   KHTASVDSVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYP  253

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR A+AIETGVTWDRLRAP +D   HDL+ISDCL +L PGDHIEIQWRRNK+FPYGWW
Sbjct  254   PHGRRAIAIETGVTWDRLRAPPLDTSPHDLYISDCLTELCPGDHIEIQWRRNKEFPYGWW  313

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLETCDGN+ YCRCH+ D V+LEFNQY+PGSRWR TT+ RKDHREEGNEA+GFYG
Sbjct  314   YGVVGHLETCDGNEIYCRCHDSDIVMLEFNQYTPGSRWRTTTIDRKDHREEGNEADGFYG  373

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K++S E IS W+ LWP   LE
Sbjct  374   GIRKLQSNEEISMWRHLWPTDALE  397



>ref|XP_009590639.1| PREDICTED: F-box protein At2g32560 [Nicotiana tomentosiformis]
Length=398

 Score =   529 bits (1362),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 252/385 (65%), Positives = 303/385 (79%), Gaps = 6/385 (2%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFS--LIPLRMLAMRSKPGGCSK  750
             YKSL+ K +P W+SE RL  ++  WKD  +L   +K       IP  +  M  +    S 
Sbjct  16    YKSLSLKPLPLWSSEVRLLSIY-FWKDFLILKPFKKGFLEAGFIPFIISRMSLRRKSFSS  74

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
               ++V+   S+MSVLDLP+L L+CILE++PPEGLC++ASVCS L+E+C SD+LWERH+K+
Sbjct  75    RVENVDRN-SEMSVLDLPELALDCILERLPPEGLCNMASVCSFLKEKCKSDYLWERHMKE  133

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR-  1107
             KWG +IGPAAYREWQW IA R DS  FNQAK++G  +YLS+ WP+S++   N      + 
Sbjct  134   KWGRVIGPAAYREWQWRIASRNDSSFFNQAKQRGFMTYLSQFWPISLVSRSNSSISSIKK  193

Query  1108  -NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
              +  PP+DSVM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD RTDTF ARY
Sbjct  194   KHTPPPVDSVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDLRTDTFQARY  253

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
             PPHGR A+AIETGVTWDRLRAP +D   HDL+ISDCL +L PGDHIEIQWRRNK+FPYGW
Sbjct  254   PPHGRRAIAIETGVTWDRLRAPPLDTSPHDLYISDCLTELCPGDHIEIQWRRNKEFPYGW  313

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WYG+VGHLETCDGN+ YCRCH+ DTV+LEFNQY+PGSRWR TT+ RKDHREEGNEA+GFY
Sbjct  314   WYGIVGHLETCDGNEFYCRCHDSDTVILEFNQYTPGSRWRTTTIDRKDHREEGNEADGFY  373

Query  1645  GGIQKVESREVISTWKRLWPAQVLE  1719
             GGI+K++S E IS W+ LWP   LE
Sbjct  374   GGIRKLQSNEEISMWRHLWPTDALE  398



>ref|XP_011080446.1| PREDICTED: F-box protein At2g32560-like [Sesamum indicum]
Length=397

 Score =   528 bits (1360),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 258/384 (67%), Positives = 305/384 (79%), Gaps = 5/384 (1%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSK-PGGCSKA  753
             Y+SL  K +P+WA E RL  L+  WK  S L +++    +++ +      S+ P      
Sbjct  16    YRSLVLKPLPSWACEMRLVSLW-FWKGFSFLPIIKSIRNTILGVIFSFFTSRMPCKKKSF  74

Query  754   DDHVETT--VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
                VET    S MSVLDLPDLVLECILEK+PPE LC +ASVC+SLR++CMSD+LWE+H+K
Sbjct  75    SSKVETIDRKSGMSVLDLPDLVLECILEKLPPEELCRMASVCASLRDKCMSDYLWEKHIK  134

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
              KW  IIGPAAYREWQW+IA RKDS  FNQ K+KGL  YL+ LWP+ V++  +  +  K+
Sbjct  135   DKWARIIGPAAYREWQWYIASRKDSIFFNQGKQKGLMGYLTHLWPV-VLIRSSFSSISKK  193

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
              N PP DS+M WY ALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD RTDTF ARYP
Sbjct  194   KNSPPADSLMSWYFALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDLRTDTFQARYP  253

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR A+ IETGVTWDRLRAP VD   HDLHIS+CL +L+PGDHIEIQWRRNK+FPYGWW
Sbjct  254   PHGRRAITIETGVTWDRLRAPPVDTSPHDLHISNCLTELQPGDHIEIQWRRNKEFPYGWW  313

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLETC GN +YCRCH+ DT+VLEFNQY+PGSRWRRTTVSRK+HREEGNEA+GFYG
Sbjct  314   YGVVGHLETCVGNANYCRCHDSDTLVLEFNQYTPGSRWRRTTVSRKNHREEGNEADGFYG  373

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K+ + E IS WK+LWP++VLE
Sbjct  374   GIRKLRTNEEISMWKKLWPSEVLE  397



>gb|EYU46183.1| hypothetical protein MIMGU_mgv1a007435mg [Erythranthe guttata]
Length=407

 Score =   521 bits (1341),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 252/396 (64%), Positives = 301/396 (76%), Gaps = 19/396 (5%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL---VRKNLFSLI-----PLRMLAMRSK  732
             +KSL+ K +P+WA E RL L  R WKDL    +   +R  +  ++     P+ +++ R K
Sbjct  16    HKSLSIKPLPSWAREVRL-LSLRFWKDLPFSPITKSIRNTIVGVVSSLFKPMMVMSPRKK  74

Query  733   P-----GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCM  897
                   GG         T  S +SVLDLPDLVLECILEK+PP GLC +ASVC+S+R+ CM
Sbjct  75    SFNSTLGGVETPP--TATASSDVSVLDLPDLVLECILEKLPPNGLCKMASVCTSMRDMCM  132

Query  898   SDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFN--QAKEKGLGSYLSRLWPLSV  1071
             SDHLWE+H++ KW  I+GPAAYREWQWH+   K S  F+  Q K+ GL  Y++RLWP+ +
Sbjct  133   SDHLWEKHMRSKWARIVGPAAYREWQWHVLSSKGSIFFDNGQGKQNGLMGYIARLWPVVL  192

Query  1072  IVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  1251
                   G  +K+N  PP+DS+M WY ALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY
Sbjct  193   FRSSFSGISNKKN-FPPLDSIMSWYFALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  251

Query  1252  DPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQ  1431
             D +TDTF ARYPPHGR   A ETGVTWDRLRAP +D   HDLH SDCL +L+PGDHIEIQ
Sbjct  252   DLQTDTFKARYPPHGRRISATETGVTWDRLRAPPIDTSPHDLHTSDCLNELQPGDHIEIQ  311

Query  1432  WRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDH  1611
             WRRNK+FPYGWWYGVVGHLETCDGN +YCRCHECDT+VLEFNQY+ GSRWR T+VSRKDH
Sbjct  312   WRRNKEFPYGWWYGVVGHLETCDGNPNYCRCHECDTLVLEFNQYTRGSRWRTTSVSRKDH  371

Query  1612  REEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             REEGNE++GFYGGI+K+ S E ISTWK+LWP +VLE
Sbjct  372   REEGNESDGFYGGIRKIYSNEEISTWKKLWPCEVLE  407



>ref|XP_004250900.1| PREDICTED: F-box protein At2g32560 isoform X2 [Solanum lycopersicum]
Length=393

 Score =   520 bits (1339),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 254/381 (67%), Positives = 300/381 (79%), Gaps = 5/381 (1%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLF-SLIPLRMLAMRSKPGGCSKAD  756
             KSL+ K +P W+S     L    W D  +L   +K    SL+   ++ +R K    S   
Sbjct  17    KSLSLKPLPLWSSSEVRLLSIWFWNDFLILNPFKKGFLESLMSSNVMTLRRK--SFSYRV  74

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             ++VE   S+MSVLDLP+LVLECILE++PPEGLC +ASVCSSLRE+C S +LWE+H+K+KW
Sbjct  75    ENVEAN-SEMSVLDLPELVLECILERLPPEGLCSMASVCSSLREKCTSKYLWEKHMKEKW  133

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G ++GPAA+REW WHI+ RKDS  FNQAKE+GL +YLS+ WP+S IV  N     K+ + 
Sbjct  134   GRVLGPAAHREWLWHISSRKDSSFFNQAKERGLMTYLSQFWPIS-IVRSNPSTSFKKKDP  192

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
             P IDS+M  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  RTDTF ARYPPHG
Sbjct  193   PVIDSIMSMYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYSRRTDTFQARYPPHG  252

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A+AIETGVTWDRLR P +D   HDL+ISDCL +L PGDHIEIQWRRNK+FPYGWWYGV
Sbjct  253   RRAMAIETGVTWDRLRVPPLDTSPHDLYISDCLTELCPGDHIEIQWRRNKEFPYGWWYGV  312

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLETCDGN++YCRCHE DTVVLEFNQY+ GSRWR T + RKDHREEGNEA+GFYGGI+
Sbjct  313   VGHLETCDGNEYYCRCHENDTVVLEFNQYTHGSRWRTTHIDRKDHREEGNEADGFYGGIR  372

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ S E IS W+RLWP+ VLE
Sbjct  373   KLHSNEEISMWRRLWPSDVLE  393



>emb|CDP09613.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   518 bits (1333),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 258/381 (68%), Positives = 298/381 (78%), Gaps = 23/381 (6%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKAD  756
             YKSL+FKL+P  A E RL  L+  WKD SLL+L+ K                    S   
Sbjct  16    YKSLSFKLLPLLACEMRLLSLW-CWKDFSLLSLLTK--------------------SIKS  54

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
                 ++   MS+LDLP+LVLECILEK+PPEGLC +A+VC SLR+RCMSDHLWE+H+ QKW
Sbjct  55    SSSPSSSEIMSILDLPELVLECILEKLPPEGLCSMAAVCRSLRDRCMSDHLWEKHMNQKW  114

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G IIGPAA+REWQWHIA RKDS  FNQA  KG  +YL++LWPLS++         KR N 
Sbjct  115   GRIIGPAAHREWQWHIATRKDS-CFNQATPKGSFNYLTQLWPLSLVRSSLKNRITKRKNS  173

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
             PP+DSVM WYLALESGK  FPAQ+YNRE+GHVGFMLSCYDAELSY+PRTDTF ARYPPHG
Sbjct  174   PPVDSVMSWYLALESGKL-FPAQIYNREHGHVGFMLSCYDAELSYNPRTDTFQARYPPHG  232

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
               AVA+ET VTWDR+RAP VD P HDLHISDCL +L PGDHIEIQWRRNK+FPYGWWYGV
Sbjct  233   NRAVAVETDVTWDRIRAPPVDTPPHDLHISDCLSELHPGDHIEIQWRRNKEFPYGWWYGV  292

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLETCDGN +YCRCHE D+VVLEFNQY+PGSRWR TT+SRKDHRE GNEA+GFYGGI+
Sbjct  293   VGHLETCDGNSNYCRCHESDSVVLEFNQYTPGSRWRTTTLSRKDHREGGNEADGFYGGIR  352

Query  1657  KVESREVISTWKRLWPAQVLE  1719
              ++  E ISTWK+LWP ++LE
Sbjct  353   NLQRNEEISTWKKLWPTEILE  373



>ref|XP_011090175.1| PREDICTED: F-box protein At2g32560-like [Sesamum indicum]
Length=405

 Score =   516 bits (1330),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 297/385 (77%), Gaps = 9/385 (2%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL---VRKNLFS-LIPLRMLAMRSKPGGC  744
             YKSL  K +P+WA E RL L F  WK LS  ++   +R  L +    L    M  K    
Sbjct  26    YKSLPLKPLPSWACEMRL-LSFCFWKGLSFFSITKSIRNTLLAATFSLFTSIMSPKKKNS  84

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             S   + VE  VS+ SVLDLPDLVLECILEK+PPEGLC +A VC+SLR+ C SDHLWERH+
Sbjct  85    SSKVESVEM-VSETSVLDLPDLVLECILEKLPPEGLCKMAGVCTSLRDWCTSDHLWERHM  143

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDK  1104
             K KWG I+GPAAYREWQ+H+   K S    Q K+KGL  YL +LWP ++I   +     K
Sbjct  144   KNKWGRIVGPAAYREWQFHVVSGKSS--IYQDKQKGLMGYLIQLWPFALIRS-SFSNISK  200

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
             + + PP+DS+M WYLALESGKFWFPAQVYNRENGH+GFMLSCYDAELSYD RTDTF ARY
Sbjct  201   KQSFPPVDSIMSWYLALESGKFWFPAQVYNRENGHIGFMLSCYDAELSYDQRTDTFQARY  260

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
             PPHGR A AIETGVTWDRLRAP VD   H+LHISDCL +L+PGD IEIQWRRNK+FPYGW
Sbjct  261   PPHGRRASAIETGVTWDRLRAPPVDTSPHNLHISDCLNELKPGDQIEIQWRRNKEFPYGW  320

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WYGVVGHLETCDGN  YCRCH+ DT+VLEFNQY+ GSRWRRTTVSRKDHREEGNEA+GFY
Sbjct  321   WYGVVGHLETCDGNADYCRCHDSDTLVLEFNQYTRGSRWRRTTVSRKDHREEGNEADGFY  380

Query  1645  GGIQKVESREVISTWKRLWPAQVLE  1719
             GGI+K+  +E IS WK+LWPA+ LE
Sbjct  381   GGIRKLCGKEEISMWKKLWPAEALE  405



>ref|XP_010313246.1| PREDICTED: F-box protein At2g32560 isoform X1 [Solanum lycopersicum]
Length=396

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 300/384 (78%), Gaps = 8/384 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLF-SLIPLRMLAMRSKPGGCSKAD  756
             KSL+ K +P W+S     L    W D  +L   +K    SL+   ++ +R K    S   
Sbjct  17    KSLSLKPLPLWSSSEVRLLSIWFWNDFLILNPFKKGFLESLMSSNVMTLRRK--SFSYRV  74

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             ++VE   S+MSVLDLP+LVLECILE++PPEGLC +ASVCSSLRE+C S +LWE+H+K+KW
Sbjct  75    ENVEAN-SEMSVLDLPELVLECILERLPPEGLCSMASVCSSLREKCTSKYLWEKHMKEKW  133

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G ++GPAA+REW WHI+ RKDS  FNQAKE+GL +YLS+ WP+S IV  N     K+ + 
Sbjct  134   GRVLGPAAHREWLWHISSRKDSSFFNQAKERGLMTYLSQFWPIS-IVRSNPSTSFKKKDP  192

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRE---NGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
             P IDS+M  YLALESGKFWFPAQVYNRE   NGHVGFMLSCYDAELSY  RTDTF ARYP
Sbjct  193   PVIDSIMSMYLALESGKFWFPAQVYNREIVQNGHVGFMLSCYDAELSYSRRTDTFQARYP  252

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR A+AIETGVTWDRLR P +D   HDL+ISDCL +L PGDHIEIQWRRNK+FPYGWW
Sbjct  253   PHGRRAMAIETGVTWDRLRVPPLDTSPHDLYISDCLTELCPGDHIEIQWRRNKEFPYGWW  312

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLETCDGN++YCRCHE DTVVLEFNQY+ GSRWR T + RKDHREEGNEA+GFYG
Sbjct  313   YGVVGHLETCDGNEYYCRCHENDTVVLEFNQYTHGSRWRTTHIDRKDHREEGNEADGFYG  372

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K+ S E IS W+RLWP+ VLE
Sbjct  373   GIRKLHSNEEISMWRRLWPSDVLE  396



>ref|XP_007015245.1| F-box family protein isoform 1 [Theobroma cacao]
 gb|EOY32864.1| F-box family protein isoform 1 [Theobroma cacao]
Length=398

 Score =   510 bits (1314),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 250/387 (65%), Positives = 297/387 (77%), Gaps = 12/387 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRK-------NLFSLIPLRMLAMRSKPG  738
             KSL  K +P WA+E RL  L+  WK++   ++ +        + F+ IP +M     K  
Sbjct  17    KSLTLKPLPPWATEMRLLSLW-FWKEVPFFSISKSIKNSLSLSFFTTIPSKMSL--KKIS  73

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
               SK D+  E     MSVLDLP+LVLECILEK+PP GLC +A VCSSLR RC+SDH WE+
Sbjct  74    FTSKVDNFEEIEEGVMSVLDLPELVLECILEKLPPAGLCSMAGVCSSLRSRCISDHFWEK  133

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAG  1098
             H+K+KWG +IGPAAYREWQWHIA RKDS    Q K KGL   LS + P   I    +   
Sbjct  134   HMKEKWGRVIGPAAYREWQWHIASRKDSSHVKQGKPKGLMRILSIIRPFWWI-KLKVDDS  192

Query  1099  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
              K+++LP  DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDP T+TF A
Sbjct  193   SKQSSLPD-DSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPGTETFQA  251

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR AVAIE  V W+RLRAP +D   HDLHISDCL +LRPGD+IEIQWRRNK+FPY
Sbjct  252   RYPPHGRRAVAIENCVPWERLRAPPIDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPY  311

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEG  1638
             GWWYGVVGHLE+CDGN++YCRCH  DTVVLEFN Y+PGSRWRRT+++RKDHREEGNEA+G
Sbjct  312   GWWYGVVGHLESCDGNENYCRCHNSDTVVLEFNHYTPGSRWRRTSINRKDHREEGNEADG  371

Query  1639  FYGGIQKVESREVISTWKRLWPAQVLE  1719
             FYGGI+K+ S E I+TWKRLWPA++LE
Sbjct  372   FYGGIRKLSSEEEITTWKRLWPAEILE  398



>ref|XP_006356347.1| PREDICTED: F-box protein At2g32560-like [Solanum tuberosum]
Length=393

 Score =   510 bits (1313),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/381 (65%), Positives = 296/381 (78%), Gaps = 5/381 (1%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLF-SLIPLRMLAMRSKPGGCSKAD  756
             KSL+ K +P W+S     L    W D  +L   ++    SL+   ++ +R K   C    
Sbjct  17    KSLSLKPLPLWSSSEVRLLSIWFWNDFLILNPFKEGFLESLMSSNVMTLRRKSFSCRV--  74

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             ++VET  S+MSVLDLP+LVLECILE++PPEGL  +ASVCSSLRE+C S +LWE+H+K+KW
Sbjct  75    ENVETN-SEMSVLDLPELVLECILERLPPEGLYSMASVCSSLREKCTSKYLWEKHMKEKW  133

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G ++GPAA+REW WHI+ R DS  FNQAKE+GL +YLS+ WP+S +V  N     K+   
Sbjct  134   GRVLGPAAHREWLWHISSRNDSSFFNQAKERGLMTYLSQFWPIS-LVRSNPSTSFKKKVP  192

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
             P IDS+M  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  RTDTF ARYPPHG
Sbjct  193   PAIDSIMSMYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYSRRTDTFQARYPPHG  252

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A+AIETGVT DRLR P +D   HDL+ISDCL +L PGDHIEIQWRRNK+FPYGWWYGV
Sbjct  253   RRAMAIETGVTLDRLRVPPLDTSPHDLYISDCLTELCPGDHIEIQWRRNKEFPYGWWYGV  312

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLETCDGN++YCRCHE DTVVLEF QY+ GSRWR T + RKDHREEGNEA+GFYGGI+
Sbjct  313   VGHLETCDGNEYYCRCHESDTVVLEFKQYTHGSRWRTTHIDRKDHREEGNEADGFYGGIR  372

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ S E IS W+RLWP+ VLE
Sbjct  373   KLHSNEEISMWRRLWPSDVLE  393



>ref|XP_007212266.1| hypothetical protein PRUPE_ppa006669mg [Prunus persica]
 gb|EMJ13465.1| hypothetical protein PRUPE_ppa006669mg [Prunus persica]
Length=400

 Score =   507 bits (1305),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 248/388 (64%), Positives = 297/388 (77%), Gaps = 9/388 (2%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVR--KNLFSLI-----PLRMLAMRSKP  735
             +K+L  K +P WA E RL L    WK+LS  T+ +  K  FS+      P +M   R   
Sbjct  15    FKTLPLKPLPPWACEMRL-LSPWFWKELSFFTISKLTKKSFSIFFLSPFPSKMSLKRKPL  73

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                +K ++  E   S++SVLDLP+LVLECILE++PP+ L  +  VC+SLRERC SDHLWE
Sbjct  74    SLSAKVENVEEEDTSELSVLDLPELVLECILERLPPDALFRMTGVCTSLRERCRSDHLWE  133

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +H+KQKWG +IGPAAYREWQWHIA + D     Q K+KGL   LS  WP S I       
Sbjct  134   KHMKQKWGSVIGPAAYREWQWHIASKTDLVDVKQGKQKGLMRILSLGWPFSWIRSRVDDH  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               +R +LP  DSVM WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAE+SYDPRTDTF 
Sbjct  194   SQQRCSLP-ADSVMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAEISYDPRTDTFQ  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVAIE GV W+RLRAP ++ PAHDLH+SDCL +L+PGDHIEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAIENGVPWERLRAPPIETPAHDLHMSDCLNELQPGDHIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDG+++YC CH  DTVVLEFNQY+ GSRWR T +SR+DHREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGHENYCLCHNSDTVVLEFNQYTHGSRWRCTNISRRDHREEGNEAD  372

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ ++E ISTWKRLWP +VLE
Sbjct  373   GFYGGIRKLRTKEEISTWKRLWPTEVLE  400



>ref|XP_009350006.1| PREDICTED: F-box protein At2g26850-like [Pyrus x bretschneideri]
Length=400

 Score =   506 bits (1304),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 250/388 (64%), Positives = 291/388 (75%), Gaps = 9/388 (2%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSL-------IPLRMLAMRSKP  735
             +K+L  K +P WASE  L  LF  WKD S   L +     L       IP RM  +R   
Sbjct  15    FKTLPLKPLPPWASETPLLSLF-FWKDFSFFALSKFTNQGLSILFRPRIPSRMSLVRRTL  73

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                S   ++V+ T  +MSVLDLP+LVLECIL+K+PPE L  +  VCSSLRERC SDHLWE
Sbjct  74    SLSSSKVENVDDT-PEMSVLDLPELVLECILDKLPPEALFRMTGVCSSLRERCRSDHLWE  132

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +H+K KWG +IGPAAYREWQWHIA + D     Q K+KGL   LS  WP S I       
Sbjct  133   KHMKMKWGRVIGPAAYREWQWHIASKTDLIDVKQGKQKGLMRILSLGWPFSWIRSKVDDH  192

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
             G K+ +  P DS+M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYDPRTDTF 
Sbjct  193   GSKQRSSLPADSIMAWYLALETGRFWFPAQVYNRENGHVGFVLSCYDAELSYDPRTDTFQ  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVAIE GV+W+RLRAP VD P HDLH+SDCL +LRPGDHIEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAIEKGVSWERLRAPPVDTPPHDLHVSDCLNELRPGDHIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDGN++YC CH   TVVLEFNQY+ GSRWR T +SR+DHREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGNENYCLCHNSGTVVLEFNQYTHGSRWRCTNISRRDHREEGNEAD  372

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ S++ IS WK +WP QVLE
Sbjct  373   GFYGGIRKLRSKQEISMWKLIWPTQVLE  400



>ref|XP_008227257.1| PREDICTED: F-box protein At2g26850-like [Prunus mume]
Length=400

 Score =   506 bits (1303),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 247/388 (64%), Positives = 295/388 (76%), Gaps = 9/388 (2%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVR--KNLFSLI-----PLRMLAMRSKP  735
             +K+L  K +P WA E RL L    WK+LS  T+ +  K  FS+      P +M   R   
Sbjct  15    FKTLPLKPLPPWACEMRL-LSPWFWKELSFFTISKLTKKSFSIFFLSPFPSKMSLKRKPL  73

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                +K ++  E    +MSVLDLP+LVLECILE++PP+ L  +  VC+SLRERC SDHLWE
Sbjct  74    SLSAKVENVEEEDTPEMSVLDLPELVLECILERLPPDALFRMTGVCTSLRERCRSDHLWE  133

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +H+KQKWG +IGPAAYREWQWHIA + D     Q K+KGL   LS  WP S I       
Sbjct  134   KHMKQKWGSVIGPAAYREWQWHIASKTDLVDVKQGKQKGLMRILSLGWPFSWIRSRVDDH  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               +R +LP  DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAE+SYDPRTDTF 
Sbjct  194   SQQRCSLP-ADSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAEISYDPRTDTFQ  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVAIE GV W+RLRAP ++ P HDLH+SDCL +L+PGDHIEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAIENGVPWERLRAPPIETPPHDLHMSDCLNELQPGDHIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDGN++YC CH  DTVVLEFNQY+ GSRWR T +SR+DHREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGNENYCLCHNSDTVVLEFNQYTHGSRWRCTNISRRDHREEGNEAD  372

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ ++E ISTWKRLWP +VLE
Sbjct  373   GFYGGIRKLRTKEEISTWKRLWPTEVLE  400



>ref|XP_002263423.1| PREDICTED: F-box protein At2g32560 isoform X2 [Vitis vinifera]
Length=396

 Score =   501 bits (1291),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 243/385 (63%), Positives = 294/385 (76%), Gaps = 11/385 (3%)
 Frame = +1

Query  583   SLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSL------IPLRMLAMRSKPGGC  744
             S + + +P+W SE RL      WK+LS  T+ R    SL      IP +M      P   
Sbjct  17    SFSIRPLPSWVSEIRLSSSLWFWKELSFFTIYRSIKNSLFGGFWGIPSKMSFTEKTP---  73

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
                 ++VE  + +M +LDLP+LVLECILE++PPEGLC L  VCSSLR+RCMSD+ W+RH+
Sbjct  74    LHKVENVEVGL-EMGLLDLPELVLECILERLPPEGLCSLGGVCSSLRDRCMSDYFWKRHM  132

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDK  1104
             K+KWG I+G AAYREWQWH+A RKDS    Q K  GL   LSR  PLS I      +  +
Sbjct  133   KEKWGRILGRAAYREWQWHMASRKDSDTLEQGKPNGLMRLLSRFGPLSWIRSRLSNSTPQ  192

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
             R+++P +DS+M WYLALE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTF ARY
Sbjct  193   RSSVP-VDSIMSWYLALETGRFWFPAQVYNRESGHVGFMLSCYDAELSYDSHTDTFQARY  251

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
             PPHGR  VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPYGW
Sbjct  252   PPHGRRTVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYGW  311

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WYG+VGHLE+CDGN+ YCRCH  +TVVLEFNQY+PGSRWRRT+++RKDHREEGNEA+GFY
Sbjct  312   WYGIVGHLESCDGNESYCRCHNSETVVLEFNQYTPGSRWRRTSINRKDHREEGNEADGFY  371

Query  1645  GGIQKVESREVISTWKRLWPAQVLE  1719
             GGI+K+   + IS WK+LWPA+VLE
Sbjct  372   GGIRKLCRNDEISVWKQLWPAEVLE  396



>ref|XP_002533285.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29096.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   501 bits (1289),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/395 (62%), Positives = 301/395 (76%), Gaps = 17/395 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLL--------TLVRKNLFSLIPLRMLAMRSKP  735
             KSL  + +P+WASE RL  L+  WK+L L         TL +  + + IP +M +M+   
Sbjct  16    KSLPLEPLPSWASEVRLLSLW-FWKELFLFPYFGSFRNTLFKACISTRIPSKM-SMKKMA  73

Query  736   GGCS------KADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCM  897
               C+      +     +  +S++SVLDLP+L LECILEK+PP+GLC +A VC+SLR+RC+
Sbjct  74    LICNGKLEQQQHQQAEDDEISEVSVLDLPELALECILEKLPPKGLCSMAGVCTSLRQRCL  133

Query  898   SDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS-VI  1074
             SDHLWERH+KQKWG IIGPAAYREWQ+HIA R D     Q K+KGL   LS +WP S +I
Sbjct  134   SDHLWERHMKQKWGKIIGPAAYREWQFHIASRNDFGTCKQGKQKGLMKLLSIVWPPSWII  193

Query  1075  VGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD  1254
                +     K+ +  P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDA+LSYD
Sbjct  194   PKDDCNIFIKQRSSLPVDSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDADLSYD  253

Query  1255  PRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQW  1434
             PR DTF ARYPPHGR A AIE GV W+RLRAP  D   HDLHISDCL +LRPGDHIEIQW
Sbjct  254   PRKDTFQARYPPHGRRATAIENGVPWERLRAPPADTSPHDLHISDCLNELRPGDHIEIQW  313

Query  1435  RRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHR  1614
             RRNK+FPYGWWYGVVGHLE+CDGN++YCRCH  DTVVLEF+QY+ GSRWR T ++RK+HR
Sbjct  314   RRNKEFPYGWWYGVVGHLESCDGNENYCRCHNSDTVVLEFHQYTRGSRWRYTMINRKEHR  373

Query  1615  EEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +EGNEA+GFYGGI+K+ S+E IS WK+LWP +VLE
Sbjct  374   QEGNEADGFYGGIRKLNSKEEISRWKQLWPTEVLE  408



>emb|CBI24276.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   497 bits (1280),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 289/379 (76%), Gaps = 20/379 (5%)
 Frame = +1

Query  583   SLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDH  762
             S + + +P+W SE RL      WK+LS  T+ R    SL                   ++
Sbjct  17    SFSIRPLPSWVSEIRLSSSLWFWKELSFFTIYRSIKNSLF------------------EN  58

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             VE  + +M +LDLP+LVLECILE++PPEGLC L  VCSSLR+RCMSD+ W+RH+K+KWG 
Sbjct  59    VEVGL-EMGLLDLPELVLECILERLPPEGLCSLGGVCSSLRDRCMSDYFWKRHMKEKWGR  117

Query  943   IIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPP  1122
             I+G AAYREWQWH+A RKDS    Q K  GL   LSR  PLS I      +  +R+++P 
Sbjct  118   ILGRAAYREWQWHMASRKDSDTLEQGKPNGLMRLLSRFGPLSWIRSRLSNSTPQRSSVP-  176

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             +DS+M WYLALE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTF ARYPPHGR 
Sbjct  177   VDSIMSWYLALETGRFWFPAQVYNRESGHVGFMLSCYDAELSYDSHTDTFQARYPPHGRR  236

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
              VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPYGWWYG+VG
Sbjct  237   TVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYGWWYGIVG  296

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             HLE+CDGN+ YCRCH  +TVVLEFNQY+PGSRWRRT+++RKDHREEGNEA+GFYGGI+K+
Sbjct  297   HLESCDGNESYCRCHNSETVVLEFNQYTPGSRWRRTSINRKDHREEGNEADGFYGGIRKL  356

Query  1663  ESREVISTWKRLWPAQVLE  1719
                + IS WK+LWPA+VLE
Sbjct  357   CRNDEISVWKQLWPAEVLE  375



>ref|XP_010651536.1| PREDICTED: F-box protein At2g32560 isoform X1 [Vitis vinifera]
Length=397

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 243/386 (63%), Positives = 294/386 (76%), Gaps = 12/386 (3%)
 Frame = +1

Query  583   SLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSL------IPLRMLAMRSKPGGC  744
             S + + +P+W SE RL      WK+LS  T+ R    SL      IP +M      P   
Sbjct  17    SFSIRPLPSWVSEIRLSSSLWFWKELSFFTIYRSIKNSLFGGFWGIPSKMSFTEKTP---  73

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
                 ++VE  + +M +LDLP+LVLECILE++PPEGLC L  VCSSLR+RCMSD+ W+RH+
Sbjct  74    LHKVENVEVGL-EMGLLDLPELVLECILERLPPEGLCSLGGVCSSLRDRCMSDYFWKRHM  132

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDK  1104
             K+KWG I+G AAYREWQWH+A RKDS    Q K  GL   LSR  PLS I      +  +
Sbjct  133   KEKWGRILGRAAYREWQWHMASRKDSDTLEQGKPNGLMRLLSRFGPLSWIRSRLSNSTPQ  192

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRE-NGHVGFMLSCYDAELSYDPRTDTFHAR  1281
             R+++P +DS+M WYLALE+G+FWFPAQVYNRE +GHVGFMLSCYDAELSYD  TDTF AR
Sbjct  193   RSSVP-VDSIMSWYLALETGRFWFPAQVYNREQSGHVGFMLSCYDAELSYDSHTDTFQAR  251

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             YPPHGR  VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPYG
Sbjct  252   YPPHGRRTVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYG  311

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYG+VGHLE+CDGN+ YCRCH  +TVVLEFNQY+PGSRWRRT+++RKDHREEGNEA+GF
Sbjct  312   WWYGIVGHLESCDGNESYCRCHNSETVVLEFNQYTPGSRWRRTSINRKDHREEGNEADGF  371

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K+   + IS WK+LWPA+VLE
Sbjct  372   YGGIRKLCRNDEISVWKQLWPAEVLE  397



>gb|KHG08627.1| hypothetical protein F383_10185 [Gossypium arboreum]
Length=400

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/388 (65%), Positives = 292/388 (75%), Gaps = 12/388 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRL-QLLFRLWKDLSLLTLVR--KNLFSLIPLRMLAMR---SKPGG  741
             KSL  K +P WA+E RL    FR  KD+S     R  KN+  L     +  +    K   
Sbjct  17    KSLTLKPLPPWATEMRLLSPWFR--KDVSFFLSSRLIKNILGLGYFTTVVSKMSLKKMSF  74

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
              SK D+  E   S MS+LDLPDLVLECILE++PP  LC +A VCSSLR RC+SDH WE+H
Sbjct  75    TSKVDNFEEVEESAMSILDLPDLVLECILERLPPAALCSMAGVCSSLRSRCISDHFWEKH  134

Query  922   LKQKWGGIIGPAAYREWQWHIALR--KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +K+KWG IIGPAAYREWQWHIALR  KDS    Q K KGL   LS + P S  +   +  
Sbjct  135   MKKKWGRIIGPAAYREWQWHIALRTRKDSSHLKQGKPKGLMRVLSIVRP-SWWIKSKVDD  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               K+ +LP  DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF 
Sbjct  194   SSKQCSLPD-DSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQ  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVAIE  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAIENYVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDGN +YCRCH  DTVVLEFNQY+ GSRWRR T++RK+HREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGNDNYCRCHNSDTVVLEFNQYTAGSRWRRATINRKEHREEGNEAD  372

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ + E ISTWK LWP+++LE
Sbjct  373   GFYGGIRKLCNEEEISTWKCLWPSEILE  400



>ref|XP_008359219.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Malus domestica]
Length=400

 Score =   494 bits (1273),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 247/388 (64%), Positives = 288/388 (74%), Gaps = 9/388 (2%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVR--KNLFSL-----IPLRMLAMRSKP  735
             +K+L    +P WASE  L  LF  WKD S   L +  K   S+     IP RM  +R   
Sbjct  15    FKTLPLNPLPPWASETPLLSLF-FWKDFSFFALSKFTKQGLSILFRPRIPSRMSLVRRTL  73

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                S   ++V+ T  +MSVLDLP+LVLECIL K+PP+ L  +  VCSSLRERC SDHLWE
Sbjct  74    SLSSSKVENVDDT-PEMSVLDLPELVLECILXKLPPDALFQMTGVCSSLRERCRSDHLWE  132

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +H+K KWG +IGPAA REWQ HIA + D     Q K+KGL   LS  WP S I       
Sbjct  133   KHMKMKWGRVIGPAAXREWQCHIASKTDLIDVKQGKQKGLMRILSLGWPFSWIRSKVDDH  192

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
             G K+ +  P DS+M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYDPRTDTF 
Sbjct  193   GTKQRSSLPADSIMSWYLALETGRFWFPAQVYNRENGHVGFVLSCYDAELSYDPRTDTFQ  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVAIE GV W+RLRAP VD P HDLH+SDCL +LRPGDHIEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAIEKGVPWERLRAPPVDTPPHDLHVSDCLNELRPGDHIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDGN++YC CH  DTVVLEFNQY+ GSRWR T +SR+DHREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGNENYCLCHXSDTVVLEFNQYTHGSRWRCTNISRRDHREEGNEAB  372

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+ + S++ IS WK +WP QVLE
Sbjct  373   GFYGGIRMLRSKQEISMWKLIWPTQVLE  400



>ref|XP_002314008.1| F-box family protein [Populus trichocarpa]
 gb|EEE87963.1| F-box family protein [Populus trichocarpa]
Length=405

 Score =   494 bits (1273),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 293/382 (77%), Gaps = 15/382 (4%)
 Frame = +1

Query  610   WASEFRLQLLFRLWKDLSLL--------TLVRKNLFSLIPLRMLAMRSKPGGCSKADDH-  762
             WASE RL  ++ L KDL L         TL+     ++IPL+    +      ++A+   
Sbjct  27    WASEIRLLSVWFL-KDLFLFSYLGSLRNTLLEVFYINIIPLKTSIKKMSLSSSARAEKSA  85

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             ++     MSVLDLP+L LEC+LE++PP GLC +A VC+SLRERC+SDHLWE+H+K KWG 
Sbjct  86    LDDETGGMSVLDLPELALECVLERLPPAGLCSMAGVCTSLRERCVSDHLWEKHMKHKWGR  145

Query  943   IIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS---VIVGPNLGAGDKRNN  1113
             +IGPAAYREWQWH+A RKD     Q K KGL   LS  WP S     V P +    +R++
Sbjct  146   VIGPAAYREWQWHLASRKDLGSCKQGKPKGLMRLLSIFWPSSWSTPKVDP-VNNSRQRSS  204

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
             LP + S+M WYLALE+GKFWFPAQV+NRENGHVGFMLSCYDAEL+YDPRTDTF ARYPPH
Sbjct  205   LP-VHSIMSWYLALETGKFWFPAQVFNRENGHVGFMLSCYDAELNYDPRTDTFQARYPPH  263

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR A++IE+GV W+RLRAP VD   HDLHISDCL+DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264   GRRAISIESGVPWERLRAPSVDTSPHDLHISDCLHDLLPGDHIEIQWRRNKEFPYGWWYG  323

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             VVGHLE+CDGN++YCRCH  DTVVLEF+QY+PGSRWR TTV+RK+HREEGNEA+GFYGGI
Sbjct  324   VVGHLESCDGNENYCRCHNSDTVVLEFHQYTPGSRWRSTTVNRKEHREEGNEADGFYGGI  383

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+   E IS WKRLWP +VLE
Sbjct  384   RKLYKNEEISRWKRLWPTEVLE  405



>ref|XP_012065843.1| PREDICTED: F-box protein At2g26850 isoform X1 [Jatropha curcas]
Length=404

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 238/390 (61%), Positives = 293/390 (75%), Gaps = 11/390 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLL--------TLVRKNLFSLIPLRMLA--MRS  729
             KSL  K +P+WA+E RL L    WK+L L         TL +   F+ +P +M    M +
Sbjct  16    KSLHLKPLPSWATEVRL-LSIWFWKELFLFPYLCSVKNTLSKAFYFTRLPSKMSTKKMTT  74

Query  730   KPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHL  909
                   + ++ V+    +++ LDLPDL L+CILE++PP GLC +A VC+SLRERC+S+HL
Sbjct  75    LSTSTVELENLVDDETGEITFLDLPDLTLDCILERLPPAGLCSMAGVCTSLRERCISNHL  134

Query  910   WERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL  1089
             WERH+KQKWG IIGPAAYR+WQ++IA  KD     Q K+K L   LS + P S +     
Sbjct  135   WERHMKQKWGKIIGPAAYRKWQFNIAASKDFDNCKQGKQKKLMRLLSIVLPFSWMNSMED  194

Query  1090  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
                 K+ +  P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPRT+T
Sbjct  195   DNNVKQKSSLPVDSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTNT  254

Query  1270  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  1449
             F ARYPPHGR A+AIETGV W+RLRAP +D   H LHISDCL DLRPGDHIEIQWRRNK+
Sbjct  255   FQARYPPHGRRAIAIETGVPWERLRAPPIDTSPHHLHISDCLNDLRPGDHIEIQWRRNKE  314

Query  1450  FPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNE  1629
             FPYGWWYGVVGHLE CDGN++YCRCH  DT+VLEF+QY+ GSRWR T ++RK+HREEGNE
Sbjct  315   FPYGWWYGVVGHLEPCDGNENYCRCHNSDTIVLEFHQYTRGSRWRCTMINRKEHREEGNE  374

Query  1630  AEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             A+GFYGGI+K+ + E IS WK+LWP +VLE
Sbjct  375   ADGFYGGIRKLNANEEISRWKQLWPTEVLE  404



>gb|KJB55449.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=400

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 250/388 (64%), Positives = 290/388 (75%), Gaps = 12/388 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRL-QLLFRLWKDLSLLTLVR--KNLFSLIPLRMLAMR---SKPGG  741
             KSL  K  P WA+E RL    FR  KD+S     R  KN+  L     +  +    K   
Sbjct  17    KSLTLKPPPPWAAEMRLLSPWFR--KDVSFFLSSRLIKNILGLAYFTTVVSKMSLKKMSF  74

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
              SK D+  E   S MS+LDLPDLVLECILE++PP  LC +A VCSSLR RC+SDH WE+H
Sbjct  75    TSKVDNFEEVEESAMSILDLPDLVLECILERLPPAALCSMAGVCSSLRSRCISDHFWEKH  134

Query  922   LKQKWGGIIGPAAYREWQWHIALR--KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +K+KWG IIGPAAYREWQWHIALR  KDS    Q K KGL   LS + P S  +   +  
Sbjct  135   MKKKWGRIIGPAAYREWQWHIALRTRKDSSHLMQGKPKGLMRVLSIVRP-SWWIKSKVDD  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               K+ +LP  DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF 
Sbjct  194   SSKQCSLPD-DSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFK  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDGN +YCRCH  DTVVLEFNQY+ GSRWRR T++RK+HREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGNDNYCRCHNSDTVVLEFNQYTAGSRWRRATINRKEHREEGNEAD  372

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ + E ISTWKRLWP+++LE
Sbjct  373   GFYGGIRKLCNEEEISTWKRLWPSEILE  400



>ref|XP_010246180.1| PREDICTED: F-box protein At2g32560-like [Nelumbo nucifera]
Length=394

 Score =   489 bits (1259),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 290/382 (76%), Gaps = 5/382 (1%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSL--LTLVRKNLFSLIPLRMLAMRSKPGGCSKA  753
             KSL+ K +  WASE RL  L+  WK+L    ++ +RK+  S     + A  S     S  
Sbjct  16    KSLSLKPLAPWASEMRLLSLW-FWKELFSFHVSWLRKSKLSDGLFEIPARMSLKKSTSLQ  74

Query  754   DDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
              ++VE T  +M VLDLP+L LECIL ++PP GL ++A VC SLR+RC SDHLWERH+K+K
Sbjct  75    VENVEET-EKMCVLDLPELALECILGRLPPSGLRNMAGVCISLRDRCRSDHLWERHMKEK  133

Query  934   WGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             WG +IG AA+REWQWHIA RKD  + N+ K+KG    LS  WPL  I      +   R++
Sbjct  134   WGRVIGRAAHREWQWHIASRKDLGVLNRTKQKGFVRSLSSFWPLPWIRSKLDNSNKPRSS  193

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
             LP +DSVM WYLALESGKFWFPAQVYNRE+GHVGFMLSCYDAELSYD RTDTF ARYPPH
Sbjct  194   LP-VDSVMSWYLALESGKFWFPAQVYNREHGHVGFMLSCYDAELSYDSRTDTFQARYPPH  252

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR  V IE GV WDRLRAP VD   HDLH+SDCL+DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  253   GRRTVVIEDGVQWDRLRAPPVDTRPHDLHVSDCLHDLHPGDHIEIQWRRNKEFPYGWWYG  312

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             VVGHLE+CDGN+++C C+  D V+LEFNQY+PGSRWR+  +SRKDHREEGNEA+GFYGGI
Sbjct  313   VVGHLESCDGNENHCHCYYSDIVILEFNQYAPGSRWRQAAISRKDHREEGNEADGFYGGI  372

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+   E ISTWKRLWP +VLE
Sbjct  373   RKIYCEEEISTWKRLWPTEVLE  394



>gb|AHB08886.1| F-box family protein [Suaeda glauca]
Length=399

 Score =   488 bits (1256),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 290/387 (75%), Gaps = 10/387 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL---VRKNLFSLIPLRMLAMRSKPGGC-S  747
              SL+ K +P WA++ RL L    WKDLS   +   ++K +F +       M  K G C S
Sbjct  16    NSLSLKPLPPWANDVRL-LPLCFWKDLSFSPICKALKKGVFGVFWRFPSIMAIKQGNCIS  74

Query  748   KADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             K ++  E    Q+SVLDLP+L L+CILEK+PP GLC +A+VCSSLRERC+SDHLW+RH+ 
Sbjct  75    KFENSQEN--EQLSVLDLPELALDCILEKLPPSGLCSMAAVCSSLRERCISDHLWDRHMN  132

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
              KWG ++G AA REW W IA +++S      K + L +++  +WPL+        A +  
Sbjct  133   HKWGKVLGRAAKREWHWFIASKRNSSASVGKKSQSLINFIWHVWPLTWFTSKFEKASNNN  192

Query  1108  N---NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
             N     P +DSVM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP++DTF A
Sbjct  193   NKDSTSPLVDSVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPQSDTFKA  252

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR AVAIE+G+ W+RLRA  VD P HDLH SDCL DL PGDHIEIQWRRNK+FPY
Sbjct  253   RYPPHGRRAVAIESGIQWERLRAAPVDTPPHDLHQSDCLNDLHPGDHIEIQWRRNKEFPY  312

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEG  1638
             GWWYGVVGHLE+CDGN +YCRCH  DTV+LEFNQY+PGSRWRRT VSRKDHREEGNE++G
Sbjct  313   GWWYGVVGHLESCDGNDNYCRCHSSDTVLLEFNQYTPGSRWRRTIVSRKDHREEGNESDG  372

Query  1639  FYGGIQKVESREVISTWKRLWPAQVLE  1719
             FYGGI+K+   + ++TWK LWP ++LE
Sbjct  373   FYGGIRKLHKHDEVATWKSLWPREILE  399



>ref|XP_008449641.1| PREDICTED: F-box protein At2g32560 [Cucumis melo]
Length=396

 Score =   486 bits (1251),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 237/383 (62%), Positives = 282/383 (74%), Gaps = 6/383 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL---VRKNLFSLIPLRMLAMRSKPGGCSK  750
             KSL+ K +P WA E R  L    WK+LSL  +   ++ +L +        M  K    SK
Sbjct  17    KSLSLKPLPLWADEMRF-LSHWFWKELSLFPIYKVIKNSLCTYTFCISSKMSFKKKYLSK  75

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
              ++  E+  ++MSVLDLP+L LECILEK+PP+ LC +A VCSSLRERC+SDHLWE+H+K+
Sbjct  76    VENVEES--AEMSVLDLPELALECILEKLPPDALCSMAGVCSSLRERCISDHLWEKHMKR  133

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             KWG +IG AAYREWQWH+A R       Q K+K L    S  W LS I        +   
Sbjct  134   KWGKVIGQAAYREWQWHLASRAGESNLKQNKQKSLIRLFSFGWSLSWIRSKVNDNNNTPR  193

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             N  P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPP
Sbjct  194   NFLPVDSIMAWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDLRTDTFQARYPP  253

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR A+AIE GV W+RLR+P +D P HDLH+SDCL +L PGDHIEIQWR+NK FPYGWWY
Sbjct  254   HGRRAIAIENGVQWERLRSPPIDTPPHDLHVSDCLNELCPGDHIEIQWRKNKDFPYGWWY  313

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GVVGHLETCDG+ ++C CH  DTVVLEFNQY+PGSRWR   + RKDHREEGNE +GFYGG
Sbjct  314   GVVGHLETCDGDANHCSCHYSDTVVLEFNQYTPGSRWRLAIIDRKDHREEGNEVDGFYGG  373

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+ S E ISTWK+LWP  VLE
Sbjct  374   IRKLYSDEEISTWKQLWPTDVLE  396



>ref|XP_003519507.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
 gb|KHN38398.1| F-box protein [Glycine soja]
Length=397

 Score =   486 bits (1250),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 239/386 (62%), Positives = 288/386 (75%), Gaps = 15/386 (4%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLLFRLWKDLSLLT---LVRKNL----FSLIPLRMLAMRSKPGGC  744
             L+ K +P+WASE RL +    +KDLS+ +   L RK L       IP RM ++ +K    
Sbjct  19    LSLKSLPSWASEVRL-ISPLFYKDLSVKSISKLFRKRLWLGFLGQIPTRM-SLVNKSSKV  76

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
                +D  +     MSVLDLP+LVLECILEK+PP  LC +A VC SLRE C+SDHLWERH+
Sbjct  77    EIIEDSQD-----MSVLDLPELVLECILEKLPPPSLCQMAGVCRSLRESCVSDHLWERHM  131

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS-VIVGPNLGAGD  1101
             KQKWG +IG AAYREW+WH A + +       K++ L   +S  WP S +    +     
Sbjct  132   KQKWGRVIGQAAYREWKWHAASKGNVGTLRHGKQRSLLRLVSLSWPFSWMRTKVDANNSI  191

Query  1102  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
             K+ +  P DS+M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP TDTF AR
Sbjct  192   KQQSYLPPDSLMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPHTDTFQAR  251

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             YPPHGR AVA+E G+ W+RLRAP VD P HDLHISDCLYDL PGDH+EIQWRRNK+FPYG
Sbjct  252   YPPHGRRAVAVEHGIPWERLRAPPVDTPPHDLHISDCLYDLHPGDHVEIQWRRNKEFPYG  311

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYGVVGHLE CDGN++YCRCH  DTVVLEFNQY+P SRW +TT+SR+DHREEGNEA+GF
Sbjct  312   WWYGVVGHLEVCDGNENYCRCHSSDTVVLEFNQYNPDSRWGKTTISRRDHREEGNEADGF  371

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K++S   IS WK +WP++VL+
Sbjct  372   YGGIRKIKSETEISIWKSIWPSEVLD  397



>gb|KDO54745.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=405

 Score =   486 bits (1251),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 240/390 (62%), Positives = 291/390 (75%), Gaps = 15/390 (4%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSL----IPLRMLAMRSKPGGC  744
             LA K +P WA    L+LL    WK++S  ++    KN  ++    IP   L+ +      
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHM---M  75

Query  745   SKADDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
             S ++DHVE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+
Sbjct  76    STSNDHVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEK  135

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAG  1098
             H+KQKWG I+GPAAYREWQWH+A RKDS    Q K++      S +   S +        
Sbjct  136   HMKQKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTS  195

Query  1099  DKRNNLP-PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
              +      P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDT
Sbjct  196   KQTTTTRLPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDT  255

Query  1270  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  1449
             F ARYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+
Sbjct  256   FQARYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKE  315

Query  1450  FPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNE  1629
             FPYGWWYGVVGHLE+CDGN+++C CH  +T++LEFNQY+PGSRWR+TT++RKDHREEGNE
Sbjct  316   FPYGWWYGVVGHLESCDGNENFCHCHNSETLILEFNQYTPGSRWRKTTINRKDHREEGNE  375

Query  1630  AEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             A+GFYGGI+KV + E I  WKRLWP +VLE
Sbjct  376   ADGFYGGIRKVNNEEEIKMWKRLWPVEVLE  405



>ref|XP_011009173.1| PREDICTED: F-box protein At2g32560-like [Populus euphratica]
Length=405

 Score =   486 bits (1251),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 240/381 (63%), Positives = 285/381 (75%), Gaps = 13/381 (3%)
 Frame = +1

Query  610   WASEFRLQLLFRLWKDL---SLLTLVRKNLFSL-----IPLRMLAMRSKPGGCSKAD-DH  762
             W SE RL L F   KDL   S L  +R  L  +     IPL+M       G  ++A    
Sbjct  27    WTSEMRL-LSFWFLKDLLLFSYLGSLRSTLLKIFHIDRIPLKMTIKNMSLGSSARAKKSS  85

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             ++  V  MSVLDLP+L LECILE++PP GLC +A VC+SLRERC+SDHLWE+H+KQKWG 
Sbjct  86    LDGEVGGMSVLDLPELALECILERLPPAGLCSMAGVCTSLRERCVSDHLWEKHMKQKWGR  145

Query  943   IIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS--VIVGPNLGAGDKRNNL  1116
             +IGPAA REWQWH+A RKD     Q K KG    LS  WP S        +    +R++L
Sbjct  146   VIGPAASREWQWHVASRKDLGSCKQGKPKGFTRLLSMFWPSSWSTPKADPINNSKQRSSL  205

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
             P ++S+M WYLALE+GKF FPAQV+NRENGH+GF+LSCYDA LSYDP TDTF  RYPPHG
Sbjct  206   P-VNSIMSWYLALETGKFSFPAQVFNRENGHIGFILSCYDANLSYDPGTDTFQVRYPPHG  264

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A+AIE+GV W+RLRAP  D   HDLHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV
Sbjct  265   RRAIAIESGVLWERLRAPPFDTSPHDLHISDCLNDLRPGDHIEIQWRRNKEFPYGWWYGV  324

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLE+CDGN++YCRCH  DTVVLEF+QY+PGSRWR T V+RK+HREEG+EA+GFYGGI+
Sbjct  325   VGHLESCDGNENYCRCHNSDTVVLEFHQYTPGSRWRSTAVNRKEHREEGDEADGFYGGIR  384

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ + E IS WKRLWP +VLE
Sbjct  385   KLYNNEEISRWKRLWPTEVLE  405



>ref|XP_007141515.1| hypothetical protein PHAVU_008G202600g [Phaseolus vulgaris]
 gb|ESW13509.1| hypothetical protein PHAVU_008G202600g [Phaseolus vulgaris]
Length=399

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/388 (62%), Positives = 291/388 (75%), Gaps = 17/388 (4%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLLFRLWKDL---SLLTLVRKNLF----SLIPLRMLAMRSKPGGC  744
             L+ K +P+WA E RL   F  +KDL   S+  L R + +      IP RM  ++      
Sbjct  19    LSLKPLPSWAGELRLISPF-FYKDLLVKSISKLFRGHFWLGFPCPIPTRMSLVKKT---L  74

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             +   + VE +   MSVLDLPDLVLECILEK+PP  LC +ASVC SLRERC+SDHLWERH+
Sbjct  75    TSKVESVEDS-QNMSVLDLPDLVLECILEKLPPAPLCQMASVCRSLRERCVSDHLWERHM  133

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVI---VGPNLGA  1095
             KQKWG +IG AAYREW+WH+A + +       K++ L S +S  WP S +   V  N   
Sbjct  134   KQKWGRVIGEAAYREWKWHVASKGNVGTLRHGKQRSLMSLVSLHWPFSWMRTKVDTN-NT  192

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
             G + + LPP DS M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP+TDTF 
Sbjct  193   GKQSSYLPP-DSFMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPQTDTFQ  251

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR A+A+E G+ W+RLRAP VD   HDLH+SDCL+DL PGDH+EIQWRRNK+FP
Sbjct  252   ARYPPHGRRAIAVEHGIPWERLRAPPVDTSPHDLHVSDCLHDLHPGDHVEIQWRRNKEFP  311

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE CDGN+ YCRCH  D VVLEFNQY+P SRWR+TT+SRKDHREEGNEA+
Sbjct  312   YGWWYGVVGHLELCDGNESYCRCHSGDMVVLEFNQYTPDSRWRKTTISRKDHREEGNEAD  371

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K++S   IS WK +WP+++L+
Sbjct  372   GFYGGIRKLKSEAEISLWKSIWPSEILD  399



>ref|XP_010673781.1| PREDICTED: F-box protein At2g32560 [Beta vulgaris subsp. vulgaris]
Length=397

 Score =   484 bits (1247),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/384 (62%), Positives = 293/384 (76%), Gaps = 6/384 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL---VRKNLFSLIPLRMLAMRSKPGGCSK  750
              SL+ K +P WAS+ RL L    WK+LS   +   ++K +F L       M  K    S 
Sbjct  16    NSLSLKPLPPWASDVRL-LPLCFWKELSFSPICKTLKKEIFGLFWGFPSIMAIKKSSSSS  74

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
               D+V+    Q+SVLDLP+L L+CILEK+ P GLC +++VC+SLRERC+SDHLW RH+K 
Sbjct  75    KFDNVQDN-GQLSVLDLPELALDCILEKLSPAGLCSMSAVCTSLRERCISDHLWGRHMKH  133

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGP-NLGAGDKR  1107
             KWG I+GPAAYREWQW IA R++S   +  K +GL  ++  +WPL+      +    +  
Sbjct  134   KWGRILGPAAYREWQWFIACRRNSTASSGKKSQGLIKFIWHVWPLTWFTSRFDKSNSNND  193

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
             +N P +D+VM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP+TDTF ARYP
Sbjct  194   SNSPLVDTVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPQTDTFQARYP  253

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR AVAIE+G+ W+RLRA  VD P HDLH SDCL DL+PGDHIEIQWRRNK+FPYGWW
Sbjct  254   PHGRRAVAIESGIQWERLRAAPVDTPPHDLHASDCLNDLQPGDHIEIQWRRNKEFPYGWW  313

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLE+CDG+++YCRCH  DTV+LEFNQY+PGSRWRRT V+RKDHREEGNE++GFYG
Sbjct  314   YGVVGHLESCDGDENYCRCHSSDTVLLEFNQYTPGSRWRRTIVNRKDHREEGNESDGFYG  373

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K+     I+TWK LWP ++LE
Sbjct  374   GIRKLRKSNEIATWKSLWPREILE  397



>ref|XP_010088960.1| F-box protein [Morus notabilis]
 gb|EXB37175.1| F-box protein [Morus notabilis]
Length=338

 Score =   482 bits (1240),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 265/329 (81%), Gaps = 4/329 (1%)
 Frame = +1

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             SK ++  + T  + SVLDLP+L L+CILE++PP+ LC +A VC+SLRERCMSD LWE+H+
Sbjct  10    SKVENVEDNTEEKTSVLDLPELALDCILERLPPDALCSMAGVCTSLRERCMSDRLWEKHM  69

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGP----NLG  1092
              QKWG IIG AAYREWQW IA + D     Q K+KGL   LS  WP S I       N  
Sbjct  70    NQKWGNIIGQAAYREWQWQIASKADLGNLKQGKQKGLMRILSLNWPFSWIRSKVDDYNNS  129

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             +  K  +  P+DS+M WYLALE+GKF FPAQVYNRENGHVGFMLSCYDA++SYDPRTDTF
Sbjct  130   SSTKPRSPLPVDSIMAWYLALETGKFCFPAQVYNRENGHVGFMLSCYDAQISYDPRTDTF  189

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              ARYPPHGR AVAIE+GV W+RLRAP VD P HDLHISDCL++LRPGDHIEIQWRRNK+F
Sbjct  190   QARYPPHGRRAVAIESGVPWERLRAPPVDTPPHDLHISDCLHELRPGDHIEIQWRRNKEF  249

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYGVVGHLE+CD N++YCRCH+ DT+VLEFNQY+PGSRWR TTV+RKDHREEGNE 
Sbjct  250   PYGWWYGVVGHLESCDRNENYCRCHDSDTLVLEFNQYTPGSRWRHTTVNRKDHREEGNEV  309

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +GFYGGI+K+ + E I TW++LWP + LE
Sbjct  310   DGFYGGIRKLNTEEEILTWRQLWPTETLE  338



>ref|XP_010031705.1| PREDICTED: F-box protein At2g26850 [Eucalyptus grandis]
 gb|KCW51069.1| hypothetical protein EUGRSUZ_J00678 [Eucalyptus grandis]
Length=395

 Score =   483 bits (1243),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 283/382 (74%), Gaps = 5/382 (1%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLF--RLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKA  753
             KSL    +P WASE  L  L+  R +    + +L+     S IP     M  K    S  
Sbjct  17    KSLPLNSLPLWASEMTLLSLWSHREFSAFCISSLMNSFYRSFIPRTCSKMSIKKINLSSR  76

Query  754   DDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
              D+VE  + + SVLDLP+LVLECILEK+PP  L ++A VCSSLR RC+SDHLWERH++QK
Sbjct  77    VDNVE--IGEKSVLDLPELVLECILEKLPPAELFNMAGVCSSLRNRCVSDHLWERHMRQK  134

Query  934   WGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             WG +IGPAAYR+W+W+IA R+D     Q K+ GL   L  +WPLS      L   +K+  
Sbjct  135   WGRVIGPAAYRQWKWYIATRRDIGNLKQGKQSGLARLLIAVWPLS-WTNSKLDNSEKQRI  193

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
               P DS+M WYLALE+GKF FPAQVYNRENGHVGFMLSCYDAELSYD +TDTF ARYPPH
Sbjct  194   PLPTDSIMSWYLALETGKFCFPAQVYNRENGHVGFMLSCYDAELSYDSQTDTFQARYPPH  253

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR A AIE+ VTWDRLRA  VD P HDLHISDCL DL+PGDHIEIQWRRN++FPYGWWYG
Sbjct  254   GRRAGAIESNVTWDRLRAQPVDAPPHDLHISDCLNDLQPGDHIEIQWRRNEEFPYGWWYG  313

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
              VGHLE+CDGN +YCRCH  DTV+LEF QY+PGSRWR T ++R++HREEGNEA+GFYGGI
Sbjct  314   AVGHLESCDGNANYCRCHNSDTVMLEFRQYAPGSRWRHTAINRRNHREEGNEADGFYGGI  373

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+++   IS WK LWP +VLE
Sbjct  374   RKLKTEREISMWKSLWPTEVLE  395



>ref|XP_003617213.1| F-box family protein [Medicago truncatula]
 gb|AET00172.1| F-box plant-like protein [Medicago truncatula]
Length=399

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 231/379 (61%), Positives = 282/379 (74%), Gaps = 13/379 (3%)
 Frame = +1

Query  607   TWASEFRL-QLLFRLWKDL---SLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETT  774
             +W +E RL  LLF   KD    S   L RK L S + L    + SK       ++ V++ 
Sbjct  26    SWTNEVRLISLLFH--KDFCLKSFCKLFRKTLVSRMSLVKKTLVSK---VENVEEEVDSL  80

Query  775   VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGP  954
                +SVLDLP+LVLECILEK+PP  LC +A VC SLRERC+SDHLWERH+KQKWG +IG 
Sbjct  81    QQNLSVLDLPELVLECILEKLPPSSLCQMAGVCHSLRERCVSDHLWERHMKQKWGRVIGS  140

Query  955   AAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS----VIVGPNLGAGDKRNNLPP  1122
              AYREW+WH+A +K+       K + L  ++S  WP S     +      + +K+N+  P
Sbjct  141   VAYREWKWHVATKKNIGSLRHGKPRSLIKFMSLYWPFSWMRMKVDAAYSNSANKQNSYLP  200

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
              DS M WYLALE+G F FPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR 
Sbjct  201   PDSFMTWYLALETGNFSFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGRR  260

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A A+E G+ W+RLRAP VD P HDLHI++CL+DL  GDHIEIQWRRNK FPYGWWYG+VG
Sbjct  261   AAAVEHGIPWERLRAPPVDTPPHDLHITECLHDLHAGDHIEIQWRRNKDFPYGWWYGIVG  320

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             HLE+CDGN++YCRCH  DTVVLEFNQY+  SRWRRTT++RKDHREEGNEA+GFYGG++K+
Sbjct  321   HLESCDGNENYCRCHNSDTVVLEFNQYTSDSRWRRTTINRKDHREEGNEADGFYGGVRKI  380

Query  1663  ESREVISTWKRLWPAQVLE  1719
             ++ + IS WK LWP++VL+
Sbjct  381   KNEKEISIWKGLWPSEVLD  399



>ref|XP_006446321.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
 gb|ESR59561.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
Length=405

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 295/393 (75%), Gaps = 21/393 (5%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSL----IPLRMLAMRSKPGGC  744
             LA K +P WA    L+LL    WK++S  ++    KN  ++    IP   L+ +      
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHM---M  75

Query  745   SKADDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
             S ++DHVE     ++MSVLDL +LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+
Sbjct  76    STSNDHVEEVSGGAEMSVLDLHELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEK  135

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEK---GLGSYL-SRLWPLSVIVGPN  1086
             H+KQKWG I+GPAAYREWQWH+A RKDS    Q K++    L S++ S  W  S +   +
Sbjct  136   HMKQKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTS  195

Query  1087  LGAGDKRNNLPPIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  1260
                   R    P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  
Sbjct  196   KQTTTTR---LPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQS  252

Query  1261  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  1440
             TDTF ARYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRR
Sbjct  253   TDTFQARYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRR  312

Query  1441  NKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREE  1620
             NK+FPYGWWYGVVGHLE+CDGN+++C CH  +T++LEFNQY+PGSRWR+TT++RKDHREE
Sbjct  313   NKEFPYGWWYGVVGHLESCDGNENFCHCHNSETLILEFNQYTPGSRWRKTTINRKDHREE  372

Query  1621  GNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GNEA+GFYGGI+KV + E I  WKRLWP +VLE
Sbjct  373   GNEADGFYGGIRKVNNEEEIKMWKRLWPVEVLE  405



>ref|XP_003545428.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=397

 Score =   482 bits (1240),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 237/378 (63%), Positives = 282/378 (75%), Gaps = 15/378 (4%)
 Frame = +1

Query  610   WASEFRLQLLFRLWKDLSLLT---LVRKNL----FSLIPLRMLAMRSKPGGCSKADDHVE  768
             WASE RL +    +KDLS+ +   L R  L       IP RM  M+      S   +++E
Sbjct  27    WASELRL-ISPLFYKDLSVKSISKLFRNRLWLGFLCQIPTRMSLMKK-----SSKVENIE  80

Query  769   TTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGII  948
              +   MSVLDLP+LVLECILEK+PP  LC +A VC SLRE C+SDHLWERH+KQKWG II
Sbjct  81    DS-QDMSVLDLPELVLECILEKLPPASLCQMAGVCRSLRESCVSDHLWERHMKQKWGRII  139

Query  949   GPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS-VIVGPNLGAGDKRNNLPPI  1125
             G AAYREW+WH+A + +       K++ L   +S  WP S +    +     K+ +  P 
Sbjct  140   GQAAYREWKWHVASKGNVGTLRHGKQRSLLRLVSLSWPFSWMRTKVDANNSIKQQSYLPP  199

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
             DS+M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP  DTF ARYPPHGR  
Sbjct  200   DSLMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPHNDTFQARYPPHGRRT  259

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  1485
             VA+E G+ W+RLRAP VD P HDLHISDC+YDL PGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  260   VAVEHGIPWERLRAPPVDTPPHDLHISDCVYDLHPGDHIEIQWRRNKEFPYGWWYGVVGH  319

Query  1486  LETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
             LE CDGN++YCRCH  DTVVLEFNQY+P SRWR+TT+SRKDHREEGNEA+GFYGGI+K++
Sbjct  320   LELCDGNENYCRCHSSDTVVLEFNQYTPDSRWRKTTISRKDHREEGNEADGFYGGIRKIK  379

Query  1666  SREVISTWKRLWPAQVLE  1719
             S   IS WK +WP++VL+
Sbjct  380   SETEISIWKSIWPSEVLD  397



>ref|XP_011024991.1| PREDICTED: F-box protein At2g32560-like [Populus euphratica]
Length=405

 Score =   481 bits (1239),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 237/381 (62%), Positives = 283/381 (74%), Gaps = 13/381 (3%)
 Frame = +1

Query  610   WASEFRLQLLFRLWKDLSLL--------TLVRKNLFSLIPLRMLAMRSKPGGCSKAD-DH  762
             W SE RL L F   KDL L         TL++      IPL+M       G  ++A    
Sbjct  27    WTSEMRL-LSFWFLKDLLLFSYLGSLRSTLLKVFHIDRIPLKMTIKNMSLGSSARAKKSS  85

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             ++  V  MSVLDLP+L LECILE++PP GLC +A VC+SLRERC+SDHLWE+H+KQKWG 
Sbjct  86    LDGEVGGMSVLDLPELALECILERLPPAGLCSMAGVCTSLRERCVSDHLWEKHMKQKWGR  145

Query  943   IIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS--VIVGPNLGAGDKRNNL  1116
             +IGPAA REWQWH+A RK+     Q K KG    LS  WP S        +    +R++L
Sbjct  146   VIGPAASREWQWHVASRKNLGSCKQGKPKGFTRLLSMFWPSSWSTPKADPINNSKQRSSL  205

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
             P ++S+M WYLALE+GKF FPAQV+NRENGH+GF+LSCYDA LSYDP TDTF  RYPPHG
Sbjct  206   P-VNSIMSWYLALETGKFSFPAQVFNRENGHIGFILSCYDANLSYDPGTDTFQVRYPPHG  264

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A+A E+GV W+RLRAP  D   HDLHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV
Sbjct  265   RRAIATESGVLWERLRAPPFDTSPHDLHISDCLNDLRPGDHIEIQWRRNKEFPYGWWYGV  324

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLE+CDGN++YCRCH  DTVVLEF+QY+PGSRWR T V+RK+HREEG+EA+GFYGGI+
Sbjct  325   VGHLESCDGNENYCRCHNRDTVVLEFHQYTPGSRWRSTAVNRKEHREEGDEADGFYGGIR  384

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ + E IS WKRLWP +VLE
Sbjct  385   KLYNNEEISRWKRLWPTEVLE  405



>ref|XP_004140188.1| PREDICTED: F-box protein At2g32560 [Cucumis sativus]
 gb|KGN48086.1| hypothetical protein Csa_6G430140 [Cucumis sativus]
Length=396

 Score =   480 bits (1236),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 233/383 (61%), Positives = 278/383 (73%), Gaps = 6/383 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL---VRKNLFSLIPLRMLAMRSKPGGCSK  750
             KSL+ K +P WA E R  L    WK+LS   +   ++ +L +        M  K    SK
Sbjct  17    KSLSLKPLPLWADEMRF-LSHWFWKELSFFPIYKVIKNSLCTYTFCISSKMSFKKKYLSK  75

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
              ++  E+   +MSVLDLP+L LECILEK+PP+ LC +A VCSSLRERC+SDHLWE+H+K+
Sbjct  76    VENVEES--GEMSVLDLPELALECILEKLPPDALCSMAGVCSSLRERCISDHLWEKHMKR  133

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             KWG +IG AAYREWQWH+A R       Q K+K L    S  W LS I        +   
Sbjct  134   KWGKVIGQAAYREWQWHLASRAGESNLKQNKQKSLIRLFSFGWSLSWIRSKVNENSNTPR  193

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
                P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPP
Sbjct  194   TFLPVDSIMAWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDLRTDTFQARYPP  253

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR A+AIE GV W+RLR+P +D P HDLH+SDCL +L PGDHIEIQWR+NK FPYGWWY
Sbjct  254   HGRRAIAIENGVQWERLRSPPIDTPPHDLHVSDCLNELWPGDHIEIQWRKNKDFPYGWWY  313

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GVVGHLETCDG+ ++C CH  DTVVLEFNQY+PGSRWR   + RKDHREEGNE +GFYGG
Sbjct  314   GVVGHLETCDGDANHCSCHYSDTVVLEFNQYTPGSRWRLAIIDRKDHREEGNEVDGFYGG  373

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+ S E IS WK+LWP  +LE
Sbjct  374   IRKLYSNEEISMWKQLWPTDILE  396



>ref|XP_002298461.1| hypothetical protein POPTR_0001s28050g [Populus trichocarpa]
 gb|EEE83266.1| hypothetical protein POPTR_0001s28050g [Populus trichocarpa]
Length=368

 Score =   477 bits (1228),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 223/317 (70%), Positives = 259/317 (82%), Gaps = 3/317 (1%)
 Frame = +1

Query  775   VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGP  954
               +MSVLDLP+L LECILE++PP GLC +A VC+SLRERC+SDHLWE+H+KQKWG +IGP
Sbjct  53    TGEMSVLDLPELALECILERLPPAGLCSMAGVCTSLRERCVSDHLWEKHMKQKWGRVIGP  112

Query  955   AAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWP--LSVIVGPNLGAGDKRNNLPPID  1128
             AAYREWQWH+A RKD     Q K KGL   LS  WP   S      +    +R++LP ++
Sbjct  113   AAYREWQWHLASRKDLGSCKQGKPKGLTRLLSMFWPSSWSTPKADPINNSKQRSSLP-VN  171

Query  1129  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  1308
             S+M WYLALE+GKFWFPAQV+NRENGHVGFMLSCYDA LSYDP TDTF  RYPPHGR A+
Sbjct  172   SIMSWYLALETGKFWFPAQVFNRENGHVGFMLSCYDANLSYDPGTDTFQVRYPPHGRRAI  231

Query  1309  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  1488
             A E+GV W+RLRAP  D   HDLHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGVVGHL
Sbjct  232   ATESGVPWERLRAPPFDTSPHDLHISDCLNDLRPGDHIEIQWRRNKEFPYGWWYGVVGHL  291

Query  1489  ETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVES  1668
             E CDGN++YCRCH  DTVVLEF+QY+PGSRWR T V+RK+HREEG+EA+GFYGGI+K+ +
Sbjct  292   ELCDGNENYCRCHNSDTVVLEFHQYTPGSRWRSTAVNRKEHREEGDEADGFYGGIRKLYN  351

Query  1669  REVISTWKRLWPAQVLE  1719
              E IS WKRLWP +VLE
Sbjct  352   NEEISRWKRLWPTEVLE  368



>ref|XP_004491223.1| PREDICTED: F-box protein At2g26850-like [Cicer arietinum]
Length=400

 Score =   478 bits (1229),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 236/384 (61%), Positives = 286/384 (74%), Gaps = 12/384 (3%)
 Frame = +1

Query  592   FKLVPTWASEFRL-QLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVE  768
              K +PTW +E RL  LLF   KD+  +  + K   +   + +L     P   S+ +D VE
Sbjct  21    IKPLPTWTNEVRLISLLFH--KDMLCVKSITKLFRNKFLVGLLC--QIPTRLSQKNDVVE  76

Query  769   TT--VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
                 VSQ  +LDLP+LVLECILEK+PP  LC +A+VC SLRERC+SDHLWERH+K KWG 
Sbjct  77    ENKDVSQQDLLDLPELVLECILEKLPPSSLCQMANVCHSLRERCVSDHLWERHMKNKWGR  136

Query  943   IIGPAAYREWQWHIALRKDSRLFNQ--AKEKGLGSYLSRL-WPLSVIVGPNLG--AGDKR  1107
             +IG  AYREW+WH+A + +    N+   K++ L  ++S L WP S  +   +   +  K+
Sbjct  137   VIGSVAYREWKWHVASKNNVGSLNRHHGKQRSLIKFMSSLHWPFSWFMRMKVDNKSVKKQ  196

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
             + L P DS M  YLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP TDTF ARYP
Sbjct  197   SYLQPPDSFMTLYLALENGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPNTDTFQARYP  256

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR A+A E G+ W+RLRAP VD P HDLHISDCL+DL PGDHIEIQWRRNK FPYGWW
Sbjct  257   PHGRRAIAAEHGIQWERLRAPPVDTPPHDLHISDCLHDLHPGDHIEIQWRRNKDFPYGWW  316

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YG+VGHLE+CDGN++YC CH  DTV+LEFNQY+ GSRWRRT +SRKDHREEGNEA+GFYG
Sbjct  317   YGIVGHLESCDGNENYCSCHNSDTVILEFNQYTSGSRWRRTAISRKDHREEGNEADGFYG  376

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+KV+S   IS WK LWP++VL+
Sbjct  377   GIRKVKSESEISIWKSLWPSEVLD  400



>gb|KJB55450.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=395

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 245/388 (63%), Positives = 285/388 (73%), Gaps = 17/388 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRL-QLLFRLWKDLSLLTLVR--KNLFSLIPLRMLAMR---SKPGG  741
             KSL  K  P WA+E RL    FR  KD+S     R  KN+  L     +  +    K   
Sbjct  17    KSLTLKPPPPWAAEMRLLSPWFR--KDVSFFLSSRLIKNILGLAYFTTVVSKMSLKKMSF  74

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
              SK D+  E   S MS+LDLPDLVLECILE++PP  LC +A VCSSLR RC+SDH WE+H
Sbjct  75    TSKVDNFEEVEESAMSILDLPDLVLECILERLPPAALCSMAGVCSSLRSRCISDHFWEKH  134

Query  922   LKQKWGGIIGPAAYREWQWHIALR--KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +K+KWG IIGPAAYREWQWHIALR  KDS    Q K KGL   LS + P S  +   +  
Sbjct  135   MKKKWGRIIGPAAYREWQWHIALRTRKDSSHLMQGKPKGLMRVLSIVRP-SWWIKSKVDD  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               K+ +LP  DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF 
Sbjct  194   SSKQCSLPD-DSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFK  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDGN +YCRCH       EFNQY+ GSRWRR T++RK+HREEGNEA+
Sbjct  313   YGWWYGVVGHLESCDGNDNYCRCHNS-----EFNQYTAGSRWRRATINRKEHREEGNEAD  367

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ + E ISTWKRLWP+++LE
Sbjct  368   GFYGGIRKLCNEEEISTWKRLWPSEILE  395



>ref|XP_006470522.1| PREDICTED: F-box protein At2g32560-like [Citrus sinensis]
Length=405

 Score =   475 bits (1223),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 240/393 (61%), Positives = 293/393 (75%), Gaps = 21/393 (5%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSL----IPLRMLAMRSKPGGC  744
             LA K +P WA    L+LL    WK++S  ++    KN  ++    IP   L+ +      
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHM---M  75

Query  745   SKADDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
             S ++D VE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+
Sbjct  76    STSNDRVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEK  135

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEK---GLGSYL-SRLWPLSVIVGPN  1086
             H+KQKWG I+GPAAYREWQWH+A  KDS    Q K++    L S++ S  W  S +   +
Sbjct  136   HMKQKWGRIVGPAAYREWQWHLASGKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTS  195

Query  1087  LGAGDKRNNLPPIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  1260
                   R    P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYD  
Sbjct  196   KQTTTTR---LPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFILSCYDAELSYDQS  252

Query  1261  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  1440
             TDTF ARYPPHGR  +AIE GV  +RLRA  VD   HDLHISDCL DL PGDHIEIQWRR
Sbjct  253   TDTFQARYPPHGRRPIAIECGVPRERLRAAAVDTSPHDLHISDCLNDLHPGDHIEIQWRR  312

Query  1441  NKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREE  1620
             NK+FPYGWWYGVVGHLE+CDGN+++C CH  +T++LEFNQY+PGSRWR+TT++RKDHREE
Sbjct  313   NKEFPYGWWYGVVGHLESCDGNENFCHCHNSETLILEFNQYTPGSRWRKTTINRKDHREE  372

Query  1621  GNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GNEA+GFYGGI+KV + E I  WKRLWP +VLE
Sbjct  373   GNEADGFYGGIRKVNNEEEIKMWKRLWPVEVLE  405



>gb|KHN11010.1| F-box protein [Glycine soja]
Length=328

 Score =   472 bits (1214),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 217/313 (69%), Positives = 253/313 (81%), Gaps = 1/313 (0%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MSVLDLP+LVLECILEK+PP  LC +A VC SLRE C+SDHLWERH+KQKWG IIG AAY
Sbjct  16    MSVLDLPELVLECILEKLPPASLCQMAGVCRSLRESCVSDHLWERHMKQKWGRIIGQAAY  75

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS-VIVGPNLGAGDKRNNLPPIDSVMF  1140
             REW+WH+A + +       K++ L   +S  WP S +    +     K+ +  P DS+M 
Sbjct  76    REWKWHVASKGNVGTLRHGKQRSLLRLVSLSWPFSWMRTKVDANNSIKQQSYLPPDSLMT  135

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
             WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP  DTF ARYPPHGR  VA+E 
Sbjct  136   WYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPHNDTFQARYPPHGRRTVAVEH  195

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCD  1500
             G+ W+RLRAP VD P HDLHISDC+YDL PGDHIEIQWRRNK+FPYGWWYGVVGHLE CD
Sbjct  196   GIPWERLRAPPVDTPPHDLHISDCVYDLHPGDHIEIQWRRNKEFPYGWWYGVVGHLELCD  255

Query  1501  GNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVI  1680
             GN++YCRCH  DTVVLEFNQY+P SRWR+TT+SRKDHREEGNEA+GFYGGI+K++S   I
Sbjct  256   GNENYCRCHSSDTVVLEFNQYTPDSRWRKTTISRKDHREEGNEADGFYGGIRKIKSETEI  315

Query  1681  STWKRLWPAQVLE  1719
             S WK +WP++VL+
Sbjct  316   SIWKSIWPSEVLD  328



>gb|KDP43182.1| hypothetical protein JCGZ_22734 [Jatropha curcas]
Length=338

 Score =   472 bits (1215),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 217/319 (68%), Positives = 260/319 (82%), Gaps = 0/319 (0%)
 Frame = +1

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             V+    +++ LDLPDL L+CILE++PP GLC +A VC+SLRERC+S+HLWERH+KQKWG 
Sbjct  20    VDDETGEITFLDLPDLTLDCILERLPPAGLCSMAGVCTSLRERCISNHLWERHMKQKWGK  79

Query  943   IIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPP  1122
             IIGPAAYR+WQ++IA  KD     Q K+K L   LS + P S +         K+ +  P
Sbjct  80    IIGPAAYRKWQFNIAASKDFDNCKQGKQKKLMRLLSIVLPFSWMNSMEDDNNVKQKSSLP  139

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             +DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPRT+TF ARYPPHGR 
Sbjct  140   VDSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTNTFQARYPPHGRR  199

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A+AIETGV W+RLRAP +D   H LHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGVVG
Sbjct  200   AIAIETGVPWERLRAPPIDTSPHHLHISDCLNDLRPGDHIEIQWRRNKEFPYGWWYGVVG  259

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             HLE CDGN++YCRCH  DT+VLEF+QY+ GSRWR T ++RK+HREEGNEA+GFYGGI+K+
Sbjct  260   HLEPCDGNENYCRCHNSDTIVLEFHQYTRGSRWRCTMINRKEHREEGNEADGFYGGIRKL  319

Query  1663  ESREVISTWKRLWPAQVLE  1719
              + E IS WK+LWP +VLE
Sbjct  320   NANEEISRWKQLWPTEVLE  338



>ref|XP_003556934.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=399

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 233/379 (61%), Positives = 289/379 (76%), Gaps = 14/379 (4%)
 Frame = +1

Query  610   WASEFRL-QLLFRLWKDLSLLTLVRKNLFSL-----IPLRMLAMRSKPGGCSKADDHVET  771
             WASE  L  LLF     +S ++ + +N F +     IP+ M  +R      +   ++VE 
Sbjct  26    WASEMWLFPLLFSQEFSMSTISKLFRNRFWIGFLCQIPIGMSLVRK---SLTSRVENVEE  82

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
             ++  MSVLDLP+L L+CILE++PP  LC +A+VC +LRERC+SDHLWE+H+++KWG +IG
Sbjct  83    SL-DMSVLDLPELALDCILERLPPSSLCRIAAVCRTLRERCVSDHLWEKHMRKKWGRVIG  141

Query  952   PAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVI---VGPNLGAGDKRNNLPP  1122
             PAAYREW+WH+A +++       ++KGL  ++S  WP   I   V  N      R++LP 
Sbjct  142   PAAYREWKWHVASKRNVGGLKHGRQKGLMRFMSLHWPFQWIRPKVDANYNNPKLRSSLP-  200

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             +DSVM WYLALESG FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR 
Sbjct  201   VDSVMNWYLALESGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGRR  260

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A A E G+ W+RLRAP +D   HDLH+SDCL DL PGDHIEIQWRRNK+FPYGWWYGVVG
Sbjct  261   ADARECGIPWERLRAPPIDTSPHDLHVSDCLNDLYPGDHIEIQWRRNKEFPYGWWYGVVG  320

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             HLE+C+G+++YCRCH  DTVVLEFN Y+PGSRWR TTVSRKDHREEGNEA+GFYGGI+K+
Sbjct  321   HLESCNGSENYCRCHSSDTVVLEFNHYTPGSRWRLTTVSRKDHREEGNEADGFYGGIRKI  380

Query  1663  ESREVISTWKRLWPAQVLE  1719
              S   I+TWK LWP++VL+
Sbjct  381   TSEAEIATWKCLWPSEVLD  399



>ref|XP_008359220.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Malus domestica]
Length=335

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 263/335 (79%), Gaps = 2/335 (1%)
 Frame = +1

Query  715   LAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERC  894
             L  R+     SK ++  +T   +MSVLDLP+LVLECIL K+PP+ L  +  VCSSLRERC
Sbjct  3     LVRRTLSLSSSKVENVDDT--PEMSVLDLPELVLECILXKLPPDALFQMTGVCSSLRERC  60

Query  895   MSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVI  1074
              SDHLWE+H+K KWG +IGPAA REWQ HIA + D     Q K+KGL   LS  WP S I
Sbjct  61    RSDHLWEKHMKMKWGRVIGPAAXREWQCHIASKTDLIDVKQGKQKGLMRILSLGWPFSWI  120

Query  1075  VGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD  1254
                    G K+ +  P DS+M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYD
Sbjct  121   RSKVDDHGTKQRSSLPADSIMSWYLALETGRFWFPAQVYNRENGHVGFVLSCYDAELSYD  180

Query  1255  PRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQW  1434
             PRTDTF ARYPPHGR AVAIE GV W+RLRAP VD P HDLH+SDCL +LRPGDHIEIQW
Sbjct  181   PRTDTFQARYPPHGRRAVAIEKGVPWERLRAPPVDTPPHDLHVSDCLNELRPGDHIEIQW  240

Query  1435  RRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHR  1614
             RRNK+FPYGWWYGVVGHLE+CDGN++YC CH  DTVVLEFNQY+ GSRWR T +SR+DHR
Sbjct  241   RRNKEFPYGWWYGVVGHLESCDGNENYCLCHXSDTVVLEFNQYTHGSRWRCTNISRRDHR  300

Query  1615  EEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             EEGNEA+GFYGGI+ + S++ IS WK +WP QVLE
Sbjct  301   EEGNEABGFYGGIRMLRSKQEISMWKLIWPTQVLE  335



>gb|KHN27365.1| F-box protein [Glycine soja]
Length=399

 Score =   473 bits (1218),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 233/379 (61%), Positives = 288/379 (76%), Gaps = 14/379 (4%)
 Frame = +1

Query  610   WASEFRL-QLLFRLWKDLSLLTLVRKNLFSL-----IPLRMLAMRSKPGGCSKADDHVET  771
             WASE  L  LLF     +S ++ + +N F +     IP+ M  +R      +   ++VE 
Sbjct  26    WASEMWLFPLLFSQEFSMSTISKLFRNRFWIGFLCQIPIGMSLVRK---SLTSRVENVEE  82

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
             ++  MSVLDLP+L L+CILE++PP  LC +A+VC +LRERC+SDHLWE+H+++KWG +IG
Sbjct  83    SL-DMSVLDLPELALDCILERLPPSSLCRIAAVCRTLRERCVSDHLWEKHMRKKWGRVIG  141

Query  952   PAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVI---VGPNLGAGDKRNNLPP  1122
             PAAYREW+WH+A +++       ++KGL  ++S  WP   I   V  N      R++LP 
Sbjct  142   PAAYREWKWHVASKRNVGGLKHGRQKGLMRFMSLHWPFQWIRPKVDANYNNPKLRSSLP-  200

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             +DSVM WYLALESG FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR 
Sbjct  201   VDSVMNWYLALESGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGRR  260

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A A E G+ W+RLRAP +D   HDLH SDCL DL PGDHIEIQWRRNK+FPYGWWYGVVG
Sbjct  261   ADARECGIPWERLRAPPIDTSPHDLHFSDCLNDLYPGDHIEIQWRRNKEFPYGWWYGVVG  320

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             HLE+C+G+++YCRCH  DTVVLEFN Y+PGSRWR TTVSRKDHREEGNEA+GFYGGI+K+
Sbjct  321   HLESCNGSENYCRCHSSDTVVLEFNHYTPGSRWRLTTVSRKDHREEGNEADGFYGGIRKI  380

Query  1663  ESREVISTWKRLWPAQVLE  1719
              S   I+TWK LWP++VL+
Sbjct  381   TSEAEIATWKCLWPSEVLD  399



>gb|KHN28192.1| F-box protein [Glycine soja]
Length=399

 Score =   471 bits (1211),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 234/384 (61%), Positives = 290/384 (76%), Gaps = 24/384 (6%)
 Frame = +1

Query  610   WASEFRL-QLLFRLWKDLSLLTLVR--KNLFSL-----IPLRMLAMRSKPGGCSKADDHV  765
             WASE  L  LLF   ++LS+ T+ +  +N F +     IP+ M  +R      +   ++V
Sbjct  26    WASEMWLFPLLFS--QELSVRTISKLFRNCFWIGFLCQIPIGMSLVRKS---LTSRVENV  80

Query  766   ETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGI  945
             E ++  MSVLDLP+L L+CILE++PP  LC +A+VC SLRERC+SDHLWERH++QKWG +
Sbjct  81    EESLD-MSVLDLPELALDCILERLPPSALCRMAAVCRSLRERCVSDHLWERHMRQKWGRV  139

Query  946   IGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP--  1119
             IGPAAYREW+WH+A +++       ++KGL  ++S  WPL  I        D  NN P  
Sbjct  140   IGPAAYREWKWHVASKRNVGGLKHGRQKGLMRFMSLRWPLQWI----RPKADANNNSPKQ  195

Query  1120  ----PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
                 P+DSVM WYLALESG FWF AQVYNRENGH+GF+LSCYDAELSYDP+TDTF ARYP
Sbjct  196   GSSLPVDSVMNWYLALESGNFWFLAQVYNRENGHIGFLLSCYDAELSYDPQTDTFQARYP  255

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR A A E G+ W+RLRAP +D   HDLH SDCL DL PGDHIEIQWRRNK+FPYGWW
Sbjct  256   PHGRRAGARECGIPWERLRAPPIDTSPHDLHFSDCLNDLYPGDHIEIQWRRNKEFPYGWW  315

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLE+C+G+++YCRCH  DTVVLEFN Y+PGS+WR+TT+SRKDHREEGNEA+GFYG
Sbjct  316   YGVVGHLESCNGSENYCRCHSSDTVVLEFNHYTPGSQWRQTTISRKDHREEGNEADGFYG  375

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K++S   I+TWK LWP +VLE
Sbjct  376   GIRKIKSEAEITTWKHLWPLEVLE  399



>ref|XP_003529497.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=399

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/384 (61%), Positives = 289/384 (75%), Gaps = 24/384 (6%)
 Frame = +1

Query  610   WASEFRL-QLLFRLWKDLSLLTLVR--KNLFSL-----IPLRMLAMRSKPGGCSKADDHV  765
             WASE  L  LLF   ++LS+ T+ +  +N F +     IP+ M  +R      +   ++V
Sbjct  26    WASEMWLFPLLFS--QELSVRTISKLFRNCFWIGFLCQIPIGMSLVRKS---LTSRVENV  80

Query  766   ETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGI  945
             E +   MSVLDLP+L L+CILE++PP  LC +A+VC SLRERC+SDHLWERH++QKWG +
Sbjct  81    EDS-HDMSVLDLPELALDCILERLPPSALCRMAAVCRSLRERCVSDHLWERHMRQKWGRV  139

Query  946   IGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP--  1119
             IGPAAYREW+WH+A +++       ++KGL  ++S  WPL  I        D  NN P  
Sbjct  140   IGPAAYREWKWHVASKRNVGGLKHGRQKGLMRFMSLRWPLQWI----RPKADANNNSPKQ  195

Query  1120  ----PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
                 P+DSVM WYLALESG FWF AQVYNRENGH+GF+LSCYDAELSYDP+TDTF ARYP
Sbjct  196   GSSLPVDSVMNWYLALESGNFWFLAQVYNRENGHIGFLLSCYDAELSYDPQTDTFQARYP  255

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR A A E G+ W+RLRAP +D   HDLH SDCL DL PGDHIEIQWRRNK+FPYGWW
Sbjct  256   PHGRRAGARECGIPWERLRAPPIDTSPHDLHFSDCLNDLYPGDHIEIQWRRNKEFPYGWW  315

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLE+C+G+++YCRCH  DTVVLEFN Y+PGS+WR+TT+SRKDHREEGNEA+GFYG
Sbjct  316   YGVVGHLESCNGSENYCRCHSSDTVVLEFNHYTPGSQWRQTTISRKDHREEGNEADGFYG  375

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K++S   I+TWK LWP +VLE
Sbjct  376   GIRKIKSEAEITTWKHLWPLEVLE  399



>ref|XP_010271792.1| PREDICTED: F-box protein At2g32560-like [Nelumbo nucifera]
Length=392

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/382 (61%), Positives = 276/382 (72%), Gaps = 7/382 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADD  759
             KSL+ K +P WAS+ +L L    W++ S   +       L      +  S P     A  
Sbjct  16    KSLSLKPLPPWASKLKL-LSIWFWQEFSSFLVSWSRESKLTGSFFQSPASMPMNKRPASL  74

Query  760   HVETT--VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
              +E      +MS+LDLP+L LECIL K+PP GLC +A VC SLR+RC S+HLWE H+K+K
Sbjct  75    KLEIVEETPEMSILDLPELALECILGKLPPSGLCRMAGVCRSLRDRCRSNHLWESHMKKK  134

Query  934   WGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             WGG+I  AAYREWQWHIA  KD     + K+K L   LS +      +       DK  +
Sbjct  135   WGGVIDRAAYREWQWHIASMKDVSAPRKTKKKSLVMSLSCM----CSIPWARSKYDKPRS  190

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
               P+DS+M WYLALESGKFWFPAQVYNRE+GHVGFMLSCYDAELSYD RTDTF+ARYPPH
Sbjct  191   SLPVDSIMSWYLALESGKFWFPAQVYNREHGHVGFMLSCYDAELSYDSRTDTFYARYPPH  250

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR    IE GV WDR+RAP VD P HDLH+SDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  251   GRRTAVIEDGVQWDRIRAPPVDTPPHDLHVSDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  310

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             VVGHLE+CD N+++C C   DTVVLEFNQY+ GSRWR+TT+SRKDHREEGNEA+GFYGGI
Sbjct  311   VVGHLESCDRNENHCLCSYSDTVVLEFNQYTHGSRWRQTTISRKDHREEGNEADGFYGGI  370

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+  +E ISTWKRLWP +VLE
Sbjct  371   RKLYCKEEISTWKRLWPKEVLE  392



>ref|XP_008798380.1| PREDICTED: F-box protein At2g32560-like [Phoenix dactylifera]
Length=398

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/382 (59%), Positives = 282/382 (74%), Gaps = 16/382 (4%)
 Frame = +1

Query  601   VPTWASEFRL-------QLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADD  759
             +P+WASE  L       + L+ L K L   +L    + S+        R  PG       
Sbjct  24    LPSWASEVTLLSNLFWKEFLYSLVKSLRNCSLAGARILSISSRMTSKRRCAPGV------  77

Query  760   HVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
              +E +  +MSVLDLP+L LECIL K+ P GLC++A+VCSSLR+RC SD+LWERH+K+KWG
Sbjct  78    EIEESSVEMSVLDLPELALECILGKLSPAGLCNMAAVCSSLRDRCRSDYLWERHMKEKWG  137

Query  940   GIIGPAAYREWQWHIALRKDSRL--FNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
              +IG  A+R+WQ + A RK S        K+K     LS +WPLS I    + +  K +N
Sbjct  138   RVIGGVAHRDWQLYTASRKVSSGGGVGSTKQKKWIGALSCVWPLSWIKS-RIESSSKPSN  196

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
               P DS+M WYL+LE+GKFWFPAQVYNRE+GHVGFMLSCYDAE+SYD  TDTFHARYPPH
Sbjct  197   PLPDDSIMSWYLSLENGKFWFPAQVYNREHGHVGFMLSCYDAEISYDCHTDTFHARYPPH  256

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR A+ IE G+ W+R+RAP VD PAHDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  257   GRRAIVIEEGLQWERIRAPPVDTPAHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  316

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             VVGHLETCDGN+H+CRCH  DT++LEF+QY+PGSRWR+ +++RKDHREEGNE +GFYGGI
Sbjct  317   VVGHLETCDGNEHFCRCHNNDTIILEFDQYTPGSRWRQASINRKDHREEGNETDGFYGGI  376

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+ S+  I+ WK++WP +VLE
Sbjct  377   RKLRSKNEIAKWKQMWPTEVLE  398



>gb|KJB35713.1| hypothetical protein B456_006G125100 [Gossypium raimondii]
Length=397

 Score =   466 bits (1199),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 282/380 (74%), Gaps = 8/380 (2%)
 Frame = +1

Query  595   KLVPTWASEFRLQLLFRLWKDLSLLTLVR--KNLFSLIPLRMLAMRSKPGGCSKADDHVE  768
             K +P W +E +L  L+   KD+S  ++ +  K   SL          K    SK D+  E
Sbjct  21    KSLPPWDTEVKLLSLW-FGKDVSFSSVTKFIKTSSSLCYFTSKMSLKKMSLTSKVDNFEE  79

Query  769   TTV---SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
               V   + MS+LDLP+LVLE ILE++PP  LC +A VCSSLR RC++DH WE+H+K KWG
Sbjct  80    EVVEEGAAMSILDLPELVLESILERLPPASLCSMAGVCSSLRSRCITDHFWEKHMKNKWG  139

Query  940   GIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP  1119
              IIGP AYREWQW IALRKDS    Q + KGL    S + P S  + P +    K+++LP
Sbjct  140   RIIGPVAYREWQWLIALRKDSSHLKQWRPKGLMRIFSIVRP-SWWIKPKVDDCSKQSSLP  198

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
               +S+M W+LALE+G+F FPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPPHGR
Sbjct  199   R-ESIMSWFLALETGRFCFPAQVYNRENGHVGFMLSCYDAELCYDQRTDTFQARYPPHGR  257

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
              AVAIE  V W+R+RAP VD   HDLHISDCL +LRPGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  258   RAVAIENNVPWERIRAPPVDTSPHDLHISDCLNELRPGDHIEIQWRRNKEFPYGWWYGVV  317

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHL +CDGN++YCRCH  DTVVLEFNQY+ GSRWR TT+ RK+HREEGNE +GFYGGI+K
Sbjct  318   GHLASCDGNENYCRCHNSDTVVLEFNQYALGSRWRHTTIDRKEHREEGNEGDGFYGGIRK  377

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + S E ISTWKRLWPA++LE
Sbjct  378   LGSVEEISTWKRLWPAEILE  397



>ref|XP_007146143.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
 ref|XP_007146144.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
 gb|ESW18137.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
 gb|ESW18138.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
Length=398

 Score =   466 bits (1198),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 231/379 (61%), Positives = 287/379 (76%), Gaps = 15/379 (4%)
 Frame = +1

Query  610   WASEFRL-QLLFRLWKDLSLLTLVRKNLFSL-----IPLRMLAMRSKPGGCSKADDHVET  771
             WA+E RL  LLF     +  ++ + +N F L     IP  M  +R      +   ++VE 
Sbjct  26    WATEMRLLPLLFSQELSVRTISKLFRNRFWLGFVCQIPAGMSLVRK---SLTSRVENVEE  82

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
             +   MSVLDLP+L L+CILE +PP  LC + +VC SLRERC+SDHLWERH+KQKWG +IG
Sbjct  83    S-HDMSVLDLPELALDCILEGLPPSALCQMIAVCRSLRERCVSDHLWERHMKQKWGRVIG  141

Query  952   PAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGD---KRNNLPP  1122
             PAAYREW+WH+A ++        +++GL  +LS  WPL     P + A +   KR++LP 
Sbjct  142   PAAYREWKWHVASKRSVGGPKHGRQRGLMRFLSIRWPLQ-WTRPKVDANNSPKKRSSLP-  199

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             +DS+M WYLA++SG F FPAQVYNRENGHVGFMLSCYDAE+SYDPRTDTF ARYPPHGR 
Sbjct  200   VDSIMNWYLAIDSGNFCFPAQVYNRENGHVGFMLSCYDAEISYDPRTDTFQARYPPHGRR  259

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A A E G+ W+RLRAP +D   HDLHIS+CL DL PGDHIEIQWRRNK+FPYGWWYGVVG
Sbjct  260   ADARECGIPWERLRAPPIDASPHDLHISECLNDLYPGDHIEIQWRRNKEFPYGWWYGVVG  319

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             HLE+C+G+++YCRCH  DTVVLEFN Y+PGSRWR+TTVSRKDHREEGNEA+GFYGGI+K+
Sbjct  320   HLESCNGSENYCRCHNSDTVVLEFNHYTPGSRWRQTTVSRKDHREEGNEADGFYGGIRKI  379

Query  1663  ESREVISTWKRLWPAQVLE  1719
             +    I+ WKRLWP++VL+
Sbjct  380   KCEAEIAIWKRLWPSEVLD  398



>gb|ERM99136.1| hypothetical protein AMTR_s00101p00163380 [Amborella trichopoda]
Length=330

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 264/320 (83%), Gaps = 2/320 (1%)
 Frame = +1

Query  760   HVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
             HV+ T  ++SVLDLP+LVLE IL ++PPEGLC++A++CSS+RERC S+HLWERH+K+KW 
Sbjct  13    HVDET-DELSVLDLPELVLEGILGRLPPEGLCNMAAICSSMRERCRSNHLWERHMKEKWA  71

Query  940   GIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP  1119
              +IGPAA +EWQ  ++LRKD  + +Q K KG    L+ +WP+S +    +  G  ++ LP
Sbjct  72    RVIGPAALKEWQSFVSLRKDLGVSDQGKSKGWIGSLACIWPVSWLKSKLVSGGKPKSTLP  131

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
               DS+M WYL+LE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTFHARYPPHGR
Sbjct  132   S-DSIMAWYLSLENGRFWFPAQVYNREHGHVGFMLSCYDAELSYDSHTDTFHARYPPHGR  190

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
               + IE GV WDRLRAP VD P HDLH+SDCL DLRPG+HIEIQWRRNK+FPYGWWYGVV
Sbjct  191   RTIVIEEGVQWDRLRAPPVDTPPHDLHVSDCLNDLRPGNHIEIQWRRNKEFPYGWWYGVV  250

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHL++CD N++ CRC   DTV+LEFNQY+PGSRWRRT ++RKDHREEGNE +GFYGGI+K
Sbjct  251   GHLDSCDRNKYNCRCLTNDTVILEFNQYTPGSRWRRTVINRKDHREEGNETDGFYGGIRK  310

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + S+E IS W RLWP+++L+
Sbjct  311   LHSKEEISMWMRLWPSEILD  330



>emb|CAN78683.1| hypothetical protein VITISV_043889 [Vitis vinifera]
Length=364

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 263/346 (76%), Gaps = 34/346 (10%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             +M +LDLP+LVLECILE++PPEGLC L  VCSSLR+RCMSD+ W+RH+K+KWG I+G AA
Sbjct  20    EMGLLDLPELVLECILERLPPEGLCSLGGVCSSLRDRCMSDYFWKRHMKEKWGRILGRAA  79

Query  961   YREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMF  1140
             YREWQWH+A RKDS    Q K  GL   LSR  PLS I      +  +R+++P +DS+M 
Sbjct  80    YREWQWHMASRKDSDTLEQGKPNGLMRLLSRFGPLSWIRSRLSNSTPQRSSVP-VDSIMS  138

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
             WYLALE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTF ARYPPHGR  VAIE 
Sbjct  139   WYLALETGRFWFPAQVYNRESGHVGFMLSCYDAELSYDSHTDTFQARYPPHGRRTVAIEN  198

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY--------------  1458
             GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPY              
Sbjct  199   GVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYDTSLFFLYFLFVIF  258

Query  1459  -------------------GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRW  1581
                                GWWYG+VGHLE+CDGN+ YCRCH  +TVVLEFNQY+PGSRW
Sbjct  259   NPGWWEVDSLLDMRCYDIAGWWYGIVGHLESCDGNESYCRCHNSETVVLEFNQYTPGSRW  318

Query  1582  RRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             RRT+++RKDHREEGNEA+GFYGGI+K+   + IS WK+LWPA+VLE
Sbjct  319   RRTSINRKDHREEGNEADGFYGGIRKLCRNDEISVWKQLWPAEVLE  364



>ref|XP_010910138.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Elaeis guineensis]
Length=398

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/390 (58%), Positives = 281/390 (72%), Gaps = 16/390 (4%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRL-------QLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKP  735
             +K L  + +P+WASE  L       + L+ L K L   +L+   + S+        R  P
Sbjct  16    FKFLPLQPMPSWASEVTLLSNLFWKEFLYSLVKSLRNCSLLSARILSISSSMSSKRRCAP  75

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                      +E     MSVLDLP+L LECIL K+ P GLC++A+V SSLR+RC SDHLWE
Sbjct  76    ------RVEIEEESVDMSVLDLPELALECILGKLSPAGLCNMAAVSSSLRDRCRSDHLWE  129

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDS--RLFNQAKEKGLGSYLSRLWPLSVIVGPNL  1089
             RH+K+KWG +IG  AYR+WQ + A RKDS   +    K+K      S +WPLS +    +
Sbjct  130   RHMKEKWGRVIGGVAYRDWQLYSASRKDSLGGVVGSTKQKKWIGAFSCVWPLSWLKS-RI  188

Query  1090  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
              +  K +N  P DS+M WYL+LESGKFWFPAQVYNRE+GHVGFMLSCYDAE+SYD  TDT
Sbjct  189   ESSSKPSNPLPDDSIMSWYLSLESGKFWFPAQVYNREHGHVGFMLSCYDAEISYDHHTDT  248

Query  1270  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  1449
             FHARYPPHGR  + IE GV WDR+RAP VD PAHDLHISDCL DL PGDHIEIQWRRNK+
Sbjct  249   FHARYPPHGRRTIVIEEGVQWDRIRAPPVDTPAHDLHISDCLNDLHPGDHIEIQWRRNKE  308

Query  1450  FPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNE  1629
             FPYGWWYGVVGHLE+CDGN+H+C CH  DT++LEFNQY+PGS+WRR +V+RKDHRE GNE
Sbjct  309   FPYGWWYGVVGHLESCDGNEHFCHCHNSDTIILEFNQYTPGSKWRRASVNRKDHREGGNE  368

Query  1630  AEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
              +GFYGGI+K+ S+  I+ WK++WP +VLE
Sbjct  369   TDGFYGGIRKLHSKYEIAKWKKMWPTEVLE  398



>ref|XP_010557458.1| PREDICTED: F-box protein At2g32560 [Tarenaya hassleriana]
Length=403

 Score =   464 bits (1194),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/397 (59%), Positives = 286/397 (72%), Gaps = 27/397 (7%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRS-KPGGCSKAD  756
             KSL+ K +P WA E R  L F      SL +       S  P +    R+ KP     A 
Sbjct  17    KSLSLKPLPPWACEARTLLSFWFNNRPSLGS-------SFKPAKKTMPRNPKP---PTAS  66

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             + V     +MSVLDLPDL LECIL+++PP GLC +A VCSSLRERC+SDHLWE+HLK KW
Sbjct  67    EVVSPAPGEMSVLDLPDLALECILDRLPPSGLCSMAGVCSSLRERCVSDHLWEKHLKMKW  126

Query  937   GGIIGPAAYREWQWHIALRKDSRLFN-QAKEKGLGSYLSRLWPLSVIVGPNL-------G  1092
             G I+GPAA+REWQW+IA   D    + QA  +G    +S +  +S +    +       G
Sbjct  127   GKILGPAAHREWQWYIASGNDLGCVDKQAGHRGFVKLVSLIRSISSLFRSKVVNSLNFDG  186

Query  1093  AGDKRNNLP--------PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELS  1248
              GD+             P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELS
Sbjct  187   FGDENKQQRQSNSSSSLPVDSIMNWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELS  246

Query  1249  YDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEI  1428
             YDP +DTF ARYPPHGR AVA+E GVTW+RLRA  +D   H LH+SDCL +L+PGDHIEI
Sbjct  247   YDPHSDTFQARYPPHGRRAVAVEKGVTWERLRAQPIDASPHHLHVSDCLNELKPGDHIEI  306

Query  1429  QWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKD  1608
             QWRRNK+FPYGWWYGVVGHL++CDGN+++C CH  +TVVLEFNQY+ GSRWRRTTV+R+D
Sbjct  307   QWRRNKEFPYGWWYGVVGHLDSCDGNENHCHCHLNETVVLEFNQYTLGSRWRRTTVNRRD  366

Query  1609  HREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             HREEGNEA+GFYGGI+K++S+E I TWKRLWP  VLE
Sbjct  367   HREEGNEADGFYGGIRKLKSQEEICTWKRLWPVSVLE  403



>ref|XP_006836283.2| PREDICTED: F-box protein At2g32560 [Amborella trichopoda]
Length=390

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 212/320 (66%), Positives = 264/320 (83%), Gaps = 2/320 (1%)
 Frame = +1

Query  760   HVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
             HV+ T  ++SVLDLP+LVLE IL ++PPEGLC++A++CSS+RERC S+HLWERH+K+KW 
Sbjct  73    HVDET-DELSVLDLPELVLEGILGRLPPEGLCNMAAICSSMRERCRSNHLWERHMKEKWA  131

Query  940   GIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP  1119
              +IGPAA +EWQ  ++LRKD  + +Q K KG    L+ +WP+S +    +  G  ++ LP
Sbjct  132   RVIGPAALKEWQSFVSLRKDLGVSDQGKSKGWIGSLACIWPVSWLKSKLVSGGKPKSTLP  191

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
               DS+M WYL+LE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTFHARYPPHGR
Sbjct  192   S-DSIMAWYLSLENGRFWFPAQVYNREHGHVGFMLSCYDAELSYDSHTDTFHARYPPHGR  250

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
               + IE GV WDRLRAP VD P HDLH+SDCL DLRPG+HIEIQWRRNK+FPYGWWYGVV
Sbjct  251   RTIVIEEGVQWDRLRAPPVDTPPHDLHVSDCLNDLRPGNHIEIQWRRNKEFPYGWWYGVV  310

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHL++CD N++ CRC   DTV+LEFNQY+PGSRWRRT ++RKDHREEGNE +GFYGGI+K
Sbjct  311   GHLDSCDRNKYNCRCLTNDTVILEFNQYTPGSRWRRTVINRKDHREEGNETDGFYGGIRK  370

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + S+E IS W RLWP+++L+
Sbjct  371   LHSKEEISMWMRLWPSEILD  390



>ref|XP_004513967.1| PREDICTED: F-box protein At2g26850-like [Cicer arietinum]
Length=404

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 287/389 (74%), Gaps = 12/389 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSL-----IPLRMLAMRSKPGGC  744
              ++  K +P+W S    +LL  L+   +   ++R + F +     I  +M  M+      
Sbjct  19    NTIFLKPLPSWTSATDKKLLPFLFCQETFSKVLRNHHFLIGLLCQIHTKMSLMKK---SL  75

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             +   ++VE T  ++S+LDLP+L LECILEK+PP  L  +A VC SLRERC+SDH WE+H+
Sbjct  76    NSRIENVEETHHELSLLDLPELTLECILEKLPPSSLIQMAGVCHSLRERCVSDHFWEKHM  135

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSR-LFNQAKEKG-LGSYLSRLWPLSVIVGPNLGAG  1098
             K+KWGG+IG AAY+EW+WH+A ++D + L    +++G L   LS +WP   +      A 
Sbjct  136   KKKWGGVIGQAAYKEWKWHLASKRDVKGLHKHGRQRGFLMKTLSLVWPFQWMKLKVDDAN  195

Query  1099  D--KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             D  K+ N  P+DS+M WYLA+E+G FWFPAQVYNRENGHVGFMLSCYDAE+SYD R DTF
Sbjct  196   DSNKQKNSLPVDSLMNWYLAIETGTFWFPAQVYNRENGHVGFMLSCYDAEISYDSRVDTF  255

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              ARYPPHGR A A E G+ W+RLRAP VD   HDLHISDCL DL PGDHIEIQWRRNK+F
Sbjct  256   LARYPPHGRRADARECGIPWERLRAPPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEF  315

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYGVVGHLE+C+GN+++CRCH  DTVVLEFN Y+PGSRWR+T ++RKDHREEGNEA
Sbjct  316   PYGWWYGVVGHLESCNGNENHCRCHISDTVVLEFNHYTPGSRWRQTNINRKDHREEGNEA  375

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +GFYGG++K+ S   IS WKR+WP++VL+
Sbjct  376   DGFYGGLRKITSENEISIWKRMWPSEVLD  404



>ref|XP_008794228.1| PREDICTED: F-box protein At2g32560-like [Phoenix dactylifera]
Length=394

 Score =   458 bits (1178),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 232/389 (60%), Positives = 285/389 (73%), Gaps = 19/389 (5%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLLFRLWKDL---SLLTLVRKNLFSL----IPLRMLAMRSKPGGC  744
             L  K +P W  E RL L    W++    SL  L    L S      P  M A  S P   
Sbjct  14    LISKPLPPWVDEMRL-LSVSFWQEFVYHSLHWLKNCQLTSRKVCGFPFTMSAKNSVP---  69

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
              + +D  ET  S M++LDLP+L LECIL K+ P GL ++A VCSSLR+RC SDHLWERH+
Sbjct  70    -RVEDVEET--SGMTILDLPELALECILGKLSPAGLANMACVCSSLRDRCRSDHLWERHM  126

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQA----KEKGLGSYLSRLWPLSVIVGPNLG  1092
             ++KWG +IG AA REW+W+++ RK S +   A    K KG    +S +WPLS +    L 
Sbjct  127   REKWGWLIGRAARREWEWYVSSRKVSLVSGGAMASLKPKGWMGSISYVWPLSWLQS-KLD  185

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
              G++ ++  P+DS+M WYL LESGKFWFPAQVYNRENGHVGF+LSCYDAELSYD  TDTF
Sbjct  186   NGNRPSSPLPMDSIMSWYLVLESGKFWFPAQVYNRENGHVGFLLSCYDAELSYDRHTDTF  245

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
             +ARYPPHGR  V IE G+ WDRLRAP VD PAHDLH+SDCL DL PGDHIEIQWRRNK+F
Sbjct  246   YARYPPHGRRPVKIEEGIEWDRLRAPPVDTPAHDLHVSDCLNDLCPGDHIEIQWRRNKEF  305

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYGVVGHLE+CDGN+H+CRCH+ DT++LEFNQY+ GSRWRR  +SRKDH+EEGNE 
Sbjct  306   PYGWWYGVVGHLESCDGNEHHCRCHKSDTIILEFNQYTHGSRWRRAAISRKDHQEEGNET  365

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +GFYGGI+K+  ++ I+ W+RLWP ++LE
Sbjct  366   DGFYGGIRKLHCKDEIAMWRRLWPNEILE  394



>ref|XP_010922076.1| PREDICTED: F-box protein At2g32560-like [Elaeis guineensis]
Length=400

 Score =   455 bits (1170),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 230/387 (59%), Positives = 281/387 (73%), Gaps = 10/387 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDL---SLLTLVRKNLFSLIPLRMLAMRSKPGGCSK  750
             KSL  K +P W  E RL L    W++    SL  L    L S    R     S      +
Sbjct  17    KSLPLKPLPPWVDEMRL-LSVLFWQEFVYYSLHWLKNCQLTSRKVFRFPFTMSTKKLVPR  75

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
              +++VE T S M++LDLP+L LECIL K+ P GL ++A VCSSLR+RC SDHLWERH+++
Sbjct  76    GEENVEET-SGMTILDLPELALECILGKLSPAGLANMACVCSSLRDRCRSDHLWERHMRE  134

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQA----KEKGLGSYLSRLWPLSVIVGPNLGAG  1098
             KWG +IG  A REW+W+I+ RK S +   A    K KG    +S +WPLS +    L  G
Sbjct  135   KWGRVIGRPARREWEWYISSRKGSLVSGGAMASLKRKGWMGSISCVWPLSWLKC-KLDDG  193

Query  1099  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
              + ++  P+DS+M WYL LESGKFWFPAQVYNRENGHVGF+LSCYDAELSYD   DTF+A
Sbjct  194   KRPSSPLPMDSMMSWYLVLESGKFWFPAQVYNRENGHVGFLLSCYDAELSYDRHADTFYA  253

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR  V IE GV WDRLRAP VD PAHDLH+SDCL DL PGDHIEIQWRRNK+FPY
Sbjct  254   RYPPHGRRPVNIEEGVEWDRLRAPPVDTPAHDLHVSDCLNDLCPGDHIEIQWRRNKEFPY  313

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEG  1638
             GWWYGVVGHL+ CDGN+++CRCH+ DT++LEFNQY+ GSRWRR  V RKDH+EEGNE  G
Sbjct  314   GWWYGVVGHLDLCDGNENHCRCHKSDTIILEFNQYTHGSRWRRAAVRRKDHQEEGNETNG  373

Query  1639  FYGGIQKVESREVISTWKRLWPAQVLE  1719
             FYGGI+K+ S++ I+ W+RLWP ++LE
Sbjct  374   FYGGIRKLHSKDEIAMWRRLWPNEILE  400



>ref|XP_009420968.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 284/385 (74%), Gaps = 10/385 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPG-----GC  744
             KSL  + +P WA E RL L    W++LS   L+  + F  +  R LA  S P       C
Sbjct  64    KSLPLQPLPPWAGEVRL-LSILFWRELSAALLLFFDKFRPVSARKLAAPSSPTMSPRKRC  122

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             +   D+VE +  +MSVLDLP+L LECIL K+ P GL ++A+VCSSLRERC SDHLWE+H+
Sbjct  123   AHRVDNVEES-GEMSVLDLPELALECILGKLSPAGLSNMAAVCSSLRERCRSDHLWEKHM  181

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDK  1104
             ++KWG +IG AA REW+  +A  K+S   N  + K +G+ LS +WP+S +     G    
Sbjct  182   EEKWGRVIGHAARREWKLLLASIKNSSASNSCR-KWIGA-LSCVWPISWLKSRIDGGCQN  239

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
             R+ LP  DS+M WY +LESG FWFPAQVYNRE+GHVGFMLSCYDAE+ YD +T++FHARY
Sbjct  240   RSPLPD-DSIMSWYRSLESGGFWFPAQVYNREHGHVGFMLSCYDAEVRYDRQTNSFHARY  298

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
             PPHGR  + +E GV WDRLRAP V+ P HDLHISDCL DLRPG+HIEIQWRRNK+FPYGW
Sbjct  299   PPHGRRTIVVEEGVQWDRLRAPPVNTPPHDLHISDCLSDLRPGNHIEIQWRRNKEFPYGW  358

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WYGV+GHLE+C+GN+HYC CH  DTVVLEFNQY+ GSRWRR ++SRK HREEGNE +GFY
Sbjct  359   WYGVIGHLESCNGNEHYCSCHLSDTVVLEFNQYTLGSRWRRASISRKHHREEGNETDGFY  418

Query  1645  GGIQKVESREVISTWKRLWPAQVLE  1719
             GGI+K+  ++ IS W+RLWP   LE
Sbjct  419   GGIRKLHGKDEISKWRRLWPTDALE  443



>ref|XP_009393902.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   447 bits (1149),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/388 (57%), Positives = 282/388 (73%), Gaps = 15/388 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTL-------VRKNLFSLIPLRMLAMRSKPG  738
             KSL  + +P WASE RL  +    + LS L         VR    +L    M   + +P 
Sbjct  17    KSLPLEPLPQWASETRLVSILLFQEVLSFLAPLLERCRPVRAGNLTLPSSLMSPGKGRPH  76

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
                  ++     +++MSVLDLP+L L+CIL ++ P GLC++A+VCSSL+ERC SDHLWE+
Sbjct  77    RVENVEE-----LAEMSVLDLPELALDCILGRLSPAGLCNMAAVCSSLKERCRSDHLWEK  131

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQ--AKEKGLGSYLSRLWPLSVIVGPNLG  1092
             H+K+KWG +IG AA REW+ ++A  +DS +  +   + K     LS LWP+S +    + 
Sbjct  132   HMKEKWGRVIGNAARREWKLYLASTRDSAVGAEDINRSKKWNGVLSCLWPISWL-NFRID  190

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             +G+K  +  P DS+M WY +LESGK WFPAQVYNRE+GHVGFMLSCYDAE+SYD  TDTF
Sbjct  191   SGNKHKSPLPDDSIMSWYRSLESGKLWFPAQVYNREHGHVGFMLSCYDAEVSYDCSTDTF  250

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
             HARYPPHGR  + +E GV WDRLRAP V+ PA+DLHISDCL DLR GDHIEIQWRRNK+F
Sbjct  251   HARYPPHGRRMMIMEEGVQWDRLRAPPVNTPAYDLHISDCLSDLRAGDHIEIQWRRNKEF  310

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYGV+GHLE+CDGN+  C CH  DTV+LEFNQY+PGSRWRR +++RK HREEGNE 
Sbjct  311   PYGWWYGVIGHLESCDGNELLCHCHLSDTVILEFNQYTPGSRWRRASINRKAHREEGNET  370

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVL  1716
             +GFYGGI+K++S++ IS W++LWP  VL
Sbjct  371   DGFYGGIRKLQSKDEISKWRQLWPKDVL  398



>ref|XP_009404696.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   444 bits (1142),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 279/385 (72%), Gaps = 8/385 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDL--SLLTLVRKNLFSLIPLRMLAMRSKPGGCSKA  753
             KSL  + +P WA E RL L    W++L  SLL L  K    +   +  A+ S      K 
Sbjct  18    KSLPLQPLPPWAGEVRL-LSVLFWQELLSSLLHLFDK-CKPISARKSGALSSVTTPPRKI  75

Query  754   DDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
                      +MSVLDLP+L LECIL K+ P GL ++A+VCSSLRERC SDHLWE+H+K+K
Sbjct  76    CGQRVENAEEMSVLDLPELALECILGKLSPAGLSNMAAVCSSLRERCRSDHLWEKHMKEK  135

Query  934   WGGIIGPAAYREWQWHIALRKDSRLF---NQAKEKGLGSYLSRLWPLSVIVGPNLGAGDK  1104
             W  +IG AA R+W+ ++A R+DS      + + +K + S LSR+W +S +    +  G K
Sbjct  136   WERVIGDAARRDWKLYLASREDSSAGIAGSDSSKKWVVSVLSRVWHISWLKS-RIDGGSK  194

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
               N  P DS+M WY +LESGKFWFPAQVYNRE+GHVGFMLSCYDA + YD +TDTFHARY
Sbjct  195   TKNPLPDDSIMSWYQSLESGKFWFPAQVYNREHGHVGFMLSCYDAAVRYDCQTDTFHARY  254

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
             PPHGR    +E GV WDRLR P V+ PAHDLHISDCL DLRPGDHIEIQWRR+K+FPYGW
Sbjct  255   PPHGRRTTVVEEGVQWDRLRPPPVETPAHDLHISDCLDDLRPGDHIEIQWRRSKEFPYGW  314

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WYGVVGHLE CDGN+H+C CH  DTVVLEFNQY+PGSRWRR +++ KDHRE GNE +GF+
Sbjct  315   WYGVVGHLEPCDGNEHFCWCHLSDTVVLEFNQYTPGSRWRRASINPKDHREGGNETDGFF  374

Query  1645  GGIQKVESREVISTWKRLWPAQVLE  1719
             GGI+K++S++ IS W++LWPA  LE
Sbjct  375   GGIRKLKSKDEISKWRQLWPADALE  399



>ref|XP_006430546.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
 gb|ESR43786.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
Length=382

 Score =   443 bits (1140),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/383 (59%), Positives = 274/383 (72%), Gaps = 19/383 (5%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLS--LLTLVRKNLFSLIPLRM-LAMRSKPGGCSK  750
             KSLA    P   S++RL L    W++LS  L++  +K    + PL+  ++  SKP    K
Sbjct  16    KSLA---KPPMKSDWRL-LSPWFWRELSSFLVSWFQKGGLVIRPLKQKMSFGSKPANTEK  71

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
                       ++S+LDLPDL LECILEK+ P GLC++A VCSSLR+RC SDHLWE+H+KQ
Sbjct  72    ---------EKISLLDLPDLTLECILEKLSPAGLCNMAGVCSSLRDRCTSDHLWEKHMKQ  122

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             KWG +IG  A REWQWH+  R+ S L N  K+ G    L   WP S          + R+
Sbjct  123   KWGRVIGDVAKREWQWHLVSRQRSSLMNNKKQTGFFWSLYSCWPFSWSERKTESNTEPRS  182

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             +LP +DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY P
Sbjct  183   SLP-VDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSP  241

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR  V  E  ++W+RLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWY
Sbjct  242   HGRRMV--EENISWERLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWY  299

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GVVGHLE+C  N+H+C C   DTVVLEFNQY  GSRWR+T ++RKDHRE GNEA+GFYGG
Sbjct  300   GVVGHLESCGRNEHHCLCLYKDTVVLEFNQYPTGSRWRQTMINRKDHREVGNEADGFYGG  359

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+   E IS WK LWP   LE
Sbjct  360   IRKIYKEEEISMWKSLWPRHALE  382



>ref|XP_009403834.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   441 bits (1133),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 253/316 (80%), Gaps = 4/316 (1%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             +MSVLDLP+L LECIL K+ P GL ++A+VCSSLRERC SDHLWE+H+K+KWG +IG AA
Sbjct  19    EMSVLDLPELTLECILGKLSPTGLSNMAAVCSSLRERCRSDHLWEKHMKEKWGRLIGHAA  78

Query  961   YREWQWHIALRKDSR---LFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDS  1131
              REW+ +++  KDS    + +  + K     LS +WP+S +    +    K  +  P DS
Sbjct  79    RREWKQYLSSTKDSSPADITSSNRSKKWIGVLSCVWPISWLKS-RIDGSYKPKSPSPDDS  137

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             VM WY +LESGKFWFP+Q+YNRE+GHVGFMLSCYDAE+ YD  TDTFHARYPPHGR A+ 
Sbjct  138   VMSWYQSLESGKFWFPSQIYNREHGHVGFMLSCYDAEVRYDSHTDTFHARYPPHGRRAIV  197

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
             IE GV WDRLRAP +  PAH+LHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV+GHLE
Sbjct  198   IEEGVQWDRLRAPPISTPAHELHISDCLSDLRPGDHIEIQWRRNKEFPYGWWYGVIGHLE  257

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CDG++H+C CH  DTVVLEFNQY+PGSRWRR  ++RKDHREEG+E +GFYGGI+K++S+
Sbjct  258   SCDGSEHFCHCHLSDTVVLEFNQYTPGSRWRRALINRKDHREEGSETDGFYGGIRKLQSK  317

Query  1672  EVISTWKRLWPAQVLE  1719
             + IS W++LWP  +LE
Sbjct  318   DEISKWRQLWPTDILE  333



>ref|XP_007028342.1| F-box family protein isoform 1 [Theobroma cacao]
 ref|XP_007028344.1| F-box family protein isoform 1 [Theobroma cacao]
 gb|EOY08844.1| F-box family protein isoform 1 [Theobroma cacao]
 gb|EOY08846.1| F-box family protein isoform 1 [Theobroma cacao]
Length=395

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 278/388 (72%), Gaps = 16/388 (4%)
 Frame = +1

Query  580   KSLAFK-LVPTWASEFRLQLLFRLWKDLS--LLTLVRKN----LFSLIPLRMLAMRSKPG  738
             KSL+FK   P    E+RL L    W+  S  +++  +K      F  +P+ +L +R K  
Sbjct  16    KSLSFKNQYPRMKGEWRL-LSPWFWEGFSSFMVSWFQKGRLGICFYQLPM-ILTLRKKMR  73

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
                K D+  E    ++S+LDLP+L LECILE++ P GLC +A VCSS RERC SDHLWE+
Sbjct  74    LGPKVDNVEE---ERISLLDLPELTLECILERLSPAGLCSMAGVCSSFRERCTSDHLWEK  130

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL-GA  1095
             H+KQKWG +IG AA+REWQWHIA RK   L   +K+KG    L+ +WP S    PNL G+
Sbjct  131   HMKQKWGKVIGDAAHREWQWHIASRKRPNLLGPSKQKGFLGSLTNMWPFSWFT-PNLEGS  189

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD +TDTF 
Sbjct  190   SSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDSKTDTFQ  249

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWRRNK+FP
Sbjct  250   ARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWRRNKEFP  307

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDG +++CRC   D V+LEFNQY   SRWR+T ++RKDHRE GNEA+
Sbjct  308   YGWWYGVVGHLESCDGAENHCRCQYTDAVILEFNQYPASSRWRKTIINRKDHREVGNEAD  367

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+   E I  WKRLWP QVLE
Sbjct  368   GFYGGIRKLCKEEEILMWKRLWPNQVLE  395



>ref|XP_010112861.1| F-box protein [Morus notabilis]
 gb|EXC34984.1| F-box protein [Morus notabilis]
Length=327

 Score =   439 bits (1130),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 209/326 (64%), Positives = 247/326 (76%), Gaps = 3/326 (1%)
 Frame = +1

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
             CS+  ++VE     +S+LDLP+L LECI E++ P GLC +A VCSSLRERC+SD LWE H
Sbjct  4     CSRLVENVEEKELMISLLDLPELTLECIFERLSPAGLCSMAGVCSSLRERCISDRLWESH  63

Query  922   LKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGD  1101
             LKQKWG +IG  AYREWQ H+A R  S L  +  +KGL   L    P S I  P +    
Sbjct  64    LKQKWGKVIGDRAYREWQCHVASRNGSNLAYRKTKKGLFESLLSAQPFSWIR-PKIEKNS  122

Query  1102  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
             K     P+DSVM WYL+LESGKFWFPAQVYNRENGH+GFMLSCYDA+LSYD RTDTF AR
Sbjct  123   KVRTNLPVDSVMAWYLSLESGKFWFPAQVYNRENGHIGFMLSCYDAQLSYDSRTDTFQAR  182

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             Y PHGR     E  + WDRLRAP +D P   LH SDCL+DL+PGDHIEIQWRRNK+ PYG
Sbjct  183   YSPHGRRTA--EENIGWDRLRAPPIDTPPFMLHASDCLHDLKPGDHIEIQWRRNKECPYG  240

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYG+VGHLE CDGN+++CRC+  DT+VLEFNQY+PGSRWRRTT++RKDHREEGNEA GF
Sbjct  241   WWYGLVGHLEPCDGNENHCRCYYSDTIVLEFNQYNPGSRWRRTTINRKDHREEGNEANGF  300

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K+ + E +  W+R WP Q LE
Sbjct  301   YGGIRKLYNDEEVVRWRRFWPNQALE  326



>ref|XP_006482074.1| PREDICTED: F-box protein At2g32560-like [Citrus sinensis]
Length=382

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/383 (59%), Positives = 272/383 (71%), Gaps = 19/383 (5%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLS--LLTLVRKNLFSLIPLRM-LAMRSKPGGCSK  750
             KSLA    P   S++RL L    W++LS  L++  +K    + PL+  ++  SKP    K
Sbjct  16    KSLA---KPPMKSDWRL-LSPWFWRELSSFLVSWFQKGGLVIRPLKQKMSFGSKPANTEK  71

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
                       ++S+LDLPDL LECILEK+ P GLC++A VCSSLR+RC SD LWE+H+KQ
Sbjct  72    ---------EKISLLDLPDLTLECILEKLSPAGLCNMAGVCSSLRDRCTSDRLWEKHMKQ  122

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             KWG +IG  A REWQWH+  R+ S L N  K+ G    L   WP S          + R+
Sbjct  123   KWGRVIGDVAKREWQWHLVSRQRSSLMNNKKQTGFFWSLYSCWPFSWSERKTESNTEPRS  182

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             +LP +DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY P
Sbjct  183   SLP-VDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSP  241

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR  V  E  ++WDRLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWY
Sbjct  242   HGRRMV--EENISWDRLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWY  299

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GVVGHLE+C  N+H+C C   DTVVLEFNQY  GSRWR+  ++RKDHRE GNEA+GFYGG
Sbjct  300   GVVGHLESCGRNEHHCLCFYKDTVVLEFNQYPTGSRWRQMMINRKDHREVGNEADGFYGG  359

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+   E IS WK LWP   LE
Sbjct  360   IRKIYKEEEISMWKSLWPRHALE  382



>ref|XP_002522176.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40217.1| conserved hypothetical protein [Ricinus communis]
Length=353

 Score =   437 bits (1125),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 256/340 (75%), Gaps = 10/340 (3%)
 Frame = +1

Query  700   IPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSS  879
             +PL+ + + SK  G  + +        ++S+LDLP+L L+CILEK+ P GLC +A+VCSS
Sbjct  1     MPLKKMNLGSKEPGNLEEE--------KISLLDLPELTLDCILEKLSPSGLCSVAAVCSS  52

Query  880   LRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLW  1059
             LR++C SDHLWE+HLKQKWG +IG AA++EWQWHIA R    L NQ+ +K L   L  +W
Sbjct  53    LRDKCTSDHLWEKHLKQKWGRVIGDAAFKEWQWHIASRNRLPLVNQSNQKRLLGSLGSIW  112

Query  1060  PLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDA  1239
             PLS I               P+DS+M  YL+LE GKFWFPAQVYNRENGHVGF+LSCYDA
Sbjct  113   PLSWIKPKFQSRSKPPIASLPVDSIMAMYLSLEKGKFWFPAQVYNRENGHVGFLLSCYDA  172

Query  1240  ELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDH  1419
              +SYD RTDTF ARY P+GR    IE G+ WDRLRA  VD PAHDLHISDCL+DL+PGDH
Sbjct  173   LVSYDSRTDTFQARYSPYGRRM--IEDGIHWDRLRASPVDTPAHDLHISDCLHDLKPGDH  230

Query  1420  IEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVS  1599
             IEIQWRR+  FPYGWWY +VGH+E+CDGN+  C C   D VVLEFNQYSPGSRWR+T ++
Sbjct  231   IEIQWRRSNGFPYGWWYAIVGHIESCDGNESRCHCQNSDKVVLEFNQYSPGSRWRQTIIN  290

Query  1600  RKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             RKDHREEG+EA+GFYGGI+K+ + + ISTWK LWP+Q L+
Sbjct  291   RKDHREEGDEADGFYGGIRKLYNADEISTWKNLWPSQYLQ  330



>ref|XP_012065844.1| PREDICTED: F-box protein At2g26850 isoform X2 [Jatropha curcas]
Length=365

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/390 (57%), Positives = 274/390 (70%), Gaps = 50/390 (13%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLL--------TLVRKNLFSLIPLRMLA--MRS  729
             KSL  K +P+WA+E RL L    WK+L L         TL +   F+ +P +M    M +
Sbjct  16    KSLHLKPLPSWATEVRL-LSIWFWKELFLFPYLCSVKNTLSKAFYFTRLPSKMSTKKMTT  74

Query  730   KPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHL  909
                   + ++ V+    +++ LDLPDL L+CILE++PP GLC +A VC+SLRERC+S+HL
Sbjct  75    LSTSTVELENLVDDETGEITFLDLPDLTLDCILERLPPAGLCSMAGVCTSLRERCISNHL  134

Query  910   WERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL  1089
             WERH+KQKW   + P     + W  ++  D    N  K+K      S L           
Sbjct  135   WERHMKQKW---VLP-----FSWMNSMEDD----NNVKQK------SSL-----------  165

Query  1090  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
                       P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPRT+T
Sbjct  166   ----------PVDSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTNT  215

Query  1270  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  1449
             F ARYPPHGR A+AIETGV W+RLRAP +D   H LHISDCL DLRPGDHIEIQWRRNK+
Sbjct  216   FQARYPPHGRRAIAIETGVPWERLRAPPIDTSPHHLHISDCLNDLRPGDHIEIQWRRNKE  275

Query  1450  FPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNE  1629
             FPYGWWYGVVGHLE CDGN++YCRCH  DT+VLEF+QY+ GSRWR T ++RK+HREEGNE
Sbjct  276   FPYGWWYGVVGHLEPCDGNENYCRCHNSDTIVLEFHQYTRGSRWRCTMINRKEHREEGNE  335

Query  1630  AEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             A+GFYGGI+K+ + E IS WK+LWP +VLE
Sbjct  336   ADGFYGGIRKLNANEEISRWKQLWPTEVLE  365



>gb|KEH33371.1| F-box plant-like protein [Medicago truncatula]
Length=335

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 259/325 (80%), Gaps = 6/325 (2%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             ++VE    ++S+LDLP+L+LECILEK+PP  LC +A +C SLRERC+SD+ WERH+K+KW
Sbjct  13    ENVEEIEDKLSLLDLPELILECILEKLPPSSLCQMAGICHSLRERCVSDYFWERHMKKKW  72

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGL-GSYLSRLWP---LSVIVGPNLGAGDK  1104
             GG+IG AAYREW+WH+A           K+ GL     S LWP   + + VG    + + 
Sbjct  73    GGVIGQAAYREWKWHVASNMGVGSLKHGKQSGLWMKIFSLLWPFQGMKLKVGDGNDSCNH  132

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
             R++LP +++VM WYLA+E+G+FWFPAQVYNRENGH+GF+LSCYDAELSYD RT+TF ARY
Sbjct  133   RSSLP-VEAVMNWYLAIETGRFWFPAQVYNRENGHLGFLLSCYDAELSYDSRTNTFLARY  191

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
             P HGR   A E G+ W+R+RAP VD   HDLHIS+CL DL PG+HIEIQWRR K+FPYGW
Sbjct  192   PSHGRRE-ARECGIPWERIRAPPVDISPHDLHISNCLNDLHPGNHIEIQWRRKKEFPYGW  250

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WYGVVGHLE+C+ N+++CRCH  D+V++EFN Y+PGSRWR+T+++RKDHREEGNEA+GFY
Sbjct  251   WYGVVGHLESCNNNENHCRCHNSDSVMIEFNHYTPGSRWRQTSINRKDHREEGNEADGFY  310

Query  1645  GGIQKVESREVISTWKRLWPAQVLE  1719
             GGI+K+ES   IS WKR+WP++VL+
Sbjct  311   GGIRKIESLNEISIWKRMWPSKVLD  335



>ref|XP_007028345.1| F-box family protein isoform 4 [Theobroma cacao]
 gb|EOY08847.1| F-box family protein isoform 4 [Theobroma cacao]
Length=393

 Score =   437 bits (1125),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 278/388 (72%), Gaps = 18/388 (5%)
 Frame = +1

Query  580   KSLAFK-LVPTWASEFRLQLLFRLWKDLS--LLTLVRKN----LFSLIPLRMLAMRSKPG  738
             KSL+FK   P    E+RL L    W+  S  +++  +K      F  +P+ +L +R K  
Sbjct  16    KSLSFKNQYPRMKGEWRL-LSPWFWEGFSSFMVSWFQKGRLGICFYQLPM-ILTLRKKMR  73

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
                K D+  E    ++S+LDLP+L LECILE++ P GLC +A VCSS RERC SDHLWE+
Sbjct  74    LGPKVDNVEE---ERISLLDLPELTLECILERLSPAGLCSMAGVCSSFRERCTSDHLWEK  130

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL-GA  1095
             H+KQKWG +IG AA+REWQWHIA RK   L   +K+KG    L+ +WP S    PNL G+
Sbjct  131   HMKQKWGKVIGDAAHREWQWHIASRKRPNLLGPSKQKGFLGSLTNMWPFSWFT-PNLEGS  189

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD +TDTF 
Sbjct  190   SSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDSKTDTFQ  249

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWRRNK+FP
Sbjct  250   ARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWRRNKEFP  307

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGHLE+CDG +++CRC    TV+LEFNQY   SRWR+T ++RKDHRE GNEA+
Sbjct  308   YGWWYGVVGHLESCDGAENHCRCQY--TVILEFNQYPASSRWRKTIINRKDHREVGNEAD  365

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+   E I  WKRLWP QVLE
Sbjct  366   GFYGGIRKLCKEEEILMWKRLWPNQVLE  393



>ref|XP_006430547.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
 gb|ESR43787.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
Length=394

 Score =   436 bits (1122),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 226/395 (57%), Positives = 274/395 (69%), Gaps = 31/395 (8%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLS--LLTLVRKNLFSLIPLRM-LAMRSKPGGCSK  750
             KSLA    P   S++RL L    W++LS  L++  +K    + PL+  ++  SKP    K
Sbjct  16    KSLA---KPPMKSDWRL-LSPWFWRELSSFLVSWFQKGGLVIRPLKQKMSFGSKPANTEK  71

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
                       ++S+LDLPDL LECILEK+ P GLC++A VCSSLR+RC SDHLWE+H+KQ
Sbjct  72    ---------EKISLLDLPDLTLECILEKLSPAGLCNMAGVCSSLRDRCTSDHLWEKHMKQ  122

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             KWG +IG  A REWQWH+  R+ S L N  K+ G    L   WP S          + R+
Sbjct  123   KWGRVIGDVAKREWQWHLVSRQRSSLMNNKKQTGFFWSLYSCWPFSWSERKTESNTEPRS  182

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             +L P+DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY P
Sbjct  183   SL-PVDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSP  241

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR  V  E  ++W+RLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWY
Sbjct  242   HGRRMV--EENISWERLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWY  299

Query  1471  GVVGHLETCDGNQHYCRC------------HECDTVVLEFNQYSPGSRWRRTTVSRKDHR  1614
             GVVGHLE+C  N+H+C C               DTVVLEFNQY  GSRWR+T ++RKDHR
Sbjct  300   GVVGHLESCGRNEHHCLCLYKAVKNLTKMSLPTDTVVLEFNQYPTGSRWRQTMINRKDHR  359

Query  1615  EEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             E GNEA+GFYGGI+K+   E IS WK LWP   LE
Sbjct  360   EVGNEADGFYGGIRKIYKEEEISMWKSLWPRHALE  394



>gb|EYU35950.1| hypothetical protein MIMGU_mgv1a008147mg [Erythranthe guttata]
Length=383

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 228/389 (59%), Positives = 265/389 (68%), Gaps = 24/389 (6%)
 Frame = +1

Query  583   SLAFKLV--PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKAD  756
             S +F L   P +A E RL L    WK       ++  LFS   L     R  P     A 
Sbjct  9     SFSFILFYSPLFACEMRL-LSLCFWKS------IKNTLFS-ATLSFFTTRMLPSKKIYAV  60

Query  757   DHVETTV------SQMSVLD-LPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
               V+ T        QMSVLD LPDLVLE ILEK+PP+GLC +  V  SLR  C+SDHLWE
Sbjct  61    PKVQRTAFDTNSGDQMSVLDYLPDLVLETILEKLPPKGLCRMGCVSKSLRGMCVSDHLWE  120

Query  916   RHLKQKWGGIIGPAAYREWQWHIALR-KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLG  1092
             RH++ KWG ++G +AYREW      R +DS  F++  EKG       L  L  +V     
Sbjct  121   RHVRSKWGRVVGTSAYREWLCSAHSRNQDSIFFDRIGEKGF------LGCLIALVRSRFC  174

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             +  K    PP++SVM WY+ALESGK WFPAQVYNRENGHVGFMLSCYDA +SYD RTDTF
Sbjct  175   SVGKDKIFPPVNSVMSWYIALESGKLWFPAQVYNRENGHVGFMLSCYDAVVSYDRRTDTF  234

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              ARYP HG    AIE+GVTWDRLRAPLVD   HDLHISDCL +LRPGD IEIQWRRNK+F
Sbjct  235   LARYPAHGTRTSAIESGVTWDRLRAPLVDTSPHDLHISDCLNELRPGDQIEIQWRRNKEF  294

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYGVVGHLETCDGN +YCRCH  +++VLEFNQY+ G RWR T V+R+DHREEGNEA
Sbjct  295   PYGWWYGVVGHLETCDGNANYCRCHHSESLVLEFNQYTRGCRWRTTIVNRRDHREEGNEA  354

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +GFYGGI+K+   E IS WK+ WP  VLE
Sbjct  355   DGFYGGIRKLCGDEEISMWKQFWPDVVLE  383



>ref|XP_004291727.1| PREDICTED: F-box protein At2g32560 isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459458.1| PREDICTED: F-box protein At2g32560 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=354

 Score =   431 bits (1108),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 214/337 (64%), Positives = 251/337 (74%), Gaps = 16/337 (5%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             DH   T  Q+ +LDLP+L LECILE++P E L  +  VC+SLRERC+SDHLWE H+KQKW
Sbjct  18    DHGINTEQQVCLLDLPELALECILERLPAESLFRIRGVCTSLRERCVSDHLWENHMKQKW  77

Query  937   GGIIGPAAYREWQWH-IALRKDSRLFNQ--AKEKGLGSYLSRLWPLSVIVG---------  1080
             G +IGPA Y+EWQWH +A +K S   NQ    +K  G  L ++  LS+            
Sbjct  78    GRVIGPATYKEWQWHSMANQKQSLNQNQLAKPQKAAGKCLMKILSLSLSWSLSWIRSSSD  137

Query  1081  -PNLGAGDKRNNLPPI---DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELS  1248
                     +R   P     +SVM WYLAL +G+FWFPAQVYNRENGHVGF+LSCYDAEL 
Sbjct  138   IDEFIKSKRRTCFPSPHYENSVMSWYLALTTGRFWFPAQVYNRENGHVGFVLSCYDAELC  197

Query  1249  YDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEI  1428
             YDPR D+F ARYPPHGR AVAIE  V W+RLRAP VD   HDLHISDCL DLRPGDHIEI
Sbjct  198   YDPRNDSFQARYPPHGRRAVAIENCVPWERLRAPPVDTLPHDLHISDCLNDLRPGDHIEI  257

Query  1429  QWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKD  1608
             QWRRNK+FPYGWWYGVVGHLE+CDGN+ YC CH  D VVLEFNQY+ GSRWR TT+SRK+
Sbjct  258   QWRRNKEFPYGWWYGVVGHLESCDGNETYCICHNSDNVVLEFNQYARGSRWRCTTISRKN  317

Query  1609  HREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             HREEG+EA+GFYGGI+K++ +E IS WK+LWP QVLE
Sbjct  318   HREEGDEADGFYGGIRKLQMKEEISIWKQLWPTQVLE  354



>ref|XP_010045084.1| PREDICTED: F-box protein At2g32560-like [Eucalyptus grandis]
 gb|KCW87237.1| hypothetical protein EUGRSUZ_B03749 [Eucalyptus grandis]
Length=389

 Score =   432 bits (1111),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 259/340 (76%), Gaps = 2/340 (1%)
 Frame = +1

Query  703   PLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSL  882
             P R+ +++ K     +  +  E+     S+LDLP+L LE ILEK+PPEGL  ++ VC++L
Sbjct  51    PPRLSSLKEKMSPAPEPGNAEESQGGAPSLLDLPELALEYILEKLPPEGLLSMSGVCTAL  110

Query  883   RERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWP  1062
             R+RC SD+ W++H+K+KW  +IGP+AY+ WQ  +A R+D+   NQ K+KGL    S +WP
Sbjct  111   RDRCRSDYFWDKHMKRKWDRVIGPSAYKVWQLCLAPRRDNGDSNQGKQKGLLRLFSLVWP  170

Query  1063  LSVIVGPNLGAG-DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDA  1239
              S   G  +  G D+  +LP   SVM WY+ALE+G+FWFPAQVYNRENGH GF+LSCYDA
Sbjct  171   CS-WAGERINIGQDQTCSLPYDSSVMSWYIALETGRFWFPAQVYNRENGHAGFLLSCYDA  229

Query  1240  ELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDH  1419
             ELSYD RTDTF ARYPPHGR A+A+ETGVTW+RLR+P VD   HDLH+SDCL DL PGDH
Sbjct  230   ELSYDFRTDTFRARYPPHGRRAMALETGVTWERLRSPQVDTSPHDLHLSDCLKDLCPGDH  289

Query  1420  IEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVS  1599
             +EIQWRRNK+FPYGWWYGVVGHLE+C+ N+ YCRC     VVLEFNQYS GS W RTT+ 
Sbjct  290   VEIQWRRNKEFPYGWWYGVVGHLESCNRNESYCRCSSSGAVVLEFNQYSAGSPWSRTTID  349

Query  1600  RKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             R++HREEGNE +GFYGGI+K+ + + IS WKRLWP ++LE
Sbjct  350   RRNHREEGNEVDGFYGGIRKLRTDDEISAWKRLWPTELLE  389



>gb|ABR18151.1| unknown [Picea sitchensis]
Length=395

 Score =   432 bits (1110),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 211/353 (60%), Positives = 256/353 (73%), Gaps = 8/353 (2%)
 Frame = +1

Query  664   LLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPP  843
             LL  +RK     +   M   R+    C +  ++VE  V   S+LDLP+L LE IL ++ P
Sbjct  50    LLEFIRKRSLVKVSASMGLKRT----CVQKVENVEE-VKGFSILDLPELALEGILSRLSP  104

Query  844   EGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAK  1023
               LC+ A VC+ LRERC S+HLW+  LK KWG +IGPAAYREWQW +A+ K++ + +  K
Sbjct  105   ASLCNTAGVCTDLRERCRSNHLWDPRLKAKWGKVIGPAAYREWQWTVAMNKETGILDGCK  164

Query  1024  EKGLGSYLSRLWPLSVI-VGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE  1200
               G    LS +W  S + + P +  G K  N PP DSVM WYLALESGKFWFPAQVYNRE
Sbjct  165   ANGWLRSLSCIWQFSWLRLRPEINRGGK--NGPPSDSVMAWYLALESGKFWFPAQVYNRE  222

Query  1201  NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLH  1380
              GHVGFMLSCYDAELSYD RTDTF ARYPPHG   + +E GV W+RLRAP VD  AHDLH
Sbjct  223   RGHVGFMLSCYDAELSYDRRTDTFQARYPPHGHRKIVVEEGVQWERLRAPPVDTTAHDLH  282

Query  1381  ISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQ  1560
              SDCL DL PGDH+EIQWRRNK+FPYGWWYGVVGH + CD +  +C+CH  DTV+LEFNQ
Sbjct  283   PSDCLNDLCPGDHVEIQWRRNKEFPYGWWYGVVGHSDYCDRDSRHCQCHLDDTVILEFNQ  342

Query  1561  YSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             Y  GSRWRR  ++R DH EEGNEAEGFYGGI+K++++E I TWK+LWP++ LE
Sbjct  343   YISGSRWRRAAINRNDHHEEGNEAEGFYGGIRKLQTKEEILTWKQLWPSETLE  395



>gb|KDO54744.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=380

 Score =   426 bits (1095),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 273/393 (69%), Gaps = 46/393 (12%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSL----IPLRMLAMRSKPGGC  744
             LA K +P WA    L+LL    WK++S  ++    KN  ++    IP   L+ +      
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHM---M  75

Query  745   SKADDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
             S ++DHVE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+
Sbjct  76    STSNDHVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEK  135

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEK---GLGSYLSRL-WPLSVIVGPN  1086
             H+KQKWG I+GPAAYREWQWH+A RKDS    Q K++    L S++    W  S +   +
Sbjct  136   HMKQKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTS  195

Query  1087  LGAGDKRNNLPPIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  1260
                   R    P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  
Sbjct  196   KQTTTTR---LPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQS  252

Query  1261  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  1440
             TDTF ARYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRR
Sbjct  253   TDTFQARYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRR  312

Query  1441  NKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREE  1620
             NK+FPY                         +T++LEFNQY+PGSRWR+TT++RKDHREE
Sbjct  313   NKEFPY-------------------------ETLILEFNQYTPGSRWRKTTINRKDHREE  347

Query  1621  GNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GNEA+GFYGGI+KV + E I  WKRLWP +VLE
Sbjct  348   GNEADGFYGGIRKVNNEEEIKMWKRLWPVEVLE  380



>ref|XP_002307980.2| hypothetical protein POPTR_0006s03840g [Populus trichocarpa]
 gb|EEE91503.2| hypothetical protein POPTR_0006s03840g [Populus trichocarpa]
Length=373

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/369 (58%), Positives = 260/369 (70%), Gaps = 8/369 (2%)
 Frame = +1

Query  628   LQLLFRLWKDLS--LLTLVRKNLF--SLIPLRMLAMRSKPGGCSKADDHVETTVSQM-SV  792
             L L  R W + S  L++   K  F  SL  + M   R K    S+  + VE    +  S+
Sbjct  8     LSLGPRFWGEFSSFLVSWFNKGRFVVSLFQVPMKMPRKKVNLGSRVQEIVEEEEEEEPSL  67

Query  793   LDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREW  972
             LDLP+L LE ILE++ P GLC +A VCSSLR+RC SDHLWE+HLKQKWG +IG +AY+EW
Sbjct  68    LDLPELALERILERLSPAGLCSMAGVCSSLRDRCRSDHLWEKHLKQKWGRVIGESAYKEW  127

Query  973   QWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLA  1152
             QWHIA  K   L ++  +KG    L  +WP      P   +  K     P+DS+M  YL+
Sbjct  128   QWHIASSKRPSLLDKRNQKGFMGSLISMWPF-CWFKPKCESRSKPTTCLPVDSIMALYLS  186

Query  1153  LESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTW  1332
             LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD +TDTF ARY P  R    IE  + W
Sbjct  187   LESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSKTDTFQARYSPFARQT--IEQSIHW  244

Query  1333  DRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQH  1512
             +RLRAP VD PAH LH SDCL DL+PGDHIEIQWRR+K+FPYGWWY VVGH E CDGN++
Sbjct  245   ERLRAPPVDTPAHVLHTSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVVGHQELCDGNEN  304

Query  1513  YCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWK  1692
              CRC   DTVVLEF QY+PGSRWR+T ++RKDHRE GNEA+GFYGGI+K+   E IS WK
Sbjct  305   RCRCRHNDTVVLEFRQYTPGSRWRQTIINRKDHREVGNEADGFYGGIRKLCKAEEISKWK  364

Query  1693  RLWPAQVLE  1719
             +LWP Q+++
Sbjct  365   QLWPNQIVD  373



>ref|XP_002277192.2| PREDICTED: F-box protein At2g32560-like isoform X1 [Vitis vinifera]
Length=453

 Score =   422 bits (1086),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/381 (55%), Positives = 270/381 (71%), Gaps = 24/381 (6%)
 Frame = +1

Query  610   WASEFRLQLLFRLWKDL--SLLTLVRKNLFSLI---------PLRMLAMRSKPGGCSKAD  756
             W SE RL L    W++L   L++ +RK    +I         PL+M  + SK     + +
Sbjct  86    WESETRL-LSPWFWRELWSFLVSCIRKGRLGIISFLQVPFVFPLKM-TISSKVVNAEEEE  143

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D        +S+LDLP+L LECIL+++ P GLC +A VC+SLR+RC SDHLWE+H+KQKW
Sbjct  144   D--------VSLLDLPELALECILQRLSPSGLCSMARVCTSLRDRCRSDHLWEKHMKQKW  195

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G +IGPAAYREWQWHIA RK   L  +  ++GL   L  + PLS I  P L +  + +  
Sbjct  196   GRVIGPAAYREWQWHIASRKRPSLLKKCNKRGLFRSLFSVCPLSWI-RPKLESSGEPSCS  254

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
               +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD RTDTF ARY P G
Sbjct  255   LSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSRTDTFRARYSPQG  314

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
                  IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+NK+ PYGWWYG+
Sbjct  315   PQT--IEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRKNKELPYGWWYGI  372

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             + HLETC+GN+++C CH  D ++LEFNQYSPGS+WRR  ++RK+H+EEGN A+GFYGGI+
Sbjct  373   ISHLETCNGNENHCCCHNNDMLILEFNQYSPGSQWRRVVINRKNHQEEGNGADGFYGGIR  432

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ ++E IS WK  WP QVL+
Sbjct  433   KICNKEEISIWKSFWPTQVLQ  453



>ref|XP_002323241.2| hypothetical protein POPTR_0016s03510g [Populus trichocarpa]
 gb|EEF05002.2| hypothetical protein POPTR_0016s03510g [Populus trichocarpa]
Length=372

 Score =   418 bits (1075),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 209/364 (57%), Positives = 256/364 (70%), Gaps = 11/364 (3%)
 Frame = +1

Query  646   LWKDLS--LLTLVRKNLFSL----IPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPD  807
              W+  S  L++   K  F++    +PL+M    +K   CS+  + VE      S+LDLP+
Sbjct  14    FWEGFSSFLVSWFNKGRFAVSMFQVPLKMPL--TKVNLCSEVQEIVEEEGESPSLLDLPE  71

Query  808   LVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA  987
             L LECILE++ P  LC +A VC+SLR+RC SDHLWE+HLK KWG +I  AA +EWQ HIA
Sbjct  72    LALECILERLSPAELCSMAGVCNSLRDRCRSDHLWEKHLKHKWGRVICEAACKEWQCHIA  131

Query  988   LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGK  1167
              RK     +Q  +KG    L  +WP S        + +K     P+DS+M  YL+LESGK
Sbjct  132   SRKRPSFLDQRNQKGFFGSLMSMWPFS-WYKSQCESRNKPTTCLPVDSIMALYLSLESGK  190

Query  1168  FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA  1347
             FWFPAQVYNRENGHVGFMLSCYDA+LSYD +TDTF ARY P  R    IE  +  DRLRA
Sbjct  191   FWFPAQVYNRENGHVGFMLSCYDAQLSYDSKTDTFQARYSPFARRT--IEESIHRDRLRA  248

Query  1348  PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
             P V+ PAH LH SDCL DL+PGDHIEIQWRR+K+FPYGWWY VVGH E CDGN++ CRC 
Sbjct  249   PPVETPAHVLHTSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVVGHQELCDGNENRCRCR  308

Query  1528  ECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPA  1707
               DTVVLEF+QY+PGSRWR+T V+RKDHRE GNEA+GFYGGI+K+   E IS WK+LWP 
Sbjct  309   YSDTVVLEFSQYTPGSRWRQTIVNRKDHREVGNEADGFYGGIRKLYKEEEISKWKQLWPK  368

Query  1708  QVLE  1719
             Q+ +
Sbjct  369   QIFD  372



>ref|XP_008240697.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Prunus mume]
Length=396

 Score =   419 bits (1076),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 197/304 (65%), Positives = 241/304 (79%), Gaps = 6/304 (2%)
 Frame = +1

Query  817   ECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRK  996
             ECILEK+ P GLC +  VC+SLRERC  D LWERH+ +KWG +IG AAYREWQ H+A R 
Sbjct  96    ECILEKLSPSGLCTMGGVCTSLRERCRDDRLWERHMMEKWGRLIGAAAYREWQLHVASRS  155

Query  997   DSR-LFNQAKEKGL-GSYLSRLWPLSVIVGPNLGAGD-KRNNLPPIDSVMFWYLALESGK  1167
               R + +Q K+KGL  S +S+ WP S I  P L   D K     P++SVM  Y++LESGK
Sbjct  156   RVRNISDQTKKKGLFESLVSKFWPFSWI-RPKLATSDCKARTSLPVESVMSLYISLESGK  214

Query  1168  FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA  1347
             FWFPAQVYNRENG+VGFMLSCYDA++SYD RT+TF ARY P+GR A   E  + WDRLRA
Sbjct  215   FWFPAQVYNRENGNVGFMLSCYDAQVSYDSRTNTFQARYSPYGRRAT--EDNIPWDRLRA  272

Query  1348  PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
               VD P+H LH++DCL+DL+PGDHIEIQWRRNK+FPYGWWYGV+GHLE CDG++++CRCH
Sbjct  273   APVDTPSHKLHVTDCLHDLKPGDHIEIQWRRNKEFPYGWWYGVIGHLELCDGHENHCRCH  332

Query  1528  ECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPA  1707
               DTV LEF+QY+PGSRWR+ T++RKDHREEG+EA+GFYGGI+K+ + E I+ WKRLWP 
Sbjct  333   SSDTVTLEFSQYTPGSRWRQVTINRKDHREEGDEADGFYGGIRKLYNEEEIARWKRLWPT  392

Query  1708  QVLE  1719
             QVLE
Sbjct  393   QVLE  396



>ref|XP_012082552.1| PREDICTED: F-box protein At2g26850-like [Jatropha curcas]
Length=395

 Score =   418 bits (1075),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 267/375 (71%), Gaps = 14/375 (4%)
 Frame = +1

Query  616   SEFRLQLLFRL-WKDL--SLLTLVRKNLFSL----IPLRMLAMRSKPGGCSKADDHVETT  774
             SE RL LL  L W+ +   L++L  K+  ++    +P++M   +   G     ++     
Sbjct  28    SERRLLLLSPLFWEKVLNFLVSLFHKDRLAISVCKLPMKMPLKKMNLG----FEEQENIE  83

Query  775   VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGP  954
               ++S+LDLP+L LE ILE++ P  LC +A VCSSLR++C SDHLW +HL+QKWG +IG 
Sbjct  84    AEKISLLDLPELTLESILERLSPAELCSMAGVCSSLRDKCTSDHLWTKHLRQKWGRVIGD  143

Query  955   AAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSV  1134
             AA+REWQ HIA  +   L +Q+ +KGL   L  +WP + I        + R +LP +DS+
Sbjct  144   AAFREWQCHIASTQRLNLVDQSNQKGLLGSLGAVWPKTWIKPKFETKSNPRTSLP-VDSI  202

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M  YL+LE GKFWFPAQVYNRENGHVGF+LSCYDA++SYD RT+TF ARY P+GR    I
Sbjct  203   MAMYLSLERGKFWFPAQVYNRENGHVGFLLSCYDAKISYDSRTNTFQARYSPYGRRM--I  260

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
             E  + WDRLRA  VD PAHDLHISDCL DL+PGDHIEIQWRR+K+FPYGWWY +VGH++ 
Sbjct  261   EESIHWDRLRASPVDTPAHDLHISDCLDDLKPGDHIEIQWRRSKEFPYGWWYAIVGHIDP  320

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CDGN + C C   D VVLEFNQY  GSRWR+T V+RK HREEGNE +GFYGGI+K+   E
Sbjct  321   CDGNANLCNCQCDDMVVLEFNQYPLGSRWRQTIVNRKKHREEGNEVDGFYGGIRKLYKEE  380

Query  1675  VISTWKRLWPAQVLE  1719
              ISTW+RLWP+QV E
Sbjct  381   EISTWRRLWPSQVFE  395



>ref|XP_002880840.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57099.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=371

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/326 (60%), Positives = 250/326 (77%), Gaps = 10/326 (3%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D     + QMS+LDLPDL L+CIL+ + P GLC +A VCSSLRERC+SDHLWE+HLK KW
Sbjct  51    DLASPVLGQMSILDLPDLPLDCILDNLSPSGLCSMARVCSSLRERCVSDHLWEKHLKTKW  110

Query  937   GGIIGPAAYREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             G I+GP+A++EWQ +++     DS   +Q    GL   +S +  LS I    LG  + R 
Sbjct  111   GKILGPSAHKEWQCYLSSPYHLDSP-HHQTSHHGLTKIISLIRSLSSI----LGDDNHRR  165

Query  1111  NLP---PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
               P   P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  T+TF AR
Sbjct  166   RYPSSIPLDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTNTFQAR  225

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             YPPHGR A+AIE  VTW+R+RA  +D   H L++SD L +L+PGDHIEIQWRRNK+FPYG
Sbjct  226   YPPHGRRAIAIEKDVTWERIRAAPIDASPHHLYVSDSLNELKPGDHIEIQWRRNKEFPYG  285

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWY VVGHLE+CDGN ++C+CH  + +VLEFNQY+ GSRWR+T ++R+DHRE+GNE +GF
Sbjct  286   WWYSVVGHLESCDGNLNHCQCHISEMMVLEFNQYTVGSRWRKTMINRRDHREKGNEEDGF  345

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K++ +E I  WKRLWP+ +LE
Sbjct  346   YGGIRKLKCKEDIEMWKRLWPSSILE  371



>gb|EMT11595.1| hypothetical protein F775_27187 [Aegilops tauschii]
Length=403

 Score =   418 bits (1074),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/360 (57%), Positives = 257/360 (71%), Gaps = 12/360 (3%)
 Frame = +1

Query  664   LLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPP  843
             LL  V       +PL     R +P    +  D    T  + SVLDLP+L ++CIL K+PP
Sbjct  48    LLGGVASTAADAMPLMPSFKRKRPAAKLETTD----TTGEPSVLDLPELAIDCILAKLPP  103

Query  844   EGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQA-  1020
               L ++A+V  S+RERC SDHLWERH+  KWG ++G AA  EW+ +++    +       
Sbjct  104   AELRNMAAVSRSMRERCRSDHLWERHMSDKWGSVLGTAARDEWRSYLSSSTAAGGGASGC  163

Query  1021  ------KEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID-SVMFWYLALESGKFWFP  1179
                   K +   + LS + P+   + P    G   +  P +D S+M WYL LESGKFWFP
Sbjct  164   GSAGSGKHRRWLAALSCVCPVVSWMRPRADGGAGTSAGPVLDDSIMSWYLHLESGKFWFP  223

Query  1180  AQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVD  1359
             AQVYNRE+GHVGFM+SCYDAELSYD RTDTFHARYPPHGR  V +E GV WDR+RAP V+
Sbjct  224   AQVYNREHGHVGFMMSCYDAELSYDFRTDTFHARYPPHGRRTVVLEDGVQWDRIRAPRVE  283

Query  1360  NPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDT  1539
               AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGHLE+CDGN+H+CRCH  DT
Sbjct  284   TLAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGHLESCDGNEHFCRCHRSDT  343

Query  1540  VVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             VVLEFNQY+PGSRWR++ V+RKDHREEGNE++GFYGGI+K++ ++  S WK+LWP  +LE
Sbjct  344   VVLEFNQYTPGSRWRQSLVNRKDHREEGNESDGFYGGIRKLQDKDESSKWKQLWPTDILE  403



>ref|NP_001042756.1| Os01g0281000 [Oryza sativa Japonica Group]
 dbj|BAA87845.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB00648.2| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAB17744.1| OSJNBa0036E02.18 [Oryza sativa Japonica Group]
 dbj|BAB44118.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04670.1| Os01g0281000 [Oryza sativa Japonica Group]
 dbj|BAG89293.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   418 bits (1074),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 245/320 (77%), Gaps = 9/320 (3%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L +ECIL ++PP  L ++A VC S+RERC  DHLWERH+ +KWGG++G AA  
Sbjct  96    SVLDLPELAIECILARLPPSELRNMAGVCRSMRERCRGDHLWERHMSEKWGGVLGHAARE  155

Query  967   EWQWHIALRKDS-------RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI  1125
             EW+ ++A   D+        L    + +   + LS + P+   + P    G    +  P+
Sbjct  156   EWRTYLASAADTGGAAASCSLAGGGRHRRWLAALSCVCPVVSWMRPRADGGSGGKSAGPV  215

Query  1126  --DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
               DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  +DTF ARYPPHGR
Sbjct  216   LDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHSDTFRARYPPHGR  275

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
               V +E GV WDR+RAP VD  AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  276   RTVVLEDGVHWDRVRAPPVDTHAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVV  335

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHLE+CDG++H+CRCH  DTVVLEFNQY+PGSRWR+  V+RKDHREEGNE +GFYGGI+K
Sbjct  336   GHLESCDGSEHFCRCHLSDTVVLEFNQYTPGSRWRQALVNRKDHREEGNEGDGFYGGIRK  395

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + S++ IS W++LWP  +LE
Sbjct  396   LRSKDEISKWRQLWPTDILE  415



>gb|KDP29248.1| hypothetical protein JCGZ_16637 [Jatropha curcas]
Length=329

 Score =   414 bits (1065),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 196/322 (61%), Positives = 242/322 (75%), Gaps = 3/322 (1%)
 Frame = +1

Query  754   DDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
             ++       ++S+LDLP+L LE ILE++ P  LC +A VCSSLR++C SDHLW +HL+QK
Sbjct  11    EEQENIEAEKISLLDLPELTLESILERLSPAELCSMAGVCSSLRDKCTSDHLWTKHLRQK  70

Query  934   WGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             WG +IG AA+REWQ HIA  +   L +Q+ +KGL   L  +WP + I        + R +
Sbjct  71    WGRVIGDAAFREWQCHIASTQRLNLVDQSNQKGLLGSLGAVWPKTWIKPKFETKSNPRTS  130

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
             LP +DS+M  YL+LE GKFWFPAQVYNRENGHVGF+LSCYDA++SYD RT+TF ARY P+
Sbjct  131   LP-VDSIMAMYLSLERGKFWFPAQVYNRENGHVGFLLSCYDAKISYDSRTNTFQARYSPY  189

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR    IE  + WDRLRA  VD PAHDLHISDCL DL+PGDHIEIQWRR+K+FPYGWWY 
Sbjct  190   GRRM--IEESIHWDRLRASPVDTPAHDLHISDCLDDLKPGDHIEIQWRRSKEFPYGWWYA  247

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             +VGH++ CDGN + C C   D VVLEFNQY  GSRWR+T V+RK HREEGNE +GFYGGI
Sbjct  248   IVGHIDPCDGNANLCNCQCDDMVVLEFNQYPLGSRWRQTIVNRKKHREEGNEVDGFYGGI  307

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+   E ISTW+RLWP+QV E
Sbjct  308   RKLYKEEEISTWRRLWPSQVFE  329



>ref|XP_004967668.1| PREDICTED: F-box protein At2g32560-like [Setaria italica]
Length=405

 Score =   416 bits (1070),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 245/316 (78%), Gaps = 6/316 (2%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L ++CILE++PP  L ++A+VC S+RERC  DHLWERH+ +KWG ++G AA  
Sbjct  91    SVLDLPELAIDCILERLPPAELRNMAAVCRSMRERCRGDHLWERHMSEKWGRVLGHAARD  150

Query  967   EWQWHIALRKDSRLFNQA-----KEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDS  1131
             EW+ H+A   +S     A     K +   + LS + P+   + P    G K +     DS
Sbjct  151   EWRAHLASASESGGAGSATGGGGKRRRWLAALSCVCPVVSWMRPK-ADGAKSSGPVLDDS  209

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             +M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHGR  V 
Sbjct  210   IMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHGRRTVV  269

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
             +E GV WDR+RAP VD  AHDLH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGHLE
Sbjct  270   LEDGVQWDRVRAPPVDTLAHDLHASDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGHLE  329

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CDGN+H+CRCH  DTV+LEFNQY+PGSRWR+  V+RKDHREEGNE +GFYGGI+K+ S+
Sbjct  330   SCDGNEHFCRCHLSDTVLLEFNQYTPGSRWRQALVNRKDHREEGNEGDGFYGGIRKLRSK  389

Query  1672  EVISTWKRLWPAQVLE  1719
             + IS W++LWP  +LE
Sbjct  390   DDISKWRQLWPTDILE  405



>ref|XP_002455470.1| hypothetical protein SORBIDRAFT_03g011420 [Sorghum bicolor]
 gb|EES00590.1| hypothetical protein SORBIDRAFT_03g011420 [Sorghum bicolor]
Length=408

 Score =   416 bits (1070),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 196/316 (62%), Positives = 246/316 (78%), Gaps = 7/316 (2%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L ++CILE++ P  L  +A+VC S+RERC SDHLWERH+  KWG ++G AA  
Sbjct  95    SVLDLPELAIDCILERLQPAELRSMAAVCRSMRERCRSDHLWERHMTSKWGRVLGRAARD  154

Query  967   EWQWHIALRKDSRLFNQA----KEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID-S  1131
             EW+ H+A   +S   +      K +   + LS + P+   + P    G  +++ P +D S
Sbjct  155   EWRTHVASASESGAVSGGGGGGKRRRWLAALSCVCPVVSWMRPRPDGG--KSSAPVLDDS  212

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             +M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHGR  V 
Sbjct  213   IMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHGRRTVV  272

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
             +E GV WDR+RAP VD  AHDLH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGHLE
Sbjct  273   LEDGVHWDRIRAPPVDTLAHDLHTSDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGHLE  332

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CDGN+H+CRCH  DTVVLEFNQY+PGSRWR+  V+RK+HREEGNE +GFYGG++K+ S+
Sbjct  333   SCDGNEHFCRCHLSDTVVLEFNQYTPGSRWRQALVNRKEHREEGNEGDGFYGGVRKLRSK  392

Query  1672  EVISTWKRLWPAQVLE  1719
             + IS W++LWP  +LE
Sbjct  393   DDISKWRQLWPTDILE  408



>ref|XP_007202057.1| hypothetical protein PRUPE_ppa006765mg [Prunus persica]
 gb|EMJ03256.1| hypothetical protein PRUPE_ppa006765mg [Prunus persica]
Length=396

 Score =   416 bits (1068),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/304 (65%), Positives = 241/304 (79%), Gaps = 6/304 (2%)
 Frame = +1

Query  817   ECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRK  996
             ECILE++ P GLC +  VC+SLRERC  D LWERH+ +KWG +IG AAYREWQ H+A R 
Sbjct  96    ECILERLSPSGLCTMGGVCTSLRERCRDDRLWERHMMEKWGRLIGAAAYREWQLHVASRS  155

Query  997   DSR-LFNQAKEKGL-GSYLSRLWPLSVIVGPNLGAGD-KRNNLPPIDSVMFWYLALESGK  1167
               R + +Q K KGL  S +S++WP S I  P L + D K     P++SVM  YL+LESGK
Sbjct  156   RVRNISDQTKTKGLFESLVSKIWPFSWI-RPKLPSSDCKVRTSLPVESVMSLYLSLESGK  214

Query  1168  FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA  1347
             FWFPAQVYNRENG+VGFMLSCYDA++SYD RT+TF ARY P+GR A   E  + WDRLRA
Sbjct  215   FWFPAQVYNRENGNVGFMLSCYDAQVSYDSRTNTFQARYSPYGRRAT--EDNIPWDRLRA  272

Query  1348  PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
               VD P+H LH+SDCL+DL+PGDHIEIQWRRNK+FPYGWWYGV+GHLE CDG+++ CRCH
Sbjct  273   APVDTPSHKLHVSDCLHDLKPGDHIEIQWRRNKEFPYGWWYGVIGHLELCDGHENRCRCH  332

Query  1528  ECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPA  1707
               DTV LEF+QY+PGSRWR+ T++RKDHREEG+EA+GFYGGI+K+ + E I+ WKRLWP 
Sbjct  333   YSDTVTLEFSQYTPGSRWRQVTINRKDHREEGDEADGFYGGIRKLYNEEEIARWKRLWPT  392

Query  1708  QVLE  1719
             QVLE
Sbjct  393   QVLE  396



>ref|XP_011027254.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Populus euphratica]
Length=375

 Score =   414 bits (1065),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 260/373 (70%), Gaps = 14/373 (4%)
 Frame = +1

Query  628   LQLLFRLWKDLS--LLTLVRKNLFSL----IPLRMLAMRSKPGGCSKADDHVETTVSQM-  786
             L L  R W + S  L++   K  F +    +P++M   +   G  S+  + VE    +  
Sbjct  8     LSLGPRFWGEFSSFLVSWFNKGRFVVSLFQVPMKMPLKKVNLG--SRVQEIVEEEEEEEE  65

Query  787   --SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
               S+LDLP+L LE ILE++ P GLC +A VCSSLR+RC SDHLWE+HLKQKWG +IG +A
Sbjct  66    EPSLLDLPELALERILERLSPAGLCSMAGVCSSLRDRCRSDHLWEKHLKQKWGRVIGESA  125

Query  961   YREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMF  1140
             Y+EWQWHIA  K   L +Q   KG    L  +WP          +  K     P+DS+M 
Sbjct  126   YKEWQWHIASSKRPSLLDQRNRKGFMGSLISMWPF-CWFKLKCESRSKPKTCLPVDSIMA  184

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
              YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+L+YD +TDTF ARY P  R    IE 
Sbjct  185   LYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLNYDSKTDTFQARYSPFARQT--IEQ  242

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCD  1500
              + W+RLRAP VD PAH LH SDCL DL+PGDHIEIQWRR+K+FPYGWWY VVGH E CD
Sbjct  243   SIHWERLRAPPVDTPAHVLHPSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVVGHQELCD  302

Query  1501  GNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVI  1680
             GN++ C C   DTVVLEF+QY+PGSRWR+T ++RKDHRE GNEA+GFYGGI+K+ + E I
Sbjct  303   GNENRCHCRHNDTVVLEFSQYTPGSRWRQTIINRKDHREVGNEADGFYGGIRKLCNAEEI  362

Query  1681  STWKRLWPAQVLE  1719
             S WK+LWP Q ++
Sbjct  363   SKWKQLWPNQTVD  375



>ref|NP_850191.1| F-box protein [Arabidopsis thaliana]
 sp|Q8RY82.1|FB121_ARATH RecName: Full=F-box protein At2g32560 [Arabidopsis thaliana]
 gb|AAL69504.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20109.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62789.1| unknown [Arabidopsis thaliana]
 gb|AEC08700.1| F-box protein [Arabidopsis thaliana]
Length=371

 Score =   414 bits (1064),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 210/376 (56%), Positives = 259/376 (69%), Gaps = 28/376 (7%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F   K+  + TL +                         D     + 
Sbjct  21    LPPWASETKTLLSFYFIKNPFMNTLHQTK----------------------HDPASPVID  58

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMSVLDLP+L L+CIL+ +PP GLC +A VCSSLRERC+SDHLWE+HLK KWG I+GPAA
Sbjct  59    QMSVLDLPELALDCILDLLPPSGLCSMARVCSSLRERCVSDHLWEKHLKTKWGKILGPAA  118

Query  961   YREWQWHIALRK---DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDS  1131
             +REWQ +I+      DS   +Q    G    +S +  LS +   +       ++LP +DS
Sbjct  119   HREWQCYISSSTYHLDSP-HHQTGNLGFAKIISLIRSLSSVFREDKQRRGYASSLP-LDS  176

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
              M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A A
Sbjct  177   SMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRASA  236

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
             IE GVTWDR+RA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V HLE
Sbjct  237   IEKGVTWDRIRAAPIDASPHLLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGLVRHLE  296

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CDG+ ++C CH  +TVVLEFNQY+ GSRWRRT + R DH+EEGNE +GFYGGI+K+  +
Sbjct  297   SCDGDHNHCHCHLSETVVLEFNQYTVGSRWRRTMIMR-DHKEEGNEEDGFYGGIRKLNCK  355

Query  1672  EVISTWKRLWPAQVLE  1719
             E I+ WKR WP  +LE
Sbjct  356   EEIAMWKRHWPCSILE  371



>tpg|DAA54206.1| TPA: cyclin-like F-box [Zea mays]
Length=404

 Score =   414 bits (1064),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 242/313 (77%), Gaps = 4/313 (1%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L ++CILEK+ P  L  +A+VC S+RERC  DHLWERH+  +WG ++G AA  
Sbjct  94    SVLDLPELAIDCILEKLRPAELRSMAAVCRSMRERCRGDHLWERHMTNRWGRVLGRAARD  153

Query  967   EWQWHIALRKDSRLFNQA-KEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID-SVMF  1140
             EW+ H+A   +SR      K +   + LS + P+   + P    G  +++ P +D S+M 
Sbjct  154   EWRTHLASASESRAAGGGGKRRKWLAALSCVCPVVSWMRPRADGG--KSSAPVLDDSIMS  211

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
             WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDA LSYD  TDTF ARYPPHGR  V +E 
Sbjct  212   WYLSVESGKFWFPAQVYNREHGHVGFMMSCYDAALSYDFHTDTFRARYPPHGRRTVVLED  271

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCD  1500
             GV WDR+RAP VD  AHDLH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGHLE+CD
Sbjct  272   GVQWDRVRAPPVDTLAHDLHTSDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGHLESCD  331

Query  1501  GNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVI  1680
             G++H+CRCH  DTVVLEFNQY+PGSRWR+  V RK+HREEGNE +GFYGGI+K+  ++ I
Sbjct  332   GSEHFCRCHLSDTVVLEFNQYTPGSRWRQALVKRKEHREEGNEGDGFYGGIRKLRGKDDI  391

Query  1681  STWKRLWPAQVLE  1719
             S W++LWP  VLE
Sbjct  392   SKWRQLWPTDVLE  404



>ref|NP_180253.2| F-box protein [Arabidopsis thaliana]
 sp|Q6NLB1.1|FB118_ARATH RecName: Full=F-box protein At2g26850 [Arabidopsis thaliana]
 gb|AAS76708.1| At2g26850 [Arabidopsis thaliana]
 gb|AAS92339.1| At2g26850 [Arabidopsis thaliana]
 gb|AEC07898.1| F-box protein [Arabidopsis thaliana]
Length=371

 Score =   412 bits (1060),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 249/326 (76%), Gaps = 10/326 (3%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D     + +MS+LDLPDL L+CILE +PP  LC +A VCSSLRERC+SDHLWE+HLK KW
Sbjct  51    DLASPVLGKMSILDLPDLPLDCILELLPPSELCTMARVCSSLRERCVSDHLWEKHLKTKW  110

Query  937   GGIIGPAAYREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             G I+GP+A++EWQ +++     DS   ++    GL   +S +  LS I   +    D R 
Sbjct  111   GKILGPSAHKEWQCYLSSPYHLDSP-HHKTSHLGLAKIISLMRSLSSIFRDD----DHRR  165

Query  1111  NLP---PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
               P   P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  T+TF AR
Sbjct  166   RYPSSIPLDSTMNFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTDTNTFQAR  225

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             YPPHG+ A+A+E  VTW+R+RA  VD   H+L++SD L +L+PGDHIEIQWRRNK+FPYG
Sbjct  226   YPPHGKRAIAVEKDVTWERIRAAPVDASPHNLYVSDSLNELKPGDHIEIQWRRNKEFPYG  285

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWY VVGH+E+CDGN ++C+CH  + +VLEFNQY+ GSRWR+T ++R+DHRE+GNE +GF
Sbjct  286   WWYSVVGHMESCDGNLNHCQCHNSEMMVLEFNQYTVGSRWRKTMINRRDHREKGNEEDGF  345

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K+  +E I  WKRLWP+ +LE
Sbjct  346   YGGIRKINCKEDIEMWKRLWPSSILE  371



>ref|XP_002879398.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55657.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=370

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 209/375 (56%), Positives = 258/375 (69%), Gaps = 27/375 (7%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F   K+  + +L +                         D     + 
Sbjct  21    LPPWASETKTLLSFYFIKNPFMNSLHQTT----------------------HDPASPVID  58

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMSVLDLP+LVL+CIL+ +PP GLC +A VCSSLRERC+SDHLWE+HLK KWG I+GPAA
Sbjct  59    QMSVLDLPELVLDCILDLLPPSGLCSMARVCSSLRERCVSDHLWEKHLKTKWGKILGPAA  118

Query  961   YREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSV  1134
             +REWQ  I+     DS    Q    G    +S +  LS +   +       ++LP +DS 
Sbjct  119   HREWQCFISSTYHLDSP-HQQTGNLGFAKIISLIRSLSSVFRDDKQMRVYTSSLP-LDSS  176

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A A+
Sbjct  177   MSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFLARYPPHGRRAAAV  236

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
             E GVTWDR+RA  +D   H L++SD L +L+PGDHIEIQWRRNK+FPYGWWYGVVGHLE+
Sbjct  237   EKGVTWDRIRAAPIDASPHHLYVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVVGHLES  296

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CDG+ ++C C   +TVVL+FNQY+ GSRWRRT V R DH+EEGNE +GFYGGI+K+  +E
Sbjct  297   CDGDLNHCHCQLSETVVLKFNQYTVGSRWRRTMVMR-DHKEEGNEEDGFYGGIRKINCKE  355

Query  1675  VISTWKRLWPAQVLE  1719
              I+ WKR WP  +LE
Sbjct  356   EIAMWKRHWPCSILE  370



>emb|CDY34614.1| BnaC08g41730D [Brassica napus]
Length=374

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 262/378 (69%), Gaps = 29/378 (8%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F L K+L     +                +KP   S A       + 
Sbjct  21    LPPWASETKTLLSFHLSKNLVFTNTLHPT-------------TKPDPPSPA-------LG  60

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QM++LDLPDL L+ IL  +PP GL  +A VCSSLRERC+SDHLWE+HL  KWG I+GPAA
Sbjct  61    QMTILDLPDLALDRILHLLPPSGLSSMAMVCSSLRERCVSDHLWEKHLVNKWGKILGPAA  120

Query  961   YREWQWHIALRKDS-----RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI  1125
             +REW+ +++          R        G  + +S L  +S +V      GD++    P+
Sbjct  121   HREWKRYLSSSSRHLDSSPRHRTGHHPLGFDTIISCLRSISSVVR----DGDRQKKALPV  176

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
             DS M +Y++LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A
Sbjct  177   DSTMSFYVSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRA  236

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  1485
             V +E GVTW+RLRA  ++   H LH+S+ L +L+PGDHIEIQWRRNK+FPYGWWYG+VGH
Sbjct  237   VGVEKGVTWERLRAAPLEASPHHLHLSESLNELKPGDHIEIQWRRNKEFPYGWWYGIVGH  296

Query  1486  LETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
             LE+CDG+ ++C CH  +TVVLEFNQY+ GSRWRRTT++++DHREEGNE +GFYGGI+K+ 
Sbjct  297   LESCDGDLNHCHCHLSETVVLEFNQYTVGSRWRRTTINKRDHREEGNEEDGFYGGIRKLI  356

Query  1666  SREVISTWKRLWPAQVLE  1719
              +E I+ W RLWP+  LE
Sbjct  357   CKEEIAMWTRLWPSSNLE  374



>ref|XP_006294453.1| hypothetical protein CARUB_v10023466mg [Capsella rubella]
 gb|EOA27351.1| hypothetical protein CARUB_v10023466mg [Capsella rubella]
Length=370

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/374 (56%), Positives = 256/374 (68%), Gaps = 25/374 (7%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F   K+               PL     ++K        D     + 
Sbjct  21    LPPWASETKTLLSFYFIKN---------------PLMNTLHQTK-------QDLASPVLD  58

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMSVLDLPDL L+CIL+ +PP GLC +A VCSSLRE+C+SDHLWE+HLK KWG I+G AA
Sbjct  59    QMSVLDLPDLALDCILDLLPPSGLCSMARVCSSLREKCVSDHLWEKHLKAKWGKILGLAA  118

Query  961   YREWQWHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +REWQ +++         +Q    G+   +S    LS +   +       ++LP +DS M
Sbjct  119   HREWQCYLSSTDHLDSPHHQTGHLGVAKIISLFRYLSSVFRDDKQRKGYASSLP-LDSSM  177

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A A+E
Sbjct  178   SCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRAAAVE  237

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
              GVTWDRLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVVGHLE+C
Sbjct  238   KGVTWDRLRAAPIDASPHHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVVGHLESC  297

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
             DG+ ++C CH  D  VLEFNQY+ GSRWRRT + R DH+EEGNE +GFYGGI+K+ S+E 
Sbjct  298   DGDLNHCHCHLNDMAVLEFNQYTVGSRWRRTMIMR-DHKEEGNEEDGFYGGIRKLNSKEE  356

Query  1678  ISTWKRLWPAQVLE  1719
             I+ WK  WP  +LE
Sbjct  357   IAMWKHHWPCSILE  370



>ref|XP_006417291.1| hypothetical protein EUTSA_v10007953mg [Eutrema salsugineum]
 gb|ESQ35644.1| hypothetical protein EUTSA_v10007953mg [Eutrema salsugineum]
Length=375

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/376 (54%), Positives = 253/376 (67%), Gaps = 24/376 (6%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F   K+  + TL                           D       
Sbjct  21    LPPWASETKTLLSFYFSKNPFINTLQHPT---------------------TPDPASPLPH  59

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMS+LDLPDL L+ IL+ +PP GLC +A VCSSL+ERC+SD LW++HL  KWG I+GPAA
Sbjct  60    QMSILDLPDLALDRILDLLPPSGLCSMARVCSSLKERCVSDQLWDKHLMIKWGKILGPAA  119

Query  961   YREWQWHIALR---KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDS  1131
             +REW+ H++      DS         G    +S +  LS +   +     +  +  P+DS
Sbjct  120   HREWKCHLSSSYHLSDSPHHQTGHPLGFAKIVSLIRSLSSVFRDDNKQRKRCASSLPLDS  179

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
              M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR  VA
Sbjct  180   TMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRPVA  239

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
             IE GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+VGHLE
Sbjct  240   IEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIVGHLE  299

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CDGN  +C CH  + VVLEFNQY+ GSRWRRT ++++DHREEGNE +GFYGGI+K+  +
Sbjct  300   SCDGNLDHCHCHLSEMVVLEFNQYTVGSRWRRTMINKRDHREEGNEEDGFYGGIRKLSCK  359

Query  1672  EVISTWKRLWPAQVLE  1719
             E I+ W RLWP+ +LE
Sbjct  360   EEIAMWTRLWPSSILE  375



>emb|CDY34820.1| BnaA09g47460D [Brassica napus]
Length=375

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 203/377 (54%), Positives = 260/377 (69%), Gaps = 28/377 (7%)
 Frame = +1

Query  604   PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQ  783
             P WASE +  L F L K+L     +                      +K D      + Q
Sbjct  22    PPWASETKTLLSFHLSKNLLFTNTLHPT-------------------TKPDPSSSPLLDQ  62

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             M++LDLPDL L+ IL+ +PP GL  +A VCSSLRERC+SDHLWE+HL  KWG ++GPAA+
Sbjct  63    MTILDLPDLALDRILDLLPPSGLSSMAMVCSSLRERCVSDHLWEKHLVNKWGKVLGPAAH  122

Query  964   REWQWHIALRKDSRLF---NQAKEKGLG--SYLSRLWPLSVIVGPNLGAGDKRNNLPPID  1128
             REW+ +++           NQ     LG  + +S L  +S +    L  GD++    P+D
Sbjct  123   REWKRYLSSSSRHLDSSPRNQTGNHPLGFDTIISCLRYISSV----LRDGDRQRKALPVD  178

Query  1129  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  1308
             S M +Y++LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR AV
Sbjct  179   STMSFYISLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRAV  238

Query  1309  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  1488
              +E GVTW+RLRA  ++   H LH+S+ L  L+PGDHIEIQWRRNK+FPYGWWYG+VGHL
Sbjct  239   GVEKGVTWERLRAAPLEASPHHLHVSESLNQLKPGDHIEIQWRRNKEFPYGWWYGIVGHL  298

Query  1489  ETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVES  1668
             E+CDG+ ++C CH  +TVVLEFNQY+ GSRWRRT ++++DHREEGNE +GFYGGI+K+  
Sbjct  299   ESCDGDLNHCHCHLSETVVLEFNQYTVGSRWRRTMINKRDHREEGNEEDGFYGGIRKLSC  358

Query  1669  REVISTWKRLWPAQVLE  1719
             +E I+ W RLWP+  LE
Sbjct  359   KEEIAMWTRLWPSSNLE  375



>emb|CDM82916.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   411 bits (1057),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 255/360 (71%), Gaps = 12/360 (3%)
 Frame = +1

Query  664   LLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPP  843
             LL  V       +PL     R +P    +  D    T  + SVLDLP+L ++CIL K+PP
Sbjct  48    LLGGVASTAADAMPLMPSFKRKRPAAKLETTD----TTGEPSVLDLPELAIDCILAKLPP  103

Query  844   EGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQA-  1020
               L ++A+V  S+RERC SDHLWERH+  KWG ++G AA  EW+ +++    +       
Sbjct  104   AELRNMAAVSQSMRERCRSDHLWERHMSDKWGSVLGTAARDEWRSYLSSSTAAGGGASGC  163

Query  1021  ------KEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID-SVMFWYLALESGKFWFP  1179
                   K +   + LS + P+   + P    G   +  P +D S+M WYL LESGK WFP
Sbjct  164   GSAGSGKHRRWLAALSCVCPVVSWMRPRADGGAGTSAGPVLDDSIMSWYLHLESGKLWFP  223

Query  1180  AQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVD  1359
             AQVYNRE+GHVGFM+SCYDAELSYD RTDTFHARYPPHGR  V +E GV WDR+RAP V 
Sbjct  224   AQVYNREHGHVGFMMSCYDAELSYDFRTDTFHARYPPHGRRTVVLEDGVQWDRVRAPPVG  283

Query  1360  NPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDT  1539
               AHDLH SDCL++LRPG +IEIQWRRNK+FPYGWWYGVVGHLE+CDGN+H+CRC+  DT
Sbjct  284   TLAHDLHASDCLHELRPGANIEIQWRRNKEFPYGWWYGVVGHLESCDGNEHFCRCYLSDT  343

Query  1540  VVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             VVLEFNQY+PGSRWR++ V+RKDHREEGNE++GFYGGI+K++ ++ IS WK+LWP  +LE
Sbjct  344   VVLEFNQYTPGSRWRQSLVNRKDHREEGNESDGFYGGIRKLQDKDEISKWKQLWPTDILE  403



>gb|KHG29237.1| hypothetical protein F383_00101 [Gossypium arboreum]
Length=404

 Score =   411 bits (1056),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 266/378 (70%), Gaps = 6/378 (2%)
 Frame = +1

Query  595   KLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETT  774
             +L P W   F    +   ++  +L           +  +   +       ++ +DH +TT
Sbjct  30    RLFPPWDEAFTTTFMTSWFQKGTLQIFTSTTPLKKLKPKAKNLVWSSSTENQKEDHNKTT  89

Query  775   VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGP  954
              S  S+LDLP+LVL+CIL+++ P  LC ++ VCSSLRERC+SD +WE+ +K KWG +IG 
Sbjct  90    PSP-SLLDLPELVLDCILDRLQPAELCAMSGVCSSLRERCVSDDVWEKRMKGKWGKVIGD  148

Query  955   AAYREWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWP-LSVIVGPNLGAGDKRNNLPPI  1125
             AAYREWQW+IAL+  S L N  + +   S+  ++++WP LS          + +N    +
Sbjct  149   AAYREWQWYIALKNRSNLLNNQRNQSNFSFESVAKIWPFLSWFNIKPRAEKELKNGGLAV  208

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
             DS+M WYLALE+G+F FPAQVYNRENGH GF+LSCYDA+LSYD +TDTF ARY PHGR  
Sbjct  209   DSIMAWYLALETGRFSFPAQVYNRENGHAGFLLSCYDAKLSYDSKTDTFQARYSPHGRRT  268

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  1485
                E  ++WDRLRAP VD  ++DLHISD L++L+PGDHIEIQWRRN++FPYGWWYGVVGH
Sbjct  269   T--EENISWDRLRAPPVDTCSYDLHISDSLFELKPGDHIEIQWRRNREFPYGWWYGVVGH  326

Query  1486  LETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
             +E+C+GN+ +CRC + DTV+LEF QY   SRWR+T ++R++HRE GNE +GFYGGI+K+ 
Sbjct  327   MESCNGNESHCRCQDTDTVMLEFKQYPSSSRWRKTMINRENHREVGNEGDGFYGGIRKLY  386

Query  1666  SREVISTWKRLWPAQVLE  1719
             +++ IS W+ LWP QVLE
Sbjct  387   NQQEISMWQSLWPNQVLE  404



>ref|XP_009148635.1| PREDICTED: F-box protein At2g32560-like [Brassica rapa]
Length=376

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 242/320 (76%), Gaps = 9/320 (3%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMSVLDLPDL L+ ILE +PP GL  +A VCSSLRERC+SDHLWE+HL  KWG ++GPAA
Sbjct  59    QMSVLDLPDLALDRILELLPPSGLSSMARVCSSLRERCVSDHLWEKHLITKWGKVLGPAA  118

Query  961   YREWQWHIALRKDSRLFNQAKEKG-----LGSYLSRLWPLSVIVGPNLGAGDKRNNLP--  1119
             +REW+   +L     L + + + G         +S +  +S +   +     KR      
Sbjct  119   HREWK--CSLSSSYHLDSPSHQIGGHPLGFDKIISLIRSVSSVFLNDDDNKRKRYAASSL  176

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
             P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  177   PLDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTLTDTFQARYPPHGR  236

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
              AVA+E GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  237   RAVAVEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIV  296

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHLE+CDGN ++C CH  + VVLEFNQY+ GSRWRRT ++++DHREEGNE EGFYGGI+K
Sbjct  297   GHLESCDGNLNHCHCHLNEMVVLEFNQYTVGSRWRRTMINKRDHREEGNEEEGFYGGIRK  356

Query  1660  VESREVISTWKRLWPAQVLE  1719
             +  +E I+ W RLWP+ +LE
Sbjct  357   LSCKEEIAMWTRLWPSSILE  376



>emb|CDY30036.1| BnaC05g09840D [Brassica napus]
Length=374

 Score =   408 bits (1049),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 207/375 (55%), Positives = 254/375 (68%), Gaps = 25/375 (7%)
 Frame = +1

Query  604   PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQ  783
             P WASE +  L F   K L   TL                 + P   S  D        Q
Sbjct  22    PPWASETKTLLSFYFSKSLFTRTL---------------HPTTPDPASPVDH-------Q  59

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MSVLDLPDL L+ ILE +PP GL  +A VCSSLRERC+SDHLWE+HL  KWG ++GPAA+
Sbjct  60    MSVLDLPDLALDRILELLPPSGLSSMARVCSSLRERCVSDHLWEKHLITKWGKVLGPAAH  119

Query  964   REWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPL-SVIVGPNLGAGDKRNNLPPIDSV  1134
             REW+ +++     DS         G    +S +  +       +        +  P+DS 
Sbjct  120   REWKCYLSSSYHLDSPSHQTGHPLGFDKIISLIRSVFRNDDDDDNKRKRYAASSLPLDST  179

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR AVA+
Sbjct  180   MSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTLTDTFKARYPPHGRRAVAV  239

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
             E GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+VGHLE+
Sbjct  240   EKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIVGHLES  299

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CDGN ++C CH  + VVLEFNQY+ GSRWRRT ++++DHREEGNE EGFYGGI+K+  +E
Sbjct  300   CDGNLNHCHCHLNEMVVLEFNQYTVGSRWRRTMINKRDHREEGNEEEGFYGGIRKLSCKE  359

Query  1675  VISTWKRLWPAQVLE  1719
              I+ W RLWP+ +LE
Sbjct  360   EIAMWTRLWPSSILE  374



>emb|CDP09596.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   409 bits (1050),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 206/384 (54%), Positives = 268/384 (70%), Gaps = 13/384 (3%)
 Frame = +1

Query  592   FKLVPTWASEFRLQLLFRLWKDLS--LLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHV  765
             F+   TW  + R+Q +     ++S  L++   ++  +   L  L    K  G  KA++ +
Sbjct  19    FRPFGTWKRDMRMQAIPWFLGEVSRFLISWSARSKAARGFLHFLTSSLKKNGNGKAENVM  78

Query  766   ETTVS--QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
                +   + ++LDLPDL LECILE++ P  LC +A+VC+SL ERC SDHLWE+H+KQKWG
Sbjct  79    VEGLEGEEYTLLDLPDLALECILERLSPFQLCSMAAVCTSLSERCSSDHLWEKHMKQKWG  138

Query  940   GIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLS----RLWPLSVIVGPNLGAGDKR  1107
              ++G AAY++WQ +IA R  ++L    + KGL  Y S    ++W  S     N    ++R
Sbjct  139   RLVGNAAYQQWQCYIASRNRAKLQESKRGKGLLGYFSIFSDKMWNRS---RENEIVTEQR  195

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
             N+LP +DSV  WYLA+E+GKF FPAQVYNRENG VGFMLSCYDAELSYD  TDTF ARY 
Sbjct  196   NSLP-VDSVKAWYLAIETGKFRFPAQVYNRENGQVGFMLSCYDAELSYDSSTDTFIARYS  254

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
               GR    IE  + W+R+RAP VD PAH LH+SDCL+DL+PGDHIE+QWRRN+ FPYGWW
Sbjct  255   APGRRPT-IEDNIKWNRIRAPAVDIPAHVLHVSDCLHDLKPGDHIEVQWRRNRDFPYGWW  313

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLE+C G + +C+CH  D+VVLEF QY+P SRWR+T V+R+DHRE GN A+GFYG
Sbjct  314   YGVVGHLESCTGQESHCQCHLNDSVVLEFKQYAPSSRWRQTIVNRRDHREVGNGADGFYG  373

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K+ +   ISTWK LWP   LE
Sbjct  374   GIRKLCNENEISTWKSLWPTSTLE  397



>ref|XP_010509997.1| PREDICTED: F-box protein At2g32560 [Camelina sativa]
 ref|XP_010509998.1| PREDICTED: F-box protein At2g32560 [Camelina sativa]
 ref|XP_010509999.1| PREDICTED: F-box protein At2g32560 [Camelina sativa]
Length=370

 Score =   407 bits (1046),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 253/374 (68%), Gaps = 25/374 (7%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F   K+  + TL +                         D     + 
Sbjct  21    LPPWASETKTLLSFYFIKNPFMTTLHQTK----------------------QDLPSPVLD  58

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMSVLDLP+L L+CIL+ +PP  LC +A VCSSLRERC+SDHLWE+HLK KWG I+GPAA
Sbjct  59    QMSVLDLPELALDCILDLLPPSELCSMARVCSSLRERCVSDHLWEKHLKAKWGKILGPAA  118

Query  961   YREWQWHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +R+WQ +++         +Q    G    +S    LS +   +       ++LP +DS M
Sbjct  119   HRQWQCYLSSTDHLVSPHHQTGSLGFAKIISLFRSLSSVFRDDKQRRGYASSLP-LDSSM  177

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A A+E
Sbjct  178   SCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRAAAVE  237

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
              GVTWDRLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVVGHLE+C
Sbjct  238   KGVTWDRLRAAPIDASPHHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVVGHLESC  297

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
             DG+ ++C CH  +  VLEFNQY+ GSRWRRT + R DH+EEGNE +GFYGGI+K+  +E 
Sbjct  298   DGDLNHCHCHFNEMAVLEFNQYTVGSRWRRTMIMR-DHKEEGNEEDGFYGGIRKLNCKEE  356

Query  1678  ISTWKRLWPAQVLE  1719
             I+ WK  WP  +LE
Sbjct  357   IAMWKHHWPCSILE  370



>ref|NP_001151624.1| cyclin-like F-box [Zea mays]
 gb|ACG43557.1| cyclin-like F-box [Zea mays]
Length=407

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 240/316 (76%), Gaps = 7/316 (2%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L ++CILEK+ P  L  +A+VC S+RERC  DHLWERH+  +WG ++G AA  
Sbjct  94    SVLDLPELAIDCILEKLRPAELRSMAAVCRSMRERCRGDHLWERHMTNRWGRVLGRAARD  153

Query  967   EWQWHIALRKDSR----LFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID-S  1131
             EW+ H+A   +SR         K +   + LS + P+   + P    G  +++ P +D S
Sbjct  154   EWRTHLASASESRAAGGGGGGGKRRRWLAALSCVCPVVSWMRPRADGG--KSSAPVLDDS  211

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             +M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDA LSYD  TDTF ARYPPHGR  V 
Sbjct  212   IMSWYLSVESGKFWFPAQVYNREHGHVGFMMSCYDAALSYDLHTDTFRARYPPHGRRTVV  271

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
             +E GV WDR+RAP VD  AH LH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGHLE
Sbjct  272   LEDGVQWDRVRAPPVDTLAHYLHTSDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGHLE  331

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CDG++H+CRCH  DTVVLEFNQY+PGSRWR+  V RK+HREEGNE +GFYGGI+K+   
Sbjct  332   SCDGSEHFCRCHLSDTVVLEFNQYTPGSRWRQALVKRKEHREEGNEGDGFYGGIRKLRGN  391

Query  1672  EVISTWKRLWPAQVLE  1719
             + IS W++LWP  VLE
Sbjct  392   DDISKWRQLWPTDVLE  407



>ref|XP_006296486.1| hypothetical protein CARUB_v10025671mg [Capsella rubella]
 gb|EOA29384.1| hypothetical protein CARUB_v10025671mg [Capsella rubella]
Length=371

 Score =   407 bits (1045),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 242/323 (75%), Gaps = 4/323 (1%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D   T ++QMS+LDLPDL L+ IL+ +PP  LC +A VCSSLRERC+S+H WE+HL  KW
Sbjct  51    DIASTVLNQMSILDLPDLPLDYILDLLPPAELCSMARVCSSLRERCVSNHFWEKHLMTKW  110

Query  937   GGIIGPAAYREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             G I+GPAA++EWQ +I+     DS    Q +  G+   +S +  LS I   +   G   +
Sbjct  111   GNILGPAAHKEWQCYISSPYYLDSH-HQQTRHPGMAKIISLIRSLSTIFQDDNQRGIYAS  169

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             +L  +DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD  T+ F ARYPP
Sbjct  170   SLL-LDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDTHTNAFQARYPP  228

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR A+A+E  V W+R+RA  +D   H LHISD L +++PGDHIEIQWRRNK+FPYGWWY
Sbjct  229   HGRRAIAVEKDVPWERIRAAPIDASPHHLHISDSLREVKPGDHIEIQWRRNKEFPYGWWY  288

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
              VVGHLE+CDGN +YC CH  D +VLEFNQY+ GSRWR+T ++R DHRE+GNE +GFYGG
Sbjct  289   SVVGHLESCDGNLNYCHCHNSDIIVLEFNQYTIGSRWRKTMINRIDHREKGNEEDGFYGG  348

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+  +E I  WKRLWP+ +LE
Sbjct  349   IRKLNRKEEIERWKRLWPSSILE  371



>ref|XP_011000416.1| PREDICTED: F-box protein At2g26850-like [Populus euphratica]
Length=394

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 252/364 (69%), Gaps = 11/364 (3%)
 Frame = +1

Query  646   LWKDLS--LLTLVRKNLFSL----IPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPD  807
              W+  S  L++   K  F++    +PL+M    +K   CSK  + VE      S+LDLP+
Sbjct  36    FWEGFSSFLVSWFNKGRFAVSMFQVPLKMPL--TKVNLCSKVQEIVEDEGEGPSLLDLPE  93

Query  808   LVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA  987
             L LECILE++ P  LC +A VC+SLR+RC SDHLWE+HLK KWG +I  AA +EWQ HIA
Sbjct  94    LALECILERLSPADLCSMAGVCNSLRDRCRSDHLWEKHLKHKWGRVICEAACKEWQCHIA  153

Query  988   LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGK  1167
              RK     +Q  +KG    L  +WP      P   + +K     P+DS+M  YL+LESGK
Sbjct  154   SRKRPSFLDQRNQKGFFGSLMGMWPF-FWYKPQCESRNKPTTCLPVDSIMALYLSLESGK  212

Query  1168  FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA  1347
             FWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY    R    IE  + WDRLRA
Sbjct  213   FWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFQARYSLFARRT--IEESIHWDRLRA  270

Query  1348  PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
             P V+ PAH L+ SDCL DL+PGDHIEIQWRR+K+FPYGWWY VVGH E CDGN++ CRC 
Sbjct  271   PPVETPAHVLYTSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVVGHQELCDGNENRCRCR  330

Query  1528  ECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPA  1707
               DTVVLEF+QY PG+RWR+T V+RKD RE GNEA+GFYGGI+K+   E I  WK+L P 
Sbjct  331   YSDTVVLEFSQYPPGTRWRQTIVNRKDRREVGNEADGFYGGIRKLYKEEEILKWKQLLPN  390

Query  1708  QVLE  1719
             Q+ +
Sbjct  391   QIFD  394



>ref|XP_001785923.1| predicted protein [Physcomitrella patens]
 gb|EDQ49265.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   404 bits (1038),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 231/312 (74%), Gaps = 5/312 (2%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MSVLDLP+L LE IL ++PP  LC +A VC  LR+RC SDHLW+   K+KW  I+GP A+
Sbjct  1     MSVLDLPELALEGILGRLPPASLCQMAGVCQDLRKRCRSDHLWQNLFKEKWARIVGPLAF  60

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFW  1143
              EWQ  + L+ +     +   +  G  LS LW  S      L    +   +PP+DS+M W
Sbjct  61    HEWQRQLTLQAELGAATERPPRPWGWPLSCLWRFSW-----LNIQGQPAAVPPLDSLMAW  115

Query  1144  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETG  1323
             Y ALESG FWFPAQVYNRENGHVGFMLSCYDAEL+YD  TD+F ARYPPHG   + IE G
Sbjct  116   YWALESGSFWFPAQVYNRENGHVGFMLSCYDAELNYDRITDSFKARYPPHGPRTIVIEEG  175

Query  1324  VTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDG  1503
             V W+RLRAP +D PAHDLH SDCL +L+PGDH+E+QWRRNK+FPYGWWYGVVGH E CDG
Sbjct  176   VRWERLRAPPLDTPAHDLHQSDCLIELQPGDHVEVQWRRNKEFPYGWWYGVVGHSEACDG  235

Query  1504  NQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVIS  1683
             N  +CRCH  +TV LEF+QY+ GSRWRR  ++RK HREEGNEAEGFYGGI+K+ ++E I+
Sbjct  236   NSRHCRCHSIETVWLEFSQYTLGSRWRRAAINRKSHREEGNEAEGFYGGIRKLRTKEEIN  295

Query  1684  TWKRLWPAQVLE  1719
              WKRLWP + LE
Sbjct  296   IWKRLWPTETLE  307



>ref|XP_007015246.1| F-box family protein isoform 2 [Theobroma cacao]
 gb|EOY32865.1| F-box family protein isoform 2 [Theobroma cacao]
Length=357

 Score =   406 bits (1043),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/329 (62%), Positives = 241/329 (73%), Gaps = 12/329 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRK-------NLFSLIPLRMLAMRSKPG  738
             KSL  K +P WA+E RL  L+  WK++   ++ +        + F+ IP +M     K  
Sbjct  17    KSLTLKPLPPWATEMRLLSLW-FWKEVPFFSISKSIKNSLSLSFFTTIPSKM--SLKKIS  73

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
               SK D+  E     MSVLDLP+LVLECILEK+PP GLC +A VCSSLR RC+SDH WE+
Sbjct  74    FTSKVDNFEEIEEGVMSVLDLPELVLECILEKLPPAGLCSMAGVCSSLRSRCISDHFWEK  133

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAG  1098
             H+K+KWG +IGPAAYREWQWHIA RKDS    Q K KGL   LS + P   I    +   
Sbjct  134   HMKEKWGRVIGPAAYREWQWHIASRKDSSHVKQGKPKGLMRILSIIRPFWWI-KLKVDDS  192

Query  1099  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
              K+++LP  DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDP T+TF A
Sbjct  193   SKQSSLPD-DSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPGTETFQA  251

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR AVAIE  V W+RLRAP +D   HDLHISDCL +LRPGD+IEIQWRRNK+FPY
Sbjct  252   RYPPHGRRAVAIENCVPWERLRAPPIDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPY  311

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVV  1545
             GWWYGVVGHLE+CDGN++YCRCH    +V
Sbjct  312   GWWYGVVGHLESCDGNENYCRCHNSVFMV  340



>ref|XP_003567352.1| PREDICTED: F-box protein At2g32560-like [Brachypodium distachyon]
Length=411

 Score =   408 bits (1048),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/321 (60%), Positives = 243/321 (76%), Gaps = 10/321 (3%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             S+LDLP+L ++CIL ++PP  L ++A+VC S+R+RC +DHLWE H+  KWG ++G AA  
Sbjct  91    SLLDLPELTIDCILARLPPAELRNMAAVCRSMRDRCRADHLWESHMSDKWGPVMGAAARE  150

Query  967   EWQWHIALRKDSRLFNQ---------AKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP  1119
             EW+ +++    +               K +   + LS + P+   + P    G  ++  P
Sbjct  151   EWRSYLSSSSAADGGGGAAGCGSGGGVKRRRWLAALSCVCPVVSWIRPRADGGAGKSAGP  210

Query  1120  PID-SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
              +D SVM WYL +ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHG
Sbjct  211   VLDDSVMSWYLHMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHG  270

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R  V +E GV WDR+RAP VD  AHDLH+SDCL++LRPGD IEIQWRRNK+FPYGWWYGV
Sbjct  271   RRTVVLEDGVQWDRVRAPPVDTLAHDLHVSDCLHELRPGDSIEIQWRRNKEFPYGWWYGV  330

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLE+CDGN+H+CRCH  DT+VLEFNQY+PGSRWR++ V+RKDHREEGNE +GFYGGI+
Sbjct  331   VGHLESCDGNEHFCRCHLSDTIVLEFNQYTPGSRWRQSLVNRKDHREEGNEGDGFYGGIR  390

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ S++ IS WK+LWP  +LE
Sbjct  391   KLHSKDEISKWKQLWPIDILE  411



>ref|XP_009118163.1| PREDICTED: F-box protein At2g32560-like [Brassica rapa]
Length=374

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 261/377 (69%), Gaps = 29/377 (8%)
 Frame = +1

Query  604   PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQ  783
             P WASE +  L F L K+L         LF+      L   +KP   S A D       Q
Sbjct  22    PPWASETKTLLSFHLSKNL---------LFT----NTLHPTTKPDPPSPALD-------Q  61

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             M++LDLPDL L+ IL+ +PP GL  +A VCSS RERC++DHLWE+HL  KWG ++GPAA+
Sbjct  62    MTILDLPDLALDRILDLLPPSGLSSMAMVCSSFRERCVNDHLWEKHLVNKWGKVLGPAAH  121

Query  964   REWQWHIALRKDS-----RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID  1128
             REW+ +++          R        G  + +S L  +S +    L  GD++    P+D
Sbjct  122   REWKRYLSSSSSHLDSSPRHQTSHHPLGFDTIISCLRSISSV----LRDGDRQRKALPVD  177

Query  1129  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  1308
             S M +Y++LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR AV
Sbjct  178   STMSFYISLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTITDTFQARYPPHGRRAV  237

Query  1309  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  1488
              +E GVTW+RLRA  ++   H LH+S+ L  L+PGDHIEIQWRRNK+FPYGWWYG+VGHL
Sbjct  238   GVEKGVTWERLRAAPLEASPHHLHVSESLNQLKPGDHIEIQWRRNKEFPYGWWYGIVGHL  297

Query  1489  ETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVES  1668
             E+CDG+ ++C CH  +TVVLEFNQY+ GSRWRRT +++ DHREEGNE +GFYGGI+K+  
Sbjct  298   ESCDGDLNHCHCHLSETVVLEFNQYTVGSRWRRTMINKSDHREEGNEEDGFYGGIRKLSC  357

Query  1669  REVISTWKRLWPAQVLE  1719
             +E I+ W RLWP+  LE
Sbjct  358   KEEIAMWTRLWPSSNLE  374



>ref|XP_010469573.1| PREDICTED: F-box protein At2g32560-like [Camelina sativa]
Length=370

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 253/374 (68%), Gaps = 25/374 (7%)
 Frame = +1

Query  601   VPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVS  780
             +P WASE +  L F   K+  + TL +                         D     + 
Sbjct  21    LPPWASETKTLLSFYFIKNPFMTTLHQTK----------------------QDLPPPVLD  58

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             QMSVLDLP+L L+CIL+ +PP  LC +A VCSSLRERC+SDHLWE+HLK KWG I+GPAA
Sbjct  59    QMSVLDLPELALDCILDLLPPSELCSMARVCSSLRERCVSDHLWEKHLKAKWGKILGPAA  118

Query  961   YREWQWHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +R+WQ +++         +Q    G    +S    LS +   +       ++LP +DS M
Sbjct  119   HRQWQCYLSSTDHLVSPHHQTGRLGFAKIISLFRSLSSVFRDDNQRRGYASSLP-LDSSM  177

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A A+E
Sbjct  178   SCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRAAAVE  237

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
              GVTWDRLRA  +D   H LH+SD L +LRPGDHIEIQWRRNK+FPYGWWYGVVGHLE+C
Sbjct  238   KGVTWDRLRAAPIDASPHHLHVSDSLKELRPGDHIEIQWRRNKEFPYGWWYGVVGHLESC  297

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
             DG+ ++C CH  +  VLEFNQY+ GSRWRRT + R DH+EEGNE +GFYGG++K+  +E 
Sbjct  298   DGDLNHCHCHFNEMAVLEFNQYTVGSRWRRTMIMR-DHKEEGNEEDGFYGGVRKLNGKEE  356

Query  1678  ISTWKRLWPAQVLE  1719
             I+ WK  WP  +LE
Sbjct  357   IAMWKHHWPCSILE  370



>dbj|BAJ88045.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   404 bits (1039),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 248/349 (71%), Gaps = 13/349 (4%)
 Frame = +1

Query  700   IPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSS  879
             +PL     R +P    ++ D       + SVLDLP+L ++CIL K+PP  L ++A+V  S
Sbjct  62    MPLMPSFKRKRPAAKVESTD----MTGEPSVLDLPELAIDCILAKLPPAELRNMAAVSRS  117

Query  880   LRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLW  1059
             +RERC SDHLWE H+  KWG ++G AA  EW+ +++    +            S   R W
Sbjct  118   MRERCRSDHLWESHMSNKWGSVLGTAARDEWRAYLSSSTAAGGGASGYCGSAASGKHRRW  177

Query  1060  --------PLSVIVGPNLGAGDKRNNLPPID-SVMFWYLALESGKFWFPAQVYNRENGHV  1212
                     P+   + P    G   +  P +D S+M  YL +ESGKFWFPAQVYNRE+GHV
Sbjct  178   LAALSCVCPVVSWMRPRAEGGAGMSAGPVLDDSIMSCYLHMESGKFWFPAQVYNREHGHV  237

Query  1213  GFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDC  1392
             GFM+SCYDAE+SYD RTDTFHARYPPHGR  V +E GV W+R+RAP V+  AHDLH SDC
Sbjct  238   GFMMSCYDAEVSYDFRTDTFHARYPPHGRRTVVLEDGVQWERVRAPPVETLAHDLHASDC  297

Query  1393  LYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPG  1572
             L++LRPGD+IEIQWRRNK+FPYGWWYGVVGHLE+CDGN+H+CRCH  D VVLEFNQY+PG
Sbjct  298   LHELRPGDNIEIQWRRNKEFPYGWWYGVVGHLESCDGNEHFCRCHLSDIVVLEFNQYTPG  357

Query  1573  SRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             SRWR++ V+RKDHREEGNE++GFYGGI+K++ ++ IS WK+LWP   LE
Sbjct  358   SRWRQSLVNRKDHREEGNESDGFYGGIRKLQDKDEISKWKQLWPTDTLE  406



>emb|CDX98095.1| BnaA06g08460D [Brassica napus]
Length=372

 Score =   403 bits (1035),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 254/377 (67%), Gaps = 31/377 (8%)
 Frame = +1

Query  604   PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQ  783
             P WASE +  L F   K L   TL                 + P   S  D        Q
Sbjct  22    PPWASETKTFLSFYFSKSLFTKTL---------------HPTTPDPASPVDH-------Q  59

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MSVLDLPDL L+ ILE +PP GL  +A VCSSLRERC+SDHLWE+HL  KWG ++GPAA+
Sbjct  60    MSVLDLPDLALDRILELLPPSGLSSMAKVCSSLRERCVSDHLWEKHLVSKWGKVLGPAAH  119

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN-----NLPPID  1128
             REW+ +++    S           G  L     +S+I    L   D +      +  P+ 
Sbjct  120   REWKCYLS----SSCHLDCPRSQTGHPLGFDKIISLIRSVFLNDDDNKRKRYAASSLPLY  175

Query  1129  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  1308
             S M + L+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR AV
Sbjct  176   STMSFCLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTLTDTFLARYPPHGRRAV  235

Query  1309  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  1488
             A+E GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+VGHL
Sbjct  236   AVEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIVGHL  295

Query  1489  ETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVES  1668
             E+CDGN ++C CH  + VVLEFNQY+ GSRWRRT ++++DHREEGNE EGFYGGI+K+  
Sbjct  296   ESCDGNLNHCHCHLNEMVVLEFNQYTVGSRWRRTMINKRDHREEGNEEEGFYGGIRKLSC  355

Query  1669  REVISTWKRLWPAQVLE  1719
             +E I+ W RLWP+ +LE
Sbjct  356   KEEIAMWTRLWPSSILE  372



>ref|XP_009618519.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Nicotiana 
tomentosiformis]
Length=393

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 240/326 (74%), Gaps = 4/326 (1%)
 Frame = +1

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             SK ++ VE    ++S+L+LPDL LECI E++PP GLC +A+VCSSLRE+C SDHLWE+H+
Sbjct  71    SKLENVVEKE-EEISLLELPDLTLECIFERLPPNGLCSMAAVCSSLREKCKSDHLWEKHM  129

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLF-NQAKEKGLGSYLSRLWPLSVIVGPNLGAGD  1101
             K+KWG +IG AAYREWQ +IA R +  L  N  K+K L    S +  L            
Sbjct  130   KEKWGALIGSAAYREWQCYIASRNNVFLLENSRKKKDLLGKFSEIRQLLWNRSKGNEDNS  189

Query  1102  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
             K  +   + S+M WYL+LESGKFWF AQV+NRENGHVGFMLSCYDAE+SYD  T+TF AR
Sbjct  190   KVRSSSAMSSIMDWYLSLESGKFWFSAQVFNRENGHVGFMLSCYDAEVSYDCSTNTFRAR  249

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             YP  GR  V  E  + W+RLRAP VD P + LHISDCL DL+P DH EIQWR++K+FPYG
Sbjct  250   YPTQGRRIV--EENIEWNRLRAPTVDTPPYVLHISDCLNDLKPDDHFEIQWRKSKEFPYG  307

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYG VGHLE+C+GN+  C CH  DTV+LEF QY+PGSRWR+  ++RK+HRE GNEA+GF
Sbjct  308   WWYGAVGHLESCNGNELNCHCHSSDTVLLEFKQYTPGSRWRQIVINRKEHREVGNEADGF  367

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K+ S + IS WK LWP+  LE
Sbjct  368   YGGIRKLYSDKEISLWKSLWPSSTLE  393



>ref|XP_010413981.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Camelina 
sativa]
 ref|XP_010413982.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Camelina 
sativa]
Length=370

 Score =   402 bits (1032),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 239/318 (75%), Gaps = 5/318 (2%)
 Frame = +1

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
              + QMSVLDLP+L L+CIL+ +PP  LC +A VCSSLRERC+SDHLWE+HLK KWG I+G
Sbjct  56    VLDQMSVLDLPELALDCILDLLPPSELCSMARVCSSLRERCVSDHLWEKHLKAKWGKILG  115

Query  952   PAAYREWQWHIALRK--DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI  1125
             PAA+R+WQ +++     DS   +Q    G    +S    LS +   +       ++LP +
Sbjct  116   PAAHRQWQCYLSSTDHLDSPR-HQTGRLGFAKIISMFRSLSSLFRDDKQRRGYASSLP-L  173

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
             DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A
Sbjct  174   DSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRA  233

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  1485
              A+E GVTWDRLRA  +D   + LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  234   AAVEKGVTWDRLRAAPIDASPNHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVVGH  293

Query  1486  LETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
             LE+CDG+ ++C CH  +  VLEFNQY+ GSRWRRT + R DH+EEGNE +GFYGGI+K+ 
Sbjct  294   LESCDGDLNHCHCHFNEMAVLEFNQYTVGSRWRRTMIMR-DHKEEGNEEDGFYGGIRKLN  352

Query  1666  SREVISTWKRLWPAQVLE  1719
              +E I+ WK  WP  +LE
Sbjct  353   CKEEIAMWKHHWPCSILE  370



>ref|XP_010910139.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Elaeis guineensis]
Length=373

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 209/390 (54%), Positives = 259/390 (66%), Gaps = 41/390 (11%)
 Frame = +1

Query  577   YKSLAFKLVPTWASEFRL-------QLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKP  735
             +K L  + +P+WASE  L       + L+ L K L   +L+   + S+        R  P
Sbjct  16    FKFLPLQPMPSWASEVTLLSNLFWKEFLYSLVKSLRNCSLLSARILSISSSMSSKRRCAP  75

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                      +E     MSVLDLP+L LECIL K+ P GLC++A+V SSLR+RC SDHLWE
Sbjct  76    RV------EIEEESVDMSVLDLPELALECILGKLSPAGLCNMAAVSSSLRDRCRSDHLWE  129

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSR--LFNQAKEKGLGSYLSRLWPLSVIVGPNL  1089
             RH+K+KWG +IG  AYR+WQ + A RKDS   +    K+K      S +WPLS +    +
Sbjct  130   RHMKEKWGRVIGGVAYRDWQLYSASRKDSLGGVVGSTKQKKWIGAFSCVWPLSWLKS-RI  188

Query  1090  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
              +  K +N  P DS+M WYL+LESGKFWFPAQVYNRE+GHVGFMLSCYDAE+SYD  TDT
Sbjct  189   ESSSKPSNPLPDDSIMSWYLSLESGKFWFPAQVYNREHGHVGFMLSCYDAEISYDHHTDT  248

Query  1270  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  1449
             FHARYPPHGR  + IE GV WDR+RAP VD PAHDLHISDCL DL PGDHIEIQWRRNK+
Sbjct  249   FHARYPPHGRRTIVIEEGVQWDRIRAPPVDTPAHDLHISDCLNDLHPGDHIEIQWRRNKE  308

Query  1450  FPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNE  1629
             FPY                         DT++LEFNQY+PGS+WRR +V+RKDHRE GNE
Sbjct  309   FPY-------------------------DTIILEFNQYTPGSKWRRASVNRKDHREGGNE  343

Query  1630  AEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
              +GFYGGI+K+ S+  I+ WK++WP +VLE
Sbjct  344   TDGFYGGIRKLHSKYEIAKWKKMWPTEVLE  373



>ref|XP_001777099.1| predicted protein [Physcomitrella patens]
 gb|EDQ58092.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   397 bits (1021),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 227/320 (71%), Gaps = 5/320 (2%)
 Frame = +1

Query  760   HVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
             H       +SVLDLP+LVLE IL ++PP  LC +A VC  LR RC SDHLW+  L++KW 
Sbjct  8     HKNEDSEHISVLDLPELVLEEILGRLPPASLCQMAGVCQDLRRRCRSDHLWKTLLEEKWA  67

Query  940   GIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP  1119
              ++GP+A++EWQ  + L  +     +   +  G  LS  WPL       L   ++   +P
Sbjct  68    RVVGPSAFQEWQRQVILTAEQAPPAERPPRIWGWPLSCFWPLKW-----LNLQNQTPAVP  122

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
             P DS+M WY ALESG FWFPAQVYNRENGHVGFMLSCYDAEL+YD +TD F ARYPPHG+
Sbjct  123   PPDSLMAWYWALESGSFWFPAQVYNRENGHVGFMLSCYDAELNYDRQTDAFKARYPPHGQ  182

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
                 +E GV W+RLRAP VD PA  LH SDCL DL+PGDH+E+QWRRNK FPYGWWYGVV
Sbjct  183   RTAVVEEGVQWERLRAPPVDTPAQVLHQSDCLADLQPGDHVEVQWRRNKDFPYGWWYGVV  242

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GH E C+GN  +CRCH  DTV LEFNQY  GSRWRR  ++RK HREEGNE EGFYGGI+K
Sbjct  243   GHSEACEGNTRHCRCHFLDTVWLEFNQYMVGSRWRRAAINRKSHREEGNEEEGFYGGIRK  302

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + SRE I TW  LWP + L+
Sbjct  303   LTSREAIGTWNDLWPTEDLQ  322



>ref|XP_004290535.1| PREDICTED: F-box protein At2g32560-like [Fragaria vesca subsp. 
vesca]
Length=402

 Score =   400 bits (1028),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 252/352 (72%), Gaps = 10/352 (3%)
 Frame = +1

Query  688   LFSLIPLRMLAMRSKPGGCSKADDHV--ETTVSQMSVLDLPDLVLECILEKVPPEGLCHL  861
             L   I  R+  M  K  G  +  ++V  E     + +LDLPDL +ECILEK+ P GLC +
Sbjct  53    LLQPISFRVKHMVMKSSGSREVLENVDQEQPGGHVCLLDLPDLTMECILEKLSPSGLCSM  112

Query  862   ASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREW--QWHIALRKDSRLFNQAKEKGL  1035
             A VC+S+R+RC+ DH WE+H+KQKWG +IG AAYREW  Q   + R+ +   +Q K+K +
Sbjct  113   AGVCTSMRDRCIRDHFWEKHMKQKWGKLIGAAAYREWELQHTDSARRRNNQSDQTKKKSV  172

Query  1036  GSYLSRLWPL-SVIVGPNLGAGDKRNNLP---PIDSVMFWYLALESGKFWFPAQVYNREN  1203
                LS L    S ++ P L +   +       P+DSVM  YL+LE G FWFPAQVYNREN
Sbjct  173   FDSLSGLLQFCSWVIRPKLQSCRVKTTSATTLPVDSVMSLYLSLEIGDFWFPAQVYNREN  232

Query  1204  GHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHI  1383
             G+VGFMLSCYDA+L YD  +DTF ARY P+GR    +E  + WDR+RA  VD P+H LH+
Sbjct  233   GNVGFMLSCYDAQLRYDSGSDTFQARYSPYGRRT--MEENIPWDRIRAAPVDTPSHMLHV  290

Query  1384  SDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQY  1563
             SDCL+DL+PGDHIEIQWRR+K+FPYGWWYGV+GH E C+G++++C CH  DTVVLEF+QY
Sbjct  291   SDCLHDLKPGDHIEIQWRRSKEFPYGWWYGVIGHFELCNGSENHCHCHYNDTVVLEFSQY  350

Query  1564  SPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +PGSRWR+  ++RK HREEGNEA+GFYGGI+K+ + E I+ WK LWP QVLE
Sbjct  351   TPGSRWRQMMINRKYHREEGNEADGFYGGIRKLYNVEEIAKWKLLWPNQVLE  402



>ref|XP_010413980.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Camelina 
sativa]
Length=409

 Score =   400 bits (1028),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/317 (61%), Positives = 237/317 (75%), Gaps = 3/317 (1%)
 Frame = +1

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
              + QMSVLDLP+L L+CIL+ +PP  LC +A VCSSLRERC+SDHLWE+HLK KWG I+G
Sbjct  95    VLDQMSVLDLPELALDCILDLLPPSELCSMARVCSSLRERCVSDHLWEKHLKAKWGKILG  154

Query  952   PAAYREWQWHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPID  1128
             PAA+R+WQ +++         +Q    G    +S    LS +   +       ++LP +D
Sbjct  155   PAAHRQWQCYLSSTDHLDSPRHQTGRLGFAKIISMFRSLSSLFRDDKQRRGYASSLP-LD  213

Query  1129  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  1308
             S M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A 
Sbjct  214   SSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRAA  273

Query  1309  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  1488
             A+E GVTWDRLRA  +D   + LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVVGHL
Sbjct  274   AVEKGVTWDRLRAAPIDASPNHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVVGHL  333

Query  1489  ETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVES  1668
             E+CDG+ ++C CH  +  VLEFNQY+ GSRWRRT + R DH+EEGNE +GFYGGI+K+  
Sbjct  334   ESCDGDLNHCHCHFNEMAVLEFNQYTVGSRWRRTMIMR-DHKEEGNEEDGFYGGIRKLNC  392

Query  1669  REVISTWKRLWPAQVLE  1719
             +E I+ WK  WP  +LE
Sbjct  393   KEEIAMWKHHWPCSILE  409



>ref|XP_009618518.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   399 bits (1024),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/328 (59%), Positives = 240/328 (73%), Gaps = 6/328 (2%)
 Frame = +1

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             SK ++ VE    ++S+L+LPDL LECI E++PP GLC +A+VCSSLRE+C SDHLWE+H+
Sbjct  71    SKLENVVEKE-EEISLLELPDLTLECIFERLPPNGLCSMAAVCSSLREKCKSDHLWEKHM  129

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLF-NQAKEKGLGSYLSRLWPLSVIVGPNLGAGD  1101
             K+KWG +IG AAYREWQ +IA R +  L  N  K+K L    S +  L            
Sbjct  130   KEKWGALIGSAAYREWQCYIASRNNVFLLENSRKKKDLLGKFSEIRQLLWNRSKGNEDNS  189

Query  1102  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYDPRTDTFH  1275
             K  +   + S+M WYL+LESGKFWF AQV+NRE  NGHVGFMLSCYDAE+SYD  T+TF 
Sbjct  190   KVRSSSAMSSIMDWYLSLESGKFWFSAQVFNREVQNGHVGFMLSCYDAEVSYDCSTNTFR  249

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYP  GR  V  E  + W+RLRAP VD P + LHISDCL DL+P DH EIQWR++K+FP
Sbjct  250   ARYPTQGRRIV--EENIEWNRLRAPTVDTPPYVLHISDCLNDLKPDDHFEIQWRKSKEFP  307

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYG VGHLE+C+GN+  C CH  DTV+LEF QY+PGSRWR+  ++RK+HRE GNEA+
Sbjct  308   YGWWYGAVGHLESCNGNELNCHCHSSDTVLLEFKQYTPGSRWRQIVINRKEHREVGNEAD  367

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVLE  1719
             GFYGGI+K+ S + IS WK LWP+  LE
Sbjct  368   GFYGGIRKLYSDKEISLWKSLWPSSTLE  395



>ref|XP_010055882.1| PREDICTED: F-box protein At2g26850-like [Eucalyptus grandis]
 gb|KCW90030.1| hypothetical protein EUGRSUZ_A02233 [Eucalyptus grandis]
Length=395

 Score =   395 bits (1016),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 257/380 (68%), Gaps = 18/380 (5%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHV  765
             L+F +     S F +    R+  +  L+    K + +  P ++L ++  PG         
Sbjct  32    LSFPIAWGQLSSFFMSFFHRIKLNQVLMMKPLKKM-TTGPSQVLQVQDFPGE--------  82

Query  766   ETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGI  945
                  + S+LDLP+L L+CILE++ P GLC +A VCSS+RE+C SDHLWE+H+KQKW  +
Sbjct  83    ----EKFSLLDLPELTLDCILERLSPAGLCSMAEVCSSMREKCRSDHLWEKHMKQKWNRL  138

Query  946   IGPAAYREWQWHIALRKDSRLFNQAKEKGLGS-YLSRLWPLSVIVGPNLGAG-DKRNNLP  1119
             IG AA REWQ  +A RK   L    +  G     L R+WP + +  PNL  G +K  +  
Sbjct  139   IGDAATREWQCQLASRKRPSLCGLDRRNGFKKDLLFRVWPFTWMR-PNLECGSNKPRSDF  197

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
             P+DS+M  YL+LE+GKFWFPAQVYNRENGH GFMLSCYDA +SYD RTDTF ARY   GR
Sbjct  198   PVDSIMCLYLSLENGKFWFPAQVYNRENGHSGFMLSCYDAHVSYDSRTDTFQARYSSPGR  257

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
               V  E  + WDRLRAP +  P H+LH SDCL DLRPGDHIEIQWR++K+FPYGWWYGVV
Sbjct  258   RTV--EENIPWDRLRAPPISTPPHELHNSDCLNDLRPGDHIEIQWRKSKEFPYGWWYGVV  315

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHLE+CDGN  +CRCH  D ++LEFNQY   SRWRRT ++RK+H+E G E  GFYGGI+K
Sbjct  316   GHLESCDGNGDHCRCHYSDNMMLEFNQYPFDSRWRRTIINRKEHKEAGTEGNGFYGGIRK  375

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + + E ISTWK L P+ V+E
Sbjct  376   LYANEEISTWKGLRPSHVME  395



>gb|EEC70414.1| hypothetical protein OsI_01411 [Oryza sativa Indica Group]
Length=382

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 237/320 (74%), Gaps = 19/320 (6%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L +ECIL ++PP  L ++A VC S+RERC  DHLWERH+ +KWGG++G AA  
Sbjct  73    SVLDLPELAIECILARLPPSELRNMAGVCRSMRERCRGDHLWERHMSEKWGGVLGHAARE  132

Query  967   EWQWHIALRKDS-------RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI  1125
             EW+ ++A   D+        L    + +   + LS + P+   + P    G    +  P+
Sbjct  133   EWRTYLASAADTGGAAASCSLAGGGRHRRWLAALSCVCPVVSWMRPRADGGSGGKSAGPV  192

Query  1126  --DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
               DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  +DTF ARYPPHGR
Sbjct  193   LDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHSDTFRARYPPHGR  252

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
               V +E GV WDR+RAP VD  AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  253   RTVVLEDGVHWDRVRAPPVDTHAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVV  312

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHLE+CDGN          TVVLEFNQY+PGSRWR+  V+RKDHREEGNE +GFYGGI+K
Sbjct  313   GHLESCDGN----------TVVLEFNQYTPGSRWRQALVNRKDHREEGNEGDGFYGGIRK  362

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + S++ IS W++LWP  +LE
Sbjct  363   LRSKDEISKWRQLWPTDILE  382



>gb|EEE54342.1| hypothetical protein OsJ_01321 [Oryza sativa Japonica Group]
Length=382

 Score =   394 bits (1013),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 237/320 (74%), Gaps = 19/320 (6%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             SVLDLP+L +ECIL ++PP  L ++A VC S+RERC  DHLWERH+ +KWGG++G AA  
Sbjct  73    SVLDLPELAIECILARLPPSELRNMAGVCRSMRERCRGDHLWERHMSEKWGGVLGHAARE  132

Query  967   EWQWHIALRKDS-------RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI  1125
             EW+ ++A   D+        L    + +   + LS + P+   + P    G    +  P+
Sbjct  133   EWRTYLASAADTGGAAASCSLAGGGRHRRWLAALSCVCPVVSWMRPRADGGSGGKSAGPV  192

Query  1126  --DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
               DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  +DTF ARYPPHGR
Sbjct  193   LDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHSDTFRARYPPHGR  252

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
               V +E GV WDR+RAP VD  AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  253   RTVVLEDGVHWDRVRAPPVDTHAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVV  312

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHLE+CDGN          TVVLEFNQY+PGSRWR+  V+RKDHREEGNE +GFYGGI+K
Sbjct  313   GHLESCDGN----------TVVLEFNQYTPGSRWRQALVNRKDHREEGNEGDGFYGGIRK  362

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + S++ IS W++LWP  +LE
Sbjct  363   LRSKDEISKWRQLWPTDILE  382



>ref|XP_009768151.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Nicotiana 
sylvestris]
Length=383

 Score =   394 bits (1013),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 236/322 (73%), Gaps = 6/322 (2%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             ++VE    ++S+LDLPDL LECI E++PP GLC +A+VCS LRE+C SDHLWE+H+K+KW
Sbjct  67    ENVEKKEDEISLLDLPDLTLECIFERLPPNGLCSMAAVCSYLREKCTSDHLWEKHMKEKW  126

Query  937   GGIIGPAAYREWQWHIALRK-DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             G +IG AAYREWQ +IA R  DS L N  K++ L   L +   +   +       +  + 
Sbjct  127   GALIGSAAYREWQCYIASRNNDSLLENSRKKRDL---LGKFSEIRKFLWNRSKGNEDNSK  183

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
             +    ++M WYL+LESG FWF AQV+NRENGHVGF LSCYDAE+SYD  T+TF ARYP  
Sbjct  184   VRSSSAIMDWYLSLESGTFWFSAQVFNRENGHVGFTLSCYDAEVSYDCNTNTFRARYPSQ  243

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR  V  E  + W+RLRAP VD P + LH+SDCL DL+P DH EIQWR++K+F YGWWYG
Sbjct  244   GRRIV--EENIEWNRLRAPTVDTPPYVLHVSDCLSDLKPDDHFEIQWRKSKEFAYGWWYG  301

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             VVGHLE+C+GN+  C CH  DTV+LEF QY+PGSRWR+  ++RK+HRE GNEA+GFYGGI
Sbjct  302   VVGHLESCNGNKLNCHCHSSDTVLLEFKQYTPGSRWRQIVINRKEHREVGNEADGFYGGI  361

Query  1654  QKVESREVISTWKRLWPAQVLE  1719
             +K+ S + IS WK L P+  LE
Sbjct  362   RKLYSDKEISLWKSLCPSSTLE  383



>emb|CAN79391.1| hypothetical protein VITISV_034661 [Vitis vinifera]
Length=313

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/312 (59%), Positives = 232/312 (74%), Gaps = 14/312 (4%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S+LDLP+L LECIL+++ P GLC +A            DHLWE+H+KQKWG +IGPAAY
Sbjct  16    VSLLDLPELALECILQRLSPSGLCSMAR-----------DHLWEKHMKQKWGRVIGPAAY  64

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFW  1143
             REWQWHIA RK   L  +  ++GL   L  + PLS I  P L +  + +    +DS+  W
Sbjct  65    REWQWHIASRKRPSLLKKCNKRGLFRSLFSVCPLSWI-RPKLESSGEPSCSLSVDSIKAW  123

Query  1144  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETG  1323
             YL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD RTDTF ARY P G     IE  
Sbjct  124   YLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSRTDTFRARYSPQGPQT--IEEN  181

Query  1324  VTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDG  1503
             + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+NK+ PYGWWYG++ HLETC+G
Sbjct  182   IPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRKNKELPYGWWYGIISHLETCNG  241

Query  1504  NQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVIS  1683
             N+++C CH  D ++LEFNQYSPGS+WRR  ++RK+H+EEGN A+GFYGGI+K+ ++E IS
Sbjct  242   NENHCCCHNNDMLILEFNQYSPGSQWRRVVINRKNHQEEGNGADGFYGGIRKICNKEEIS  301

Query  1684  TWKRLWPAQVLE  1719
              WK  WP QVL+
Sbjct  302   IWKSFWPTQVLQ  313



>ref|XP_008392525.1| PREDICTED: F-box protein At2g26850-like [Malus domestica]
Length=399

 Score =   394 bits (1013),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/383 (54%), Positives = 270/383 (70%), Gaps = 16/383 (4%)
 Frame = +1

Query  598   LVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTV  777
             ++ TW +  RL +  + W   S  + ++KN  SL P+     +    G S  +   E   
Sbjct  24    MLQTWENNLRL-ISLKFWSGSS--SFLQKNWISLQPITSKLKKMVTSG-SNVEGQREERE  79

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             + +S+LDLPDL L CILEK+PP GL  +A+VCSSL E C SDHLW+ H+K KWG +IGPA
Sbjct  80    TSLSLLDLPDLALGCILEKLPPSGLFSMAAVCSSLXESCKSDHLWDNHMKHKWGTLIGPA  139

Query  958   AYREWQWHIALRKDSRLFN-QAKEKGLGSYLSRL--------WPLSVIVGPNLGAGDKRN  1110
             AYR+WQ H+A R  +R +  + ++KGL   L+ +         P SV    N       +
Sbjct  140   AYRQWQLHVASRNRTRHYCLKTRKKGLMESLAAIILPSTWTTLPQSVTCVCNCKVKGSSH  199

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             +LP + S+M  YL+LESGKFWFPAQVYNRE+G++GF+LSCYDA+L YD RT+TF ARY P
Sbjct  200   SLP-VHSIMSLYLSLESGKFWFPAQVYNREHGNLGFLLSCYDAQLRYDSRTNTFQARYSP  258

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             +GR  V  E  + WDRLRA  VD P + LH+SDCL+DL+PGDHIEIQWRRN +FPYGWWY
Sbjct  259   YGRRVV--EENIPWDRLRAAPVDTPPYKLHVSDCLHDLKPGDHIEIQWRRNNEFPYGWWY  316

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GV+GHLE C+GN ++CRCH  D VVLEF Q++PGSRWR+  ++RKD+REEGNEA+GFYGG
Sbjct  317   GVIGHLELCNGNVNHCRCHYNDIVVLEFRQHTPGSRWRQMMINRKDNREEGNEADGFYGG  376

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             ++K+ + E I+ WKRLWP+QVLE
Sbjct  377   VRKLYNDEEIARWKRLWPSQVLE  399



>gb|KCW51070.1| hypothetical protein EUGRSUZ_J00678 [Eucalyptus grandis]
Length=336

 Score =   390 bits (1003),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 230/319 (72%), Gaps = 5/319 (2%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLF--RLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKA  753
             KSL    +P WASE  L  L+  R +    + +L+     S IP     M  K    S  
Sbjct  17    KSLPLNSLPLWASEMTLLSLWSHREFSAFCISSLMNSFYRSFIPRTCSKMSIKKINLSSR  76

Query  754   DDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
              D+VE  + + SVLDLP+LVLECILEK+PP  L ++A VCSSLR RC+SDHLWERH++QK
Sbjct  77    VDNVE--IGEKSVLDLPELVLECILEKLPPAELFNMAGVCSSLRNRCVSDHLWERHMRQK  134

Query  934   WGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             WG +IGPAAYR+W+W+IA R+D     Q K+ GL   L  +WPLS      L   +K+  
Sbjct  135   WGRVIGPAAYRQWKWYIATRRDIGNLKQGKQSGLARLLIAVWPLS-WTNSKLDNSEKQRI  193

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
               P DS+M WYLALE+GKF FPAQVYNRENGHVGFMLSCYDAELSYD +TDTF ARYPPH
Sbjct  194   PLPTDSIMSWYLALETGKFCFPAQVYNRENGHVGFMLSCYDAELSYDSQTDTFQARYPPH  253

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR A AIE+ VTWDRLRA  VD P HDLHISDCL DL+PGDHIEIQWRRN++FPYGWWYG
Sbjct  254   GRRAGAIESNVTWDRLRAQPVDAPPHDLHISDCLNDLQPGDHIEIQWRRNEEFPYGWWYG  313

Query  1474  VVGHLETCDGNQHYCRCHE  1530
              VGHLE+CDGN +YCRCH 
Sbjct  314   AVGHLESCDGNANYCRCHN  332



>gb|KJB55451.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=374

 Score =   392 bits (1006),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 233/324 (72%), Gaps = 12/324 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRL-QLLFRLWKDLSLLTLVR--KNLFSLIPLRMLAMR---SKPGG  741
             KSL  K  P WA+E RL    FR  KD+S     R  KN+  L     +  +    K   
Sbjct  17    KSLTLKPPPPWAAEMRLLSPWFR--KDVSFFLSSRLIKNILGLAYFTTVVSKMSLKKMSF  74

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
              SK D+  E   S MS+LDLPDLVLECILE++PP  LC +A VCSSLR RC+SDH WE+H
Sbjct  75    TSKVDNFEEVEESAMSILDLPDLVLECILERLPPAALCSMAGVCSSLRSRCISDHFWEKH  134

Query  922   LKQKWGGIIGPAAYREWQWHIALR--KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +K+KWG IIGPAAYREWQWHIALR  KDS    Q K KGL   LS + P S  +   +  
Sbjct  135   MKKKWGRIIGPAAYREWQWHIALRTRKDSSHLMQGKPKGLMRVLSIVRP-SWWIKSKVDD  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               K+ +LP  DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF 
Sbjct  194   SSKQCSLPD-DSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFK  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  312

Query  1456  YGWWYGVVGHLETCDGNQHYCRCH  1527
             YGWWYGVVGHLE+CDGN +YCRCH
Sbjct  313   YGWWYGVVGHLESCDGNDNYCRCH  336



>ref|XP_006362270.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Solanum tuberosum]
Length=386

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/329 (56%), Positives = 240/329 (73%), Gaps = 10/329 (3%)
 Frame = +1

Query  757   DHVETTVSQM-------SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
             DHV++ +  +       S+LDLPDL LECI E++PP GLC++A+VC+SLRE+C SDHLWE
Sbjct  60    DHVKSKLENVVEKEEGVSLLDLPDLTLECIFERLPPNGLCNMAAVCNSLREKCTSDHLWE  119

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQA-KEKGLGSYLSRLWPLSVIVGPNLG  1092
             +H+K+KWG +IG AAY+EWQ ++  R  + +  ++ K+K L    S++  L         
Sbjct  120   KHMKEKWGELIGSAAYKEWQCYVVSRNKASILEKSRKKKDLYGKFSKIRKLLWNRSKGNE  179

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
                K  N   + S+M WYL+LE+GKFWFPAQV+NRENG VGFMLSCYDAE+SYD RT+TF
Sbjct  180   DDSKVGNSSEMSSIMDWYLSLETGKFWFPAQVFNRENGQVGFMLSCYDAEVSYDSRTNTF  239

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              ARYP +GR    IE  + W+RLRAP VD   + LH+SDCL DL+P DHIEIQWR++K+F
Sbjct  240   SARYPSYGRRI--IEDDIEWNRLRAPTVDTLPYVLHVSDCLDDLKPDDHIEIQWRKSKEF  297

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
              YGWWYGVVGH E+C G++  C CH  +TV+LEF QY+PGSRWR+T ++RKDHRE GNE 
Sbjct  298   AYGWWYGVVGHSESCSGSKLNCHCHASETVLLEFKQYTPGSRWRQTVINRKDHREVGNEG  357

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +GFYGGI+K+ S + IS WK L P  +LE
Sbjct  358   DGFYGGIRKLYSDKEISLWKSLLPNSILE  386



>ref|XP_010417831.1| PREDICTED: F-box protein At2g26850-like [Camelina sativa]
Length=371

 Score =   391 bits (1004),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 252/375 (67%), Gaps = 28/375 (7%)
 Frame = +1

Query  604   PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQ  783
             PTW S+ +    F  +K+               P   +   + P       D     ++Q
Sbjct  22    PTWISKTKTLFSFYFYKN---------------PFMKILHPTTP-------DLASPVLNQ  59

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MS+LDLPDL L+CIL+ +PP  LC L+ VCSSLRERC+SD+LWE+HL  KWG I+GPAA+
Sbjct  60    MSILDLPDLPLDCILDLLPPSELCSLSRVCSSLRERCVSDYLWEKHLITKWGKILGPAAH  119

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPP---IDSV  1134
             +EWQ     R      +    +    +L+++  L          G +R    P   +DS 
Sbjct  120   KEWQ---CYRSSPYHLDSPHHQTEQPWLAKIISLIRSHSSIFRDGYQRMIDAPSVSLDST  176

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDA+LSYD  T+TF AR+PPHGR A+A+
Sbjct  177   MSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAQLSYDTHTNTFQARFPPHGRRAIAV  236

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
             E  VTW+R+RA  +D   H L+ISD L +L+PGDHIEIQWRRNK+FPYGWWY VVGHL++
Sbjct  237   EKDVTWERIRAAPIDASPHHLYISDSLKELKPGDHIEIQWRRNKEFPYGWWYSVVGHLDS  296

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CDGN ++C CH  + VVLEF QY+ GSRWR+T ++RKDHRE+GNE +GFYGGI+K+  +E
Sbjct  297   CDGNLNHCHCHISEIVVLEFKQYTIGSRWRKTMINRKDHREKGNEEDGFYGGIRKLNCKE  356

Query  1675  VISTWKRLWPAQVLE  1719
              I+ WK LWP+  LE
Sbjct  357   DIARWKCLWPSSFLE  371



>gb|EPS60658.1| hypothetical protein M569_14143, partial [Genlisea aurea]
Length=379

 Score =   391 bits (1004),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 254/385 (66%), Gaps = 29/385 (8%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADD  759
             K+L+   +P WA      +    W+DL L + +   L    P +            K  +
Sbjct  18    KTLSTNPLPHWAYGGMRLVSLCFWEDL-LASPISSYLTKFFPEK------------KCFE  64

Query  760   HVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWG  939
                      S+LDLP+LVLE ILEK+PP GLC +  VC+SLR+RCMSDHLWE+H+++KWG
Sbjct  65    SEMKNSDAPSLLDLPELVLESILEKLPPSGLCKMGVVCTSLRDRCMSDHLWEKHMEEKWG  124

Query  940   GIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP  1119
              ++G  A+++WQ H A  K   +    K   +  ++  L PL            K+N + 
Sbjct  125   RLVGRIAHKKWQLHTASDKKQVM----KRSSVMGHVWNLLPLRS------SEKKKKNRMS  174

Query  1120  PIDS-----VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
                      VM  YLAL SG FWFPAQVYNRENGH GF+LSCYDAELSYD  TDTF ARY
Sbjct  175   CCSCNSNSSVMSCYLALHSGNFWFPAQVYNRENGHSGFLLSCYDAELSYDRITDTFSARY  234

Query  1285  PPHGRMAVAIETGVTWDRLRAP-LVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             PPHG  A A+ETG+TWDR+RA  L D   HDLH SDCL +LRPGDH+EIQWRR K+FPYG
Sbjct  235   PPHGWRASAVETGITWDRVRASSLGDASPHDLHASDCLNELRPGDHVEIQWRRYKEFPYG  294

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYGV+GHLE+CDGN   CRC + +TV++EFN YS  SRWRRT VSRK+HREEGNEA+GF
Sbjct  295   WWYGVIGHLESCDGNLICCRCRDSETVIVEFNHYSVESRWRRTAVSRKEHREEGNEADGF  354

Query  1642  YGGIQKVESREVISTWKRLWPAQVL  1716
             YGGI+K++S E I+ WK LWPAQVL
Sbjct  355   YGGIRKLKSDEEIAAWKNLWPAQVL  379



>ref|XP_009345151.1| PREDICTED: F-box protein At2g26850-like [Pyrus x bretschneideri]
Length=399

 Score =   390 bits (1003),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 208/383 (54%), Positives = 268/383 (70%), Gaps = 16/383 (4%)
 Frame = +1

Query  598   LVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTV  777
             ++ TW    RL +  + W   S  + ++KN  SL P+     +    G S  +   E   
Sbjct  24    MLQTWEDNIRL-ISPKFWSGSS--SFLQKNWISLQPITSKLKKMVTSG-SNVEGQREERE  79

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             + +S+LDLPDL L CILEK+PP GLC +A+VCSSLRE C SDHLW+ H+K KWG +IGPA
Sbjct  80    TSLSLLDLPDLALGCILEKLPPSGLCSMAAVCSSLRESCRSDHLWDNHMKHKWGTLIGPA  139

Query  958   AYREWQWHIALRKDSRLFN-QAKEKGLGSYLSRL-----W---PLSVIVGPNLGAGDKRN  1110
             AY +WQ H+A R   R +  + K+KGL   L+ +     W   P SV    N        
Sbjct  140   AYGQWQLHVASRNRIRHYCLKTKKKGLMESLAAIILPSTWTTLPQSVTCVCNCKVKASSR  199

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
             +LP + S+M  YL+LESGKFWFPAQVYNRE+G++GF+LSCYDA+L YD  T+TF ARY P
Sbjct  200   SLP-VHSIMSLYLSLESGKFWFPAQVYNREHGNLGFLLSCYDAQLRYDSWTNTFQARYSP  258

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             +GR  V  E  + WDRLRA  VD P + LH+SDCL+DL+PGDHIEIQWRRN ++PYGWWY
Sbjct  259   YGRRVV--EENIPWDRLRAAPVDTPPYKLHVSDCLHDLKPGDHIEIQWRRNNEYPYGWWY  316

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GV+GHLE C+GN ++CRCH  D VVLEF+ Y+ GSRWR+ T++RKDHREEGNEA+GFYGG
Sbjct  317   GVIGHLELCNGNVNHCRCHYNDIVVLEFHHYTSGSRWRQMTINRKDHREEGNEADGFYGG  376

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+ + + I+ WKRLWP+QVLE
Sbjct  377   IRKLYNDKEIARWKRLWPSQVLE  399



>ref|XP_009768150.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Nicotiana 
sylvestris]
Length=385

 Score =   389 bits (1000),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 236/324 (73%), Gaps = 8/324 (2%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             ++VE    ++S+LDLPDL LECI E++PP GLC +A+VCS LRE+C SDHLWE+H+K+KW
Sbjct  67    ENVEKKEDEISLLDLPDLTLECIFERLPPNGLCSMAAVCSYLREKCTSDHLWEKHMKEKW  126

Query  937   GGIIGPAAYREWQWHIALRK-DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             G +IG AAYREWQ +IA R  DS L N  K++ L   L +   +   +       +  + 
Sbjct  127   GALIGSAAYREWQCYIASRNNDSLLENSRKKRDL---LGKFSEIRKFLWNRSKGNEDNSK  183

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
             +    ++M WYL+LESG FWF AQV+NRE  NGHVGF LSCYDAE+SYD  T+TF ARYP
Sbjct  184   VRSSSAIMDWYLSLESGTFWFSAQVFNREVQNGHVGFTLSCYDAEVSYDCNTNTFRARYP  243

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
               GR  V  E  + W+RLRAP VD P + LH+SDCL DL+P DH EIQWR++K+F YGWW
Sbjct  244   SQGRRIV--EENIEWNRLRAPTVDTPPYVLHVSDCLSDLKPDDHFEIQWRKSKEFAYGWW  301

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLE+C+GN+  C CH  DTV+LEF QY+PGSRWR+  ++RK+HRE GNEA+GFYG
Sbjct  302   YGVVGHLESCNGNKLNCHCHSSDTVLLEFKQYTPGSRWRQIVINRKEHREVGNEADGFYG  361

Query  1648  GIQKVESREVISTWKRLWPAQVLE  1719
             GI+K+ S + IS WK L P+  LE
Sbjct  362   GIRKLYSDKEISLWKSLCPSSTLE  385



>ref|XP_010510850.1| PREDICTED: F-box protein At2g26850-like [Camelina sativa]
Length=371

 Score =   388 bits (997),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 256/367 (70%), Gaps = 13/367 (4%)
 Frame = +1

Query  637   LFRLWKDLSLLTLVRKN--LFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDL  810
              F  +K L L T V K   LFS    + L M+          D     ++QMS+LDLPDL
Sbjct  12    FFLFFKSLRLPTWVSKTKTLFSFYFYKNLFMKILH---PTTPDLASPVLNQMSILDLPDL  68

Query  811   VLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIAL  990
              L+CIL+ +PP  LC L+ VCSSLRERC+SD+LWE+HL  KWG I+GPAA++EWQ     
Sbjct  69    PLDCILDLLPPSELCSLSRVCSSLRERCVSDYLWEKHLITKWGKILGPAAHKEWQ---CY  125

Query  991   RKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP----PIDSVMFWYLALE  1158
             R      +    +    +L+++  L +    ++   D R  +      +DS M +YL+LE
Sbjct  126   RSSPYHLDSPHHQTGHPWLAKIISL-IRSHSSIFRDDYRRMIDVPFVSLDSTMSFYLSLE  184

Query  1159  SGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDR  1338
             +G+FWFPAQVYNRENGHVGFMLSCYDA LSYD  T+TF AR+PPHGR A+A+E  VTW+R
Sbjct  185   TGRFWFPAQVYNRENGHVGFMLSCYDAHLSYDTHTNTFQARFPPHGRRAIAVEKDVTWER  244

Query  1339  LRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYC  1518
             +RA  +D   H L+ISD L +L+PGDHIEIQWRRNK+FPYGWWY VVGHL++CDGN ++C
Sbjct  245   IRATPIDASPHHLYISDSLKELKPGDHIEIQWRRNKEFPYGWWYSVVGHLDSCDGNLNHC  304

Query  1519  RCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRL  1698
             +CH  + +VLEF QY+ GSRWR+T ++RKDHRE+GN+ +G+YGG++K+  +E I+ WK L
Sbjct  305   QCHISEILVLEFKQYTIGSRWRKTMINRKDHREKGNDEDGYYGGMRKLNCKEDIARWKCL  364

Query  1699  WPAQVLE  1719
             WP+ +LE
Sbjct  365   WPSSILE  371



>gb|KDO54746.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=351

 Score =   387 bits (993),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 236/326 (72%), Gaps = 9/326 (3%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSLIPLRMLAMR-SKPGGCSKA  753
             LA K +P WA    L+LL    WK++S  ++    KN  ++  + + + + S     S +
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHMMSTS  78

Query  754   DDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             +DHVE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+H+K
Sbjct  79    NDHVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEKHMK  138

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
             QKWG I+GPAAYREWQWH+A RKDS    Q K++      S +   S +         + 
Sbjct  139   QKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTSKQT  198

Query  1108  NNLP-PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                  P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF A
Sbjct  199   TTTRLPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQA  258

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPY
Sbjct  259   RYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPY  318

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECD  1536
             GWWYGVVGHLE+CDGN+++C CH  D
Sbjct  319   GWWYGVVGHLESCDGNENFCHCHNSD  344



>ref|XP_010473070.1| PREDICTED: F-box protein At2g26850-like [Camelina sativa]
Length=371

 Score =   387 bits (994),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 253/371 (68%), Gaps = 21/371 (6%)
 Frame = +1

Query  637   LFRLWKDLSLLTLVRKN--LFSLI----PLRMLAMRSKPGGCSKADDHVETTVSQMSVLD  798
              F  +K L L T V K   LFS      P   +   + P       D     ++QMS+LD
Sbjct  12    FFLFFKSLCLPTWVSKTKTLFSFYFYKNPFMKILHPTTP-------DLASPVLNQMSILD  64

Query  799   LPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQW  978
             LPDL  +CIL+ +PP  LC L+ VC+SLRERC+SD+LWE+HL  KWG I+GPAA++EWQ 
Sbjct  65    LPDLPFDCILDLLPPSELCSLSRVCTSLRERCVSDYLWEKHLITKWGKILGPAAHKEWQ-  123

Query  979   HIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPP----IDSVMFWY  1146
                 R      +    +    +L+++  L +    ++   D R  +      +DS M +Y
Sbjct  124   --CYRSSPYHLDSPHHQTGHPWLAKIISL-IRSHSSIFRDDYRRMIDAPSVSLDSTMSFY  180

Query  1147  LALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGV  1326
             L+LE+G+FWFPAQVYNRENGHVGFMLSCYDA+LSYD  T+TF AR+PPHGR A+A+E  V
Sbjct  181   LSLETGRFWFPAQVYNRENGHVGFMLSCYDAQLSYDTHTNTFQARFPPHGRRAIAVEKDV  240

Query  1327  TWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGN  1506
             TW+R+RA  +D   H L+ISD L +L+PGDH+EIQWRRNK+FPYGWWY VVGHL++CDGN
Sbjct  241   TWERIRAAPIDASPHHLYISDSLKELKPGDHVEIQWRRNKEFPYGWWYSVVGHLDSCDGN  300

Query  1507  QHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVIST  1686
              ++C CH  + VVLEF QY+ GSRWR+T +SRKDHRE+GNE +GFYGGI+K+  +E I+ 
Sbjct  301   LNHCHCHISEIVVLEFKQYTIGSRWRKTMISRKDHREKGNEEDGFYGGIRKLNCKEDIAR  360

Query  1687  WKRLWPAQVLE  1719
             W  LWP+  LE
Sbjct  361   WTCLWPSSFLE  371



>ref|XP_006362269.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Solanum tuberosum]
Length=388

 Score =   387 bits (995),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/331 (56%), Positives = 240/331 (73%), Gaps = 12/331 (4%)
 Frame = +1

Query  757   DHVETTVSQM-------SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
             DHV++ +  +       S+LDLPDL LECI E++PP GLC++A+VC+SLRE+C SDHLWE
Sbjct  60    DHVKSKLENVVEKEEGVSLLDLPDLTLECIFERLPPNGLCNMAAVCNSLREKCTSDHLWE  119

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQA-KEKGLGSYLSRLWPLSVIVGPNLG  1092
             +H+K+KWG +IG AAY+EWQ ++  R  + +  ++ K+K L    S++  L         
Sbjct  120   KHMKEKWGELIGSAAYKEWQCYVVSRNKASILEKSRKKKDLYGKFSKIRKLLWNRSKGNE  179

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYDPRTD  1266
                K  N   + S+M WYL+LE+GKFWFPAQV+NRE  NG VGFMLSCYDAE+SYD RT+
Sbjct  180   DDSKVGNSSEMSSIMDWYLSLETGKFWFPAQVFNREVQNGQVGFMLSCYDAEVSYDSRTN  239

Query  1267  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  1446
             TF ARYP +GR    IE  + W+RLRAP VD   + LH+SDCL DL+P DHIEIQWR++K
Sbjct  240   TFSARYPSYGRRI--IEDDIEWNRLRAPTVDTLPYVLHVSDCLDDLKPDDHIEIQWRKSK  297

Query  1447  KFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGN  1626
             +F YGWWYGVVGH E+C G++  C CH  +TV+LEF QY+PGSRWR+T ++RKDHRE GN
Sbjct  298   EFAYGWWYGVVGHSESCSGSKLNCHCHASETVLLEFKQYTPGSRWRQTVINRKDHREVGN  357

Query  1627  EAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             E +GFYGGI+K+ S + IS WK L P  +LE
Sbjct  358   EGDGFYGGIRKLYSDKEISLWKSLLPNSILE  388



>ref|XP_001775579.1| predicted protein [Physcomitrella patens]
 gb|EDQ59526.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 233/313 (74%), Gaps = 6/313 (2%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MSVLDLP+L LE IL ++PP  LC +A+VC  LR+RC SDHLW+   ++KW  ++G +A+
Sbjct  1     MSVLDLPELALEEILGRLPPASLCQMAAVCHHLRKRCRSDHLWQSLFERKWARVVGSSAF  60

Query  964   REWQWHIALRKDS-RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMF  1140
             +EWQ  + L+ +      +   +  G  LS LWP   +   NL    + + +PP DS+M 
Sbjct  61    QEWQRQLILQAEQGPPAAECPPRVWGWPLSCLWPFKWL---NLQG--QPSAIPPPDSLMA  115

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
             WY ALESG FWFPAQVYNRENGHVGFMLSCYDAEL+YD RTDTF ARYPPHG+    +E 
Sbjct  116   WYWALESGSFWFPAQVYNRENGHVGFMLSCYDAELNYDRRTDTFKARYPPHGQRTAVVEE  175

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCD  1500
             GV W+RLRAP V+ PAHDLH SDCL DL+PGD +E+QWRRNK FPYGWWYGVVGH E C+
Sbjct  176   GVQWERLRAPPVETPAHDLHQSDCLADLKPGDCVEVQWRRNKDFPYGWWYGVVGHSEGCE  235

Query  1501  GNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVI  1680
             G+  +CRC+  +T+ LEFNQY+ GSRWRR  ++RK H EEG+EAEGFYGGI+K++++E I
Sbjct  236   GSSRHCRCYSLETLWLEFNQYAVGSRWRRAPINRKSHEEEGSEAEGFYGGIRKLKTKEEI  295

Query  1681  STWKRLWPAQVLE  1719
               WK+LWP + L+
Sbjct  296   EIWKKLWPTEDLQ  308



>ref|XP_008387444.1| PREDICTED: F-box protein At2g26850-like [Malus domestica]
Length=393

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 226/305 (74%), Gaps = 9/305 (3%)
 Frame = +1

Query  820   CILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKD  999
             CILE++PP GLC +A+VC+SLRE C SDHLW  H+  KWG +IGPAAYREWQ H A R  
Sbjct  91    CILERLPPSGLCSMAAVCASLRESCTSDHLWGNHMNHKWGRLIGPAAYREWQLHGASRNR  150

Query  1000  SRLFN-QAKEKGL-----GSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALES  1161
              R ++ + ++KGL      S L   W     + P        + L  +DS+M  YL+LE+
Sbjct  151   IRNYSVRTEKKGLMESLEASILHSSWITWQKLTPVCKVKASTSCLS-VDSIMSLYLSLET  209

Query  1162  GKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRL  1341
             GKFWFPAQVYNRENG+VGFMLSCYDA + YD  T+TF ARY P+GR A   E  + WDRL
Sbjct  210   GKFWFPAQVYNRENGNVGFMLSCYDARVRYDSTTNTFQARYSPYGRRAT--EENIPWDRL  267

Query  1342  RAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCR  1521
             RA  VD P H LH+SDCL+DL+PGD+IEIQWRRNK+FPYGWWYGV+GHLE CDGN++ CR
Sbjct  268   RAAPVDTPPHKLHVSDCLHDLKPGDYIEIQWRRNKEFPYGWWYGVIGHLEFCDGNENGCR  327

Query  1522  CHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLW  1701
             CH  D V LEF+QY+PGSRWR  T++RKDHREEGNEA+GFY GI+K+ + E I+ WKRLW
Sbjct  328   CHCNDIVKLEFSQYTPGSRWREMTINRKDHREEGNEADGFYAGIRKIYNEEEIARWKRLW  387

Query  1702  PAQVL  1716
             P QVL
Sbjct  388   PTQVL  392



>gb|KEH28371.1| F-box plant-like protein [Medicago truncatula]
Length=347

 Score =   385 bits (990),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 226/315 (72%), Gaps = 13/315 (4%)
 Frame = +1

Query  607   TWASEFRL-QLLFRLWKDL---SLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETT  774
             +W +E RL  LLF   KD    S   L RK L S + L    + SK       ++ V++ 
Sbjct  26    SWTNEVRLISLLFH--KDFCLKSFCKLFRKTLVSRMSLVKKTLVSK---VENVEEEVDSL  80

Query  775   VSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGP  954
                +SVLDLP+LVLECILEK+PP  LC +A VC SLRERC+SDHLWERH+KQKWG +IG 
Sbjct  81    QQNLSVLDLPELVLECILEKLPPSSLCQMAGVCHSLRERCVSDHLWERHMKQKWGRVIGS  140

Query  955   AAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLS----VIVGPNLGAGDKRNNLPP  1122
              AYREW+WH+A +K+       K + L  ++S  WP S     +      + +K+N+  P
Sbjct  141   VAYREWKWHVATKKNIGSLRHGKPRSLIKFMSLYWPFSWMRMKVDAAYSNSANKQNSYLP  200

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
              DS M WYLALE+G F FPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR 
Sbjct  201   PDSFMTWYLALETGNFSFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGRR  260

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A A+E G+ W+RLRAP VD P HDLHI++CL+DL  GDHIEIQWRRNK FPYGWWYG+VG
Sbjct  261   AAAVEHGIPWERLRAPPVDTPPHDLHITECLHDLHAGDHIEIQWRRNKDFPYGWWYGIVG  320

Query  1483  HLETCDGNQHYCRCH  1527
             HLE+CDGN++YCRCH
Sbjct  321   HLESCDGNENYCRCH  335



>gb|KDO54747.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=356

 Score =   385 bits (989),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 235/323 (73%), Gaps = 9/323 (3%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSLIPLRMLAMR-SKPGGCSKA  753
             LA K +P WA    L+LL    WK++S  ++    KN  ++  + + + + S     S +
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHMMSTS  78

Query  754   DDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             +DHVE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+H+K
Sbjct  79    NDHVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEKHMK  138

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
             QKWG I+GPAAYREWQWH+A RKDS    Q K++      S +   S +         + 
Sbjct  139   QKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTSKQT  198

Query  1108  NNLP-PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                  P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF A
Sbjct  199   TTTRLPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQA  258

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPY
Sbjct  259   RYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPY  318

Query  1459  GWWYGVVGHLETCDGNQHYCRCH  1527
             GWWYGVVGHLE+CDGN+++C CH
Sbjct  319   GWWYGVVGHLESCDGNENFCHCH  341



>ref|XP_010327750.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Solanum lycopersicum]
Length=387

 Score =   385 bits (990),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 252/360 (70%), Gaps = 9/360 (3%)
 Frame = +1

Query  646   LWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECI  825
             L K L+L     +N  S + L ++    K    SK ++ VE     +S+LDLPDL LECI
Sbjct  35    LVKFLALWFSKGRNAISFLNLPLMTDHVK----SKLENVVEKE-EGVSLLDLPDLTLECI  89

Query  826   LEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSR  1005
              E++PP GLC++A+VC+SLRE+C SDHLWE+H+K KWG +IG AAY+EWQ ++  R  + 
Sbjct  90    FERLPPNGLCNMAAVCTSLREKCTSDHLWEKHMKGKWGELIGSAAYKEWQCYVVSRNKAS  149

Query  1006  LFNQAKEK-GLGSYLSRLWPLSVIVGPNLGAGDKR-NNLPPIDSVMFWYLALESGKFWFP  1179
             +  ++++K  L    S++  L           D +  N   + S+M WYL+LE+GKFWFP
Sbjct  150   ILEKSRKKRELYGKFSKIRELLWDRSKKGNEDDSKIGNSSEMSSIMDWYLSLETGKFWFP  209

Query  1180  AQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVD  1359
             AQV+NRENGH+GFMLSCYDAE+SYD RT+TF ARYP +GR    IE  + W+RLRAP VD
Sbjct  210   AQVFNRENGHIGFMLSCYDAEVSYDCRTNTFSARYPSYGRRM--IEDDIEWNRLRAPTVD  267

Query  1360  NPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDT  1539
                + LH+SDCL DL+P DHIEIQWR++K+F YGWWYGVVGHLE+C G++  C CH  +T
Sbjct  268   TLPYVLHVSDCLDDLQPDDHIEIQWRKSKEFAYGWWYGVVGHLESCSGSKLNCHCHASET  327

Query  1540  VVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             V+LEF QY+ GSRWR+T ++RKDHRE GNE +GFYGGI+K+ S + IS W  L P   LE
Sbjct  328   VLLEFKQYTAGSRWRQTVINRKDHREVGNEGDGFYGGIRKLYSDKEISLWNSLLPNNTLE  387



>ref|XP_006446322.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
 gb|ESR59562.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
Length=356

 Score =   382 bits (980),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 234/323 (72%), Gaps = 9/323 (3%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSLIPLRMLAMR-SKPGGCSKA  753
             LA K +P WA    L+LL    WK++S  ++    KN  ++  + + + + S     S +
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHMMSTS  78

Query  754   DDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             +DHVE     ++MSVLDL +LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+H+K
Sbjct  79    NDHVEEVSGGAEMSVLDLHELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEKHMK  138

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
             QKWG I+GPAAYREWQWH+A RKDS    Q K++      S +   S +         + 
Sbjct  139   QKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTSKQT  198

Query  1108  NNLP-PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                  P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF A
Sbjct  199   TTTRLPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQA  258

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPY
Sbjct  259   RYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPY  318

Query  1459  GWWYGVVGHLETCDGNQHYCRCH  1527
             GWWYGVVGHLE+CDGN+++C CH
Sbjct  319   GWWYGVVGHLESCDGNENFCHCH  341



>ref|XP_004249133.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Solanum lycopersicum]
Length=389

 Score =   381 bits (979),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 252/362 (70%), Gaps = 11/362 (3%)
 Frame = +1

Query  646   LWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECI  825
             L K L+L     +N  S + L ++    K    SK ++ VE     +S+LDLPDL LECI
Sbjct  35    LVKFLALWFSKGRNAISFLNLPLMTDHVK----SKLENVVEKE-EGVSLLDLPDLTLECI  89

Query  826   LEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSR  1005
              E++PP GLC++A+VC+SLRE+C SDHLWE+H+K KWG +IG AAY+EWQ ++  R  + 
Sbjct  90    FERLPPNGLCNMAAVCTSLREKCTSDHLWEKHMKGKWGELIGSAAYKEWQCYVVSRNKAS  149

Query  1006  LFNQAKEK-GLGSYLSRLWPLSVIVGPNLGAGDKR-NNLPPIDSVMFWYLALESGKFWFP  1179
             +  ++++K  L    S++  L           D +  N   + S+M WYL+LE+GKFWFP
Sbjct  150   ILEKSRKKRELYGKFSKIRELLWDRSKKGNEDDSKIGNSSEMSSIMDWYLSLETGKFWFP  209

Query  1180  AQVYNRE--NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPL  1353
             AQV+NRE  NGH+GFMLSCYDAE+SYD RT+TF ARYP +GR    IE  + W+RLRAP 
Sbjct  210   AQVFNREVQNGHIGFMLSCYDAEVSYDCRTNTFSARYPSYGRRM--IEDDIEWNRLRAPT  267

Query  1354  VDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHEC  1533
             VD   + LH+SDCL DL+P DHIEIQWR++K+F YGWWYGVVGHLE+C G++  C CH  
Sbjct  268   VDTLPYVLHVSDCLDDLQPDDHIEIQWRKSKEFAYGWWYGVVGHLESCSGSKLNCHCHAS  327

Query  1534  DTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQV  1713
             +TV+LEF QY+ GSRWR+T ++RKDHRE GNE +GFYGGI+K+ S + IS W  L P   
Sbjct  328   ETVLLEFKQYTAGSRWRQTVINRKDHREVGNEGDGFYGGIRKLYSDKEISLWNSLLPNNT  387

Query  1714  LE  1719
             LE
Sbjct  388   LE  389



>gb|KJB46204.1| hypothetical protein B456_007G352500 [Gossypium raimondii]
Length=392

 Score =   381 bits (979),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 234/304 (77%), Gaps = 6/304 (2%)
 Frame = +1

Query  745   SKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHL  924
             ++ +DH +TT S  S+LDLP+LVL+CI +++ P  LC ++ VCSSLRERC+SD++W + +
Sbjct  80    NQKEDHNKTTPSP-SLLDLPELVLDCIFDRLQPAELCAMSGVCSSLRERCVSDYVWAKRM  138

Query  925   KQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWP-LSVIVGPNLGA  1095
             K KWG +IG AAYREWQW+IAL+  S L N  + +   S+  ++++WP LS         
Sbjct  139   KGKWGKVIGDAAYREWQWYIALQNRSNLLNNQRNQSNLSFESVAKIWPFLSWFNIKPRAE  198

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
              + +N    +DS+M WYLALE+G+F FPAQVYNRENGH GF+LSCYDA+LSYD +TDTF 
Sbjct  199   KELKNGGLAVDSIMAWYLALETGRFSFPAQVYNRENGHAGFLLSCYDAKLSYDSKTDTFQ  258

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARY PH R     E  ++WDRLRAP VD  ++DLHIS+ L+DL+PGDHIEIQWRRN++FP
Sbjct  259   ARYSPHVRQTT--EQNISWDRLRAPPVDTCSYDLHISNSLFDLKPGDHIEIQWRRNREFP  316

Query  1456  YGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAE  1635
             YGWWYGVVGH+E+C+GN+++CRC + DTV+LEF QY   SRWR+TT++R++HRE GNE +
Sbjct  317   YGWWYGVVGHMESCNGNENHCRCQDTDTVMLEFKQYPSSSRWRKTTINRENHREVGNEGD  376

Query  1636  GFYG  1647
             GFYG
Sbjct  377   GFYG  380



>ref|XP_003624978.1| F-box protein [Medicago truncatula]
Length=382

 Score =   380 bits (975),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 226/301 (75%), Gaps = 7/301 (2%)
 Frame = +1

Query  820   CILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKD  999
             CILEK+ P  LC++A VC SLRE+C SD+LWE+H+K KWG I+G +AYR+W+ ++A +  
Sbjct  88    CILEKLSPSELCNVAQVCKSLREKCRSDYLWEKHMKMKWGKILGDSAYRQWKCYVASKSI  147

Query  1000  SRLFNQAK-EKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWF  1176
              +  NQ K +K + ++L    P   I   +    +K     P DS+   YL+LE+GKFWF
Sbjct  148   EKNSNQHKNQKTVLAFLHAFLPFFWIKSKS----EKYIKSRPDDSIAALYLSLENGKFWF  203

Query  1177  PAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLV  1356
             PAQVYNRENGH GF+LSCYDAEL YD RTDTF ARY PHGR     E  + W+RLR P +
Sbjct  204   PAQVYNRENGHAGFLLSCYDAELCYDSRTDTFQARYSPHGRWTT--EENIKWERLRVPPI  261

Query  1357  DNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECD  1536
             D+ +H LHISDCL DL+PGDH+EIQWRRN +FPYGWWY V+GHLETC G+ ++C+CH+ D
Sbjct  262   DSSSHVLHISDCLDDLKPGDHVEIQWRRNNEFPYGWWYSVIGHLETCQGDGNHCQCHDKD  321

Query  1537  TVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             TV+LEF QY+ GSRWR+T ++RK+HRE+GNE EGFYGGI+K+ S+E I+ WK+LWP + +
Sbjct  322   TVILEFTQYTAGSRWRQTMINRKNHREQGNEIEGFYGGIRKLHSKEEITKWKKLWPTKNV  381

Query  1717  E  1719
             E
Sbjct  382   E  382



>gb|ABD33039.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES81196.2| F-box plant-like protein [Medicago truncatula]
Length=394

 Score =   380 bits (975),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 226/301 (75%), Gaps = 7/301 (2%)
 Frame = +1

Query  820   CILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKD  999
             CILEK+ P  LC++A VC SLRE+C SD+LWE+H+K KWG I+G +AYR+W+ ++A +  
Sbjct  100   CILEKLSPSELCNVAQVCKSLREKCRSDYLWEKHMKMKWGKILGDSAYRQWKCYVASKSI  159

Query  1000  SRLFNQAK-EKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWF  1176
              +  NQ K +K + ++L    P   I   +    +K     P DS+   YL+LE+GKFWF
Sbjct  160   EKNSNQHKNQKTVLAFLHAFLPFFWIKSKS----EKYIKSRPDDSIAALYLSLENGKFWF  215

Query  1177  PAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLV  1356
             PAQVYNRENGH GF+LSCYDAEL YD RTDTF ARY PHGR     E  + W+RLR P +
Sbjct  216   PAQVYNRENGHAGFLLSCYDAELCYDSRTDTFQARYSPHGRWTT--EENIKWERLRVPPI  273

Query  1357  DNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECD  1536
             D+ +H LHISDCL DL+PGDH+EIQWRRN +FPYGWWY V+GHLETC G+ ++C+CH+ D
Sbjct  274   DSSSHVLHISDCLDDLKPGDHVEIQWRRNNEFPYGWWYSVIGHLETCQGDGNHCQCHDKD  333

Query  1537  TVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             TV+LEF QY+ GSRWR+T ++RK+HRE+GNE EGFYGGI+K+ S+E I+ WK+LWP + +
Sbjct  334   TVILEFTQYTAGSRWRQTMINRKNHREQGNEIEGFYGGIRKLHSKEEITKWKKLWPTKNV  393

Query  1717  E  1719
             E
Sbjct  394   E  394



>gb|AFK37960.1| unknown [Medicago truncatula]
Length=394

 Score =   380 bits (975),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 226/301 (75%), Gaps = 7/301 (2%)
 Frame = +1

Query  820   CILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKD  999
             CILEK+ P  LC++A VC SLRE+C SD+LWE+H+K KWG I+G +AYR+W+ ++A +  
Sbjct  100   CILEKLSPSELCNVAQVCKSLREKCRSDYLWEKHMKMKWGKILGDSAYRQWKCYVASKSI  159

Query  1000  SRLFNQAK-EKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWF  1176
              +  NQ K +K + ++L    P   I   +    +K     P DS+   YL+LE+GKFWF
Sbjct  160   EKNSNQHKNQKTVLAFLHAFLPFFWIKSKS----EKYIKSRPDDSIAALYLSLENGKFWF  215

Query  1177  PAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLV  1356
             PAQVYNRENGH GF+LSCYDAEL YD RTDTF ARY PHGR     E  + W+RLR P +
Sbjct  216   PAQVYNRENGHAGFLLSCYDAELCYDSRTDTFQARYSPHGRWTT--EENIKWERLRVPPI  273

Query  1357  DNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECD  1536
             D+ +H LHISDCL DL+PGDH+EIQWRRN +FPYGWWY V+GHLETC G+ ++C+CH+ D
Sbjct  274   DSSSHVLHISDCLDDLKPGDHVEIQWRRNNEFPYGWWYSVIGHLETCQGDGNHCQCHDKD  333

Query  1537  TVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             TV+LEF QY+ GSRWR+T ++RK+HRE+GNE EGFYGGI+K+ S+E I+ WK+LWP + +
Sbjct  334   TVILEFTQYTAGSRWRQTMINRKNHREQGNEIEGFYGGIRKLHSKEEITKWKKLWPTKNV  393

Query  1717  E  1719
             E
Sbjct  394   E  394



>ref|XP_003521127.1| PREDICTED: F-box protein At2g32560-like [Glycine max]
Length=401

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 223/301 (74%), Gaps = 3/301 (1%)
 Frame = +1

Query  817   ECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRK  996
             ECILE + P  LC +A+VC+SLR+RC SDHLW++H+++KWG + G AAYR+W+WH+A + 
Sbjct  100   ECILEHLSPAELCRVATVCTSLRDRCRSDHLWKKHMERKWGKVFGDAAYRQWKWHVASKN  159

Query  997   DSRLF-NQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFW  1173
               ++  NQ  +KG+ ++L   +   + +      G + ++  P DS+   YL+LESGKFW
Sbjct  160   REKISSNQHNQKGIFAFLRGGFLPFIWIKAKSEKGTESSSSLPEDSIAALYLSLESGKFW  219

Query  1174  FPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPL  1353
             FPAQVYNRENGH GFMLSCYDA+L YD R+DTF ARY PHGR     E  + WDRLR P 
Sbjct  220   FPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFLARYSPHGRWTT--EENIQWDRLRVPP  277

Query  1354  VDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHEC  1533
             +    H LHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV+GHLE C G+ ++C CH  
Sbjct  278   IATSPHALHISDCLDDLRPGDHIEIQWRRNKEFPYGWWYGVIGHLEQCQGHGNHCHCHYN  337

Query  1534  DTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQV  1713
             D V+LEF QY+ GSRWR+T ++RK H E+GNE +GFYGGI+K+ S+E I+ WK LWP ++
Sbjct  338   DIVILEFTQYTAGSRWRQTVINRKHHIEKGNEIDGFYGGIRKLHSKEEIARWKNLWPTKI  397

Query  1714  L  1716
             +
Sbjct  398   V  398



>ref|NP_001044567.1| Os01g0806200 [Oryza sativa Japonica Group]
 dbj|BAD68058.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06481.1| Os01g0806200 [Oryza sativa Japonica Group]
 dbj|BAG97148.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71668.1| hypothetical protein OsI_04131 [Oryza sativa Indica Group]
Length=427

 Score =   377 bits (968),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 225/326 (69%), Gaps = 11/326 (3%)
 Frame = +1

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
               + + +LDLP+L LE +LE++ P  L  +A VC +LR+RC +D LW RH+ +KWG ++G
Sbjct  101   NAAALPLLDLPELALERVLEELEPPSLAAMACVCVALRDRCSADTLWGRHVNRKWGRVLG  160

Query  952   PAAYREWQWHIALRKDS-RLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL----  1116
              AA +EW+  +A R+ S  L   A+ + L   L+  WP S I    L             
Sbjct  161   AAARKEWEAELAARRSSGALPRPARRRSLADSLACAWPFSWITCRWLKGNAVAAEPAAAT  220

Query  1117  ------PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                   P  D+V  WY A+E G+F FPAQVYNRE+GHVGF+LSCYDA L YD RTDTF A
Sbjct  221   PSPLPSPATDTVAAWYRAVECGEFSFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTA  280

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR     E+GV W R+R+P V  PAHDLH S CL DLRPGDH EIQWR+NK FPY
Sbjct  281   RYPPHGRKPAKEESGVQWSRVRSPPVSTPAHDLHASGCLGDLRPGDHFEIQWRKNKDFPY  340

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEG  1638
             GWWYGVVGH ETC+ N+H CRCHE D VVLEF  Y+ GSRWR+TTVSRKDHRE+G+E +G
Sbjct  341   GWWYGVVGHQETCNANEHLCRCHEDDMVVLEFKHYAAGSRWRQTTVSRKDHREKGDETDG  400

Query  1639  FYGGIQKVESREVISTWKRLWPAQVL  1716
             FYGGI+K+++ + ISTW++ WP  VL
Sbjct  401   FYGGIRKLQTSDEISTWRKFWPVDVL  426



>ref|XP_003554122.1| PREDICTED: F-box protein At2g32560-like [Glycine max]
Length=399

 Score =   376 bits (965),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 251/364 (69%), Gaps = 11/364 (3%)
 Frame = +1

Query  646   LWKDLS--LLTLVRK----NLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPD  807
              W  LS  L++ +RK      FS +   +          SK ++  E    ++S+LDLPD
Sbjct  37    FWGSLSSWLVSRLRKGSTSTRFSFLQFSLDMSLKNNSLVSKGENEEEEV--KVSLLDLPD  94

Query  808   LVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA  987
             L LECILE + P  LC +A+VC+SLR+RC SDHLW++H+++KWG + G A YR+W+W +A
Sbjct  95    LPLECILEHLSPAELCRVATVCTSLRDRCRSDHLWKKHMERKWGKVFGDAVYRQWKWQVA  154

Query  988   LRKDSRLF-NQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESG  1164
              +   ++  NQ  +KG+ ++L+  +   + +      G + N+    DS+   YL+LESG
Sbjct  155   SKTREKISSNQHNQKGIFAFLNGGFLPLLWIKAKSEKGTQSNSSLSEDSIAALYLSLESG  214

Query  1165  KFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLR  1344
             KFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF ARY PHGR     E  + WDRLR
Sbjct  215   KFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFLARYSPHGRWTT--EENIQWDRLR  272

Query  1345  APLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRC  1524
              P + +  H LHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV+GHLE C G+ ++C C
Sbjct  273   VPPIASSPHALHISDCLDDLRPGDHIEIQWRRNKEFPYGWWYGVIGHLEQCQGHGNHCHC  332

Query  1525  HECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWP  1704
             H  D V+LEF QYS GSRWR+T ++RK H E+GNE +GFYGGI+K+ S+E I+ WK LWP
Sbjct  333   HYSDMVILEFTQYSAGSRWRQTVINRKHHVEKGNEIDGFYGGIRKLHSKEEITRWKNLWP  392

Query  1705  AQVL  1716
              +++
Sbjct  393   TKIV  396



>ref|XP_011459459.1| PREDICTED: F-box protein At2g32560 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   373 bits (957),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 230/337 (68%), Gaps = 41/337 (12%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             DH   T  Q+ +LDLP+L LECILE++P E L  +  VC+SLRERC+SDHLWE H+KQKW
Sbjct  18    DHGINTEQQVCLLDLPELALECILERLPAESLFRIRGVCTSLRERCVSDHLWENHMKQKW  77

Query  937   GGIIGPAAYREWQWH-IALRKDSRLFNQ--AKEKGLGSYLSRLWPLSVIVG---------  1080
             G +IGPA Y+EWQWH +A +K S   NQ    +K  G  L ++  LS+            
Sbjct  78    GRVIGPATYKEWQWHSMANQKQSLNQNQLAKPQKAAGKCLMKILSLSLSWSLSWIRSSSD  137

Query  1081  -PNLGAGDKRNNLPPI---DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELS  1248
                     +R   P     +SVM WYLAL +G+FWFPAQVYNRENGHVGF+LSCYDAEL 
Sbjct  138   IDEFIKSKRRTCFPSPHYENSVMSWYLALTTGRFWFPAQVYNRENGHVGFVLSCYDAELC  197

Query  1249  YDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEI  1428
             YDPR D+F ARYPPHGR AVAIE  V W+RLRAP VD   HDLHISDCL DLRPGDHIEI
Sbjct  198   YDPRNDSFQARYPPHGRRAVAIENCVPWERLRAPPVDTLPHDLHISDCLNDLRPGDHIEI  257

Query  1429  QWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKD  1608
             QWRRNK+FPY                         D VVLEFNQY+ GSRWR TT+SRK+
Sbjct  258   QWRRNKEFPY-------------------------DNVVLEFNQYARGSRWRCTTISRKN  292

Query  1609  HREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             HREEG+EA+GFYGGI+K++ +E IS WK+LWP QVLE
Sbjct  293   HREEGDEADGFYGGIRKLQMKEEISIWKQLWPTQVLE  329



>ref|XP_006294440.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
 gb|EOA27338.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
Length=373

 Score =   374 bits (960),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 233/320 (73%), Gaps = 10/320 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             ++MS+LDLP L L+CILEK+ P  LC +  VCS LR++C+SDHLW++H++ KWG ++G A
Sbjct  58    NKMSLLDLPALTLDCILEKLSPSELCAMTCVCSELRDKCVSDHLWQKHMETKWGRLMGDA  117

Query  958   AYREWQWHIA-LRKDSRLFNQAKEKGLGS--YLSRLWPLSVIVGPNLG---AGDKRNNLP  1119
             A +EW+ H+A + +  R  NQ+  K   S  +++ L P S +   N G    G   +   
Sbjct  118   ATQEWKSHVATIMRCLRSSNQSSSKPNWSSRFVASLRPFSWL-SSNHGFDKRGSASSYFA  176

Query  1120  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  1299
             PIDSVM+WY  LE+GKFWFPAQVYNRE+GHVGFM+SCYDA++ YD +TDTF A+Y  HGR
Sbjct  177   PIDSVMYWYSNLENGKFWFPAQVYNREHGHVGFMMSCYDAKIRYDFKTDTFQAKYSAHGR  236

Query  1300  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  1479
              A   E  VTW RLR   VD  + +LH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G+V
Sbjct  237   RAA--EEKVTWQRLRPSQVDTKSRELHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFGIV  294

Query  1480  GHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQK  1659
             GHL+ CDG ++ CRCH  + VV+EF Q+ P S W RT ++RKDHRE GNE  GFYGG++K
Sbjct  295   GHLQNCDGEEN-CRCHTAENVVMEFRQFRPESPWSRTVINRKDHRETGNEDNGFYGGVKK  353

Query  1660  VESREVISTWKRLWPAQVLE  1719
             + + E +STWKR+WP+Q LE
Sbjct  354   LGTEEEVSTWKRMWPSQALE  373



>gb|KHN08884.1| F-box protein [Glycine soja]
Length=333

 Score =   372 bits (956),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 222/301 (74%), Gaps = 3/301 (1%)
 Frame = +1

Query  817   ECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRK  996
             ECILE + P  LC +A+VC+SLR+RC SDHLW++H+++KWG + G A YR+W+W +A + 
Sbjct  32    ECILEHLSPAELCRVATVCTSLRDRCRSDHLWKKHMERKWGKVFGDAVYRQWKWQVASKT  91

Query  997   DSRLF-NQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFW  1173
               ++  NQ  +KG+ ++L+  +   + +      G + N+    DS+   YL+LESGKFW
Sbjct  92    REKISSNQHNQKGIFAFLNGGFLPLLWIKAKSEKGTQSNSSLSEDSIAALYLSLESGKFW  151

Query  1174  FPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPL  1353
             FPAQVYNRENGH GFMLSCYDA+L YD R+DTF ARY PHGR     E  + WDRLR P 
Sbjct  152   FPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFLARYSPHGRWTT--EENIQWDRLRVPP  209

Query  1354  VDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHEC  1533
             + +  H LHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV+GHLE C G+ ++C CH  
Sbjct  210   IASSPHALHISDCLDDLRPGDHIEIQWRRNKEFPYGWWYGVIGHLEQCQGHGNHCHCHYS  269

Query  1534  DTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQV  1713
             D V+LEF QYS GSRWR+T ++RK H E+GNE +GFYGGI+K+ S+E I+ WK LWP ++
Sbjct  270   DMVILEFTQYSAGSRWRQTVINRKHHVEKGNEIDGFYGGIRKLHSKEEITRWKNLWPTKI  329

Query  1714  L  1716
             +
Sbjct  330   V  330



>ref|XP_006294441.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
 gb|EOA27339.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
Length=314

 Score =   372 bits (954),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 177/318 (56%), Positives = 231/318 (73%), Gaps = 10/318 (3%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MS+LDLP L L+CILEK+ P  LC +  VCS LR++C+SDHLW++H++ KWG ++G AA 
Sbjct  1     MSLLDLPALTLDCILEKLSPSELCAMTCVCSELRDKCVSDHLWQKHMETKWGRLMGDAAT  60

Query  964   REWQWHIA-LRKDSRLFNQAKEKGLGS--YLSRLWPLSVIVGPNLG---AGDKRNNLPPI  1125
             +EW+ H+A + +  R  NQ+  K   S  +++ L P S +   N G    G   +   PI
Sbjct  61    QEWKSHVATIMRCLRSSNQSSSKPNWSSRFVASLRPFSWL-SSNHGFDKRGSASSYFAPI  119

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
             DSVM+WY  LE+GKFWFPAQVYNRE+GHVGFM+SCYDA++ YD +TDTF A+Y  HGR A
Sbjct  120   DSVMYWYSNLENGKFWFPAQVYNREHGHVGFMMSCYDAKIRYDFKTDTFQAKYSAHGRRA  179

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  1485
                E  VTW RLR   VD  + +LH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G+VGH
Sbjct  180   A--EEKVTWQRLRPSQVDTKSRELHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFGIVGH  237

Query  1486  LETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
             L+ CDG ++ CRCH  + VV+EF Q+ P S W RT ++RKDHRE GNE  GFYGG++K+ 
Sbjct  238   LQNCDGEEN-CRCHTAENVVMEFRQFRPESPWSRTVINRKDHRETGNEDNGFYGGVKKLG  296

Query  1666  SREVISTWKRLWPAQVLE  1719
             + E +STWKR+WP+Q LE
Sbjct  297   TEEEVSTWKRMWPSQALE  314



>dbj|BAK00229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   372 bits (956),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 220/315 (70%), Gaps = 8/315 (3%)
 Frame = +1

Query  790   VLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYRE  969
             VLDLP+L LE +LE++ P  L  +A VC+ LR+RC  D LW RH+++KWG ++G AA RE
Sbjct  87    VLDLPELALERVLEELSPASLAAMACVCAGLRDRCSMDSLWARHVRRKWGRVLGAAARRE  146

Query  970   WQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI------DS  1131
             W   +A    + L   A+ +G    L+  WP S I    L   D              DS
Sbjct  147   WGAELA--AAATLPRPARRRGWADSLACAWPFSWIGRRWLKEEDAAAAAARSSPAPPADS  204

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR    
Sbjct  205   VAAWYRALECGDFWFPAQVYNREDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRKPAK  264

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
              E GV W R+RA  +  PA DLH S CL DLRPGDH EIQWR+NK FPYGWWYGVVGHLE
Sbjct  265   EEEGVQWCRVRAAPLSTPAQDLHASGCLEDLRPGDHFEIQWRKNKDFPYGWWYGVVGHLE  324

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +C+ N+H CRCHE DT++LEF  Y+ GSRWR+TTVSRKDHRE+G+E +GFYGGI+K++++
Sbjct  325   SCNANEHLCRCHEDDTIMLEFKHYAAGSRWRQTTVSRKDHREKGDETDGFYGGIRKLQTK  384

Query  1672  EVISTWKRLWPAQVL  1716
             + ISTW+R WP  VL
Sbjct  385   DEISTWRRFWPVDVL  399



>ref|XP_004493395.1| PREDICTED: F-box protein At2g26850-like [Cicer arietinum]
Length=391

 Score =   372 bits (955),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 244/360 (68%), Gaps = 10/360 (3%)
 Frame = +1

Query  652   KDLSLLTLVRKNLFSLIPLRM----LAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLE  819
             K L+LL   R  + S+IP       L M++K        +  E     +S+LDLPDL LE
Sbjct  38    KLLNLLVASRIKIVSIIPFSFFHFSLGMQNKTFVSKIEHEEKEVEEKVVSLLDLPDLPLE  97

Query  820   CILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKD  999
             CILE + P  LC++A VC SL+ +C SD LWE H+K+KWG + G AAYR+W+ H+A R +
Sbjct  98    CILEHLSPNELCNVAKVCKSLKNKCRSDFLWENHMKRKWGKVFGDAAYRQWKCHVASRNN  157

Query  1000  SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFP  1179
             +        K L ++L    P   I   +    +K   L P DSV   YL+LE+G FWFP
Sbjct  158   NIDDTSNHHKKLLAFLHGFLPFFWIKSKS----EKDIKLSPDDSVAALYLSLENGNFWFP  213

Query  1180  AQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVD  1359
             AQVYNRENGH GFMLSCYDA+L YD R+DTF ARY PHGR     E  + W+RLR P ++
Sbjct  214   AQVYNRENGHAGFMLSCYDAQLCYDYRSDTFQARYSPHGRWTT--EENIKWERLRVPPIE  271

Query  1360  NPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDT  1539
             +  H LHISDCL +L+ GDH+EIQWRRNK+FPYGWWY V+GHLETC G  ++C+CH  D 
Sbjct  272   SSPHVLHISDCLDELKAGDHVEIQWRRNKEFPYGWWYSVIGHLETCQGEGNHCQCHNNDK  331

Query  1540  VVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             V+LEF QY+ GSRWR+T ++RK HRE+GNE EGFYGGI+K+ S+E I+ WK+LWP +++E
Sbjct  332   VILEFTQYTAGSRWRQTIINRKHHREQGNEIEGFYGGIRKLHSKEEITRWKKLWPTKIVE  391



>gb|KJB35714.1| hypothetical protein B456_006G125100 [Gossypium raimondii]
 gb|KJB35715.1| hypothetical protein B456_006G125100 [Gossypium raimondii]
Length=374

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 230/327 (70%), Gaps = 12/327 (4%)
 Frame = +1

Query  595   KLVPTWASEFRLQLLFRLW--KDLSLLTLVR--KNLFSLIPLRMLAMRSKPGGCSKADDH  762
             K +P W +E +L     LW  KD+S  ++ +  K   SL          K    SK D+ 
Sbjct  21    KSLPPWDTEVKL---LSLWFGKDVSFSSVTKFIKTSSSLCYFTSKMSLKKMSLTSKVDNF  77

Query  763   VETTV---SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQK  933
              E  V   + MS+LDLP+LVLE ILE++PP  LC +A VCSSLR RC++DH WE+H+K K
Sbjct  78    EEEVVEEGAAMSILDLPELVLESILERLPPASLCSMAGVCSSLRSRCITDHFWEKHMKNK  137

Query  934   WGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN  1113
             WG IIGP AYREWQW IALRKDS    Q + KGL    S + P S  + P +    K+++
Sbjct  138   WGRIIGPVAYREWQWLIALRKDSSHLKQWRPKGLMRIFSIVRP-SWWIKPKVDDCSKQSS  196

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
             LP  +S+M W+LALE+G+F FPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPPH
Sbjct  197   LPR-ESIMSWFLALETGRFCFPAQVYNRENGHVGFMLSCYDAELCYDQRTDTFQARYPPH  255

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR AVAIE  V W+R+RAP VD   HDLHISDCL +LRPGDHIEIQWRRNK+FPYGWWYG
Sbjct  256   GRRAVAIENNVPWERIRAPPVDTSPHDLHISDCLNELRPGDHIEIQWRRNKEFPYGWWYG  315

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEF  1554
             VVGHL +CDGN++YCRCH    ++  F
Sbjct  316   VVGHLASCDGNENYCRCHNSGKLISSF  342



>ref|XP_008464952.1| PREDICTED: F-box protein At2g26850-like [Cucumis melo]
Length=384

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/381 (49%), Positives = 257/381 (67%), Gaps = 13/381 (3%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFR-LQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKAD  756
             KS ++K +  W ++   L  L   W   S L L   + F ++ +   +++S    CS   
Sbjct  16    KSFSYKRLLPWEAKMSFLTALLVSWFHKSKLAL---SFFLVLKVSDPSLKS--NRCSAKQ  70

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
              ++E    + S+LDLP+L LE +L ++ P  LC +A+VC+ LR+ C  D+ WE+H+KQKW
Sbjct  71    GNLEEE-RRTSLLDLPELALESVLGRLSPSELCRMANVCTYLRDVCEDDYFWEKHMKQKW  129

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G ++G +A +EW  HIA ++ S+L N  ++KG  S  S  W   ++  P     + R N+
Sbjct  130   GKLMGNSACKEWHLHIARQRRSKLTNSPQKKGFFSSYSGSWSF-LLTRPK---PESRGNI  185

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
                DS+  WY +LE+GK WFPAQVYNRE+GH GFMLSCYDA++SYD +TD F ARYPPHG
Sbjct  186   RSPDSMKAWYQSLENGKLWFPAQVYNRESGHAGFMLSCYDAQISYDSQTDMFKARYPPHG  245

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A  IE  + W+RLRAP VD P H LH S+CL DL+PGDH+EIQWR++K+F YGWWYGV
Sbjct  246   RRA--IEENIFWNRLRAPPVDIPPHLLHASECLADLKPGDHVEIQWRKSKEFSYGWWYGV  303

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLE CDG+ + C C   D V+LEF+QY  GSRWR+T ++RK H+E GNEA+G+YGG++
Sbjct  304   VGHLEACDGSANNCHCCCNDMVLLEFSQYGVGSRWRKTVINRKSHKEVGNEADGYYGGLR  363

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+   E I+ WK LWP +VLE
Sbjct  364   KLYKEEEITRWKCLWPNRVLE  384



>gb|ACL53470.1| unknown [Zea mays]
 tpg|DAA57197.1| TPA: cyclin-like F-box [Zea mays]
Length=428

 Score =   372 bits (955),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 229/341 (67%), Gaps = 40/341 (12%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             + +LDLP+L L+ +LE++ P  L  +A VCS+LR+RC +D LW RHL+ KWG ++G AA 
Sbjct  97    LPLLDLPELALDRVLEELSPSSLAAMACVCSALRDRCSADALWGRHLRIKWGRVLGAAAR  156

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSR--------------LWPLSVIVGPN-LGAG  1098
             REW        D+ L   A   G  +   R               WP S  +G   L  G
Sbjct  157   REW--------DAELGGTASGSGARAGAPRPTTRRRSWVDSLACAWPFSSWIGCRWLLEG  208

Query  1099  DKRNNLPP---------------IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCY  1233
             D  +NLP                 D+V  WY ALE G+FWFPAQVYNRE+GHVGF+LSCY
Sbjct  209   D--HNLPSPAAESTPAPAPAAPRTDTVAAWYRALECGEFWFPAQVYNREDGHVGFVLSCY  266

Query  1234  DAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPG  1413
             DA L Y  RTDTF ARYPPHGR A   E GV W+R+RAP +  PAHDLH SDCL +LRPG
Sbjct  267   DAHLRYHQRTDTFTARYPPHGRKAAKEEDGVKWNRVRAPPLATPAHDLHASDCLEELRPG  326

Query  1414  DHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTT  1593
             DH EIQWR+NK FPYGWWYGVVGH E+C+GN+H CRCH+ DTVVLEF  Y+PGSRWR+TT
Sbjct  327   DHFEIQWRKNKDFPYGWWYGVVGHQESCNGNEHLCRCHQDDTVVLEFQHYAPGSRWRQTT  386

Query  1594  VSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             V RKDHRE+G+E +GFYGGI+K+ +++ ISTW+R WP  VL
Sbjct  387   VGRKDHREKGDETDGFYGGIRKLHTKDEISTWRRFWPVDVL  427



>ref|NP_001147974.1| cyclin-like F-box precursor [Zea mays]
 gb|ACG29298.1| cyclin-like F-box [Zea mays]
 gb|ACG29718.1| cyclin-like F-box [Zea mays]
Length=428

 Score =   372 bits (955),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 229/341 (67%), Gaps = 40/341 (12%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             + +LDLP+L L+ +LE++ P  L  +A VCS+LR+RC +D LW RHL+ KWG ++G AA 
Sbjct  97    LPLLDLPELALDRVLEELSPSSLAAMACVCSALRDRCSADALWGRHLRIKWGRVLGAAAR  156

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSR--------------LWPLSVIVGPN-LGAG  1098
             REW        D+ L   A   G  +   R               WP S  +G   L  G
Sbjct  157   REW--------DAELGGTASGSGARAGAPRPTTRRRSWVDSLACAWPFSSWIGCRWLLEG  208

Query  1099  DKRNNLPP---------------IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCY  1233
             D  +NLP                 D+V  WY ALE G+FWFPAQVYNRE+GHVGF+LSCY
Sbjct  209   D--HNLPSPAAESTPAPAPAAPRTDTVAAWYRALECGEFWFPAQVYNREDGHVGFVLSCY  266

Query  1234  DAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPG  1413
             DA L Y  RTDTF ARYPPHGR A   E GV W+R+RAP +  PAHDLH SDCL +LRPG
Sbjct  267   DAHLRYHQRTDTFTARYPPHGRKAAKEEDGVQWNRVRAPPLATPAHDLHASDCLEELRPG  326

Query  1414  DHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTT  1593
             DH EIQWR+NK FPYGWWYGVVGH E+C+GN+H CRCH+ DTVVLEF  Y+PGSRWR+TT
Sbjct  327   DHFEIQWRKNKDFPYGWWYGVVGHQESCNGNEHLCRCHQDDTVVLEFQHYAPGSRWRQTT  386

Query  1594  VSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             V RKDHRE+G+E +GFYGGI+K+ +++ ISTW+R WP  VL
Sbjct  387   VGRKDHREKGDETDGFYGGIRKLHTKDEISTWRRFWPVDVL  427



>gb|ACN33240.1| unknown [Zea mays]
Length=428

 Score =   370 bits (951),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/341 (55%), Positives = 229/341 (67%), Gaps = 40/341 (12%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             + +LDLP+L L+ +LE++ P  L  +A VCS+LR+RC +D LW RHL+ KWG ++G AA 
Sbjct  97    LPLLDLPELALDRVLEELSPSSLAAMACVCSALRDRCSADALWGRHLRIKWGRVLGAAAR  156

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSR--------------LWPLSVIVGPN-LGAG  1098
             REW        D+ L   A   G  +   R               WP S  +G   L  G
Sbjct  157   REW--------DAELGGTASGSGARAGAPRPTTRRRSWVDSLACAWPFSSWIGCRWLLEG  208

Query  1099  DKRNNLPP---------------IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCY  1233
             D  +NLP                 D+V  WY ALE G+FWFPAQVYNRE+GHVGF+LSCY
Sbjct  209   D--HNLPSPAAESTPAPAPAAPRTDTVAAWYRALECGEFWFPAQVYNREDGHVGFVLSCY  266

Query  1234  DAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPG  1413
             DA L Y  +TDTF ARYPPHGR A   E GV W+R+RAP +  PAHDLH SDCL +LRPG
Sbjct  267   DAHLRYHQQTDTFTARYPPHGRKAAKEEDGVKWNRVRAPPLATPAHDLHASDCLEELRPG  326

Query  1414  DHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTT  1593
             DH EIQWR+NK FPYGWWYGVVGH E+C+GN+H CRCH+ DTVVLEF  Y+PGSRWR+TT
Sbjct  327   DHFEIQWRKNKDFPYGWWYGVVGHQESCNGNEHLCRCHQDDTVVLEFQHYAPGSRWRQTT  386

Query  1594  VSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             V RKDHRE+G+E +GFYGGI+K+ +++ ISTW+R WP  VL
Sbjct  387   VGRKDHREKGDETDGFYGGIRKLHTKDEISTWRRFWPVDVL  427



>ref|XP_010554766.1| PREDICTED: F-box protein At2g41170 isoform X2 [Tarenaya hassleriana]
Length=329

 Score =   365 bits (938),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 230/321 (72%), Gaps = 11/321 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             +++S+LDLP+L LE +LEK+ P  LC +A VCS LRERCMSDHLWE+H+K KWG ++G A
Sbjct  13    NRVSLLDLPELALELVLEKLSPAELCVMACVCSELRERCMSDHLWEKHMKNKWGRLMGDA  72

Query  958   AYREWQWHIALRKDS-RLFNQAKEK-GLGSYLSRLWPLSVI-----VGPNLGAGDKRNNL  1116
             A REW+ H+A +    R  N++     L S L++  P S++     +G N   G +  + 
Sbjct  73    ATREWRSHVAAKMSCLRRSNRSNTNWNLLSVLAKSMPFSLLSAKTELGNNGNGGAEETS-  131

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
                 SVM WY +LE+GKF FPAQV+NRENGHVGFM+SCYDAE+ Y+ + DTF ARY P G
Sbjct  132   -SCLSVMSWYSSLENGKFSFPAQVFNRENGHVGFMMSCYDAEIRYNSKLDTFRARYSPCG  190

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R     E  VTW+RLR+P VD P+  LH SDCL++LRP DH+EIQWRR+K+FPYGWWYG+
Sbjct  191   RRTA--EENVTWERLRSPPVDTPSRALHESDCLHELRPDDHVEIQWRRSKEFPYGWWYGI  248

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHL+ C G++  C C   + VVLEF Q+ P S WR T + R DHRE GNE++GFYGG++
Sbjct  249   VGHLQICSGHEKNCLCESDENVVLEFRQFRPESPWRTTVIRRTDHRETGNESDGFYGGVR  308

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ ++E ISTW RLWP QVLE
Sbjct  309   KLYAKEEISTWNRLWPTQVLE  329



>ref|XP_004141125.1| PREDICTED: F-box protein At2g26850-like [Cucumis sativus]
 gb|KGN59728.1| hypothetical protein Csa_3G842010 [Cucumis sativus]
Length=387

 Score =   367 bits (942),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 257/383 (67%), Gaps = 14/383 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRS---KPGGCSK  750
             KS ++K +  W  E ++ LL  L     L++   K+  +L    +L +     K   CS 
Sbjct  16    KSFSYKRLLPW--EVKMSLLTAL-----LVSWFHKSKLALSFFLVLKVSDPSLKSIRCST  68

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
                ++E      S+LDLP+L LE IL+++ P  LC +A+VC+ LR+ C  D+ WE+H+KQ
Sbjct  69    KLGNLEEKRG-TSLLDLPELALESILDRLSPSELCRMANVCTYLRDVCEDDYFWEKHMKQ  127

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             KWG ++G +A +EW  HIA ++ S+L +  ++KG  S  S  W   +        G+ R+
Sbjct  128   KWGKLMGNSASKEWHLHIARQRRSKLTSSPQKKGFFSSYSGSWSFLLTRPKPESRGNIRS  187

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
              LP IDS+  WY +LE+GK WFPAQVYNRE+GH GFMLSCYDA++SYD +TD F ARYPP
Sbjct  188   PLP-IDSMKAWYQSLENGKLWFPAQVYNRESGHAGFMLSCYDAQISYDWQTDMFKARYPP  246

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  1470
             HGR A  IE  + W+RLRAP VD P H LH S+CL DL+PGDH+EIQWR++K+F YGWWY
Sbjct  247   HGRRA--IEENIFWNRLRAPPVDIPPHLLHASECLADLKPGDHVEIQWRKSKEFSYGWWY  304

Query  1471  GVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             GVVGHLE CDGN + C+C   D V+LEF+QY   SRWR+T ++RK H+E GN A+G+YGG
Sbjct  305   GVVGHLEACDGNANKCQCCWNDMVLLEFSQYGVESRWRKTVINRKSHKEVGNGADGYYGG  364

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             ++K+   E I+ WK LWP +VLE
Sbjct  365   VRKLYKEEEITRWKCLWPNRVLE  387



>ref|XP_008672833.1| PREDICTED: cyclin-like F-box isoform X1 [Zea mays]
 tpg|DAA57196.1| TPA: hypothetical protein ZEAMMB73_495322 [Zea mays]
Length=429

 Score =   367 bits (943),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 229/342 (67%), Gaps = 41/342 (12%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             + +LDLP+L L+ +LE++ P  L  +A VCS+LR+RC +D LW RHL+ KWG ++G AA 
Sbjct  97    LPLLDLPELALDRVLEELSPSSLAAMACVCSALRDRCSADALWGRHLRIKWGRVLGAAAR  156

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSR--------------LWPLSVIVGPN-LGAG  1098
             REW        D+ L   A   G  +   R               WP S  +G   L  G
Sbjct  157   REW--------DAELGGTASGSGARAGAPRPTTRRRSWVDSLACAWPFSSWIGCRWLLEG  208

Query  1099  DKRNNLPP---------------IDSVMFWYLALESGKFWFPAQVYNRE-NGHVGFMLSC  1230
             D  +NLP                 D+V  WY ALE G+FWFPAQVYNRE +GHVGF+LSC
Sbjct  209   D--HNLPSPAAESTPAPAPAAPRTDTVAAWYRALECGEFWFPAQVYNREQDGHVGFVLSC  266

Query  1231  YDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRP  1410
             YDA L Y  RTDTF ARYPPHGR A   E GV W+R+RAP +  PAHDLH SDCL +LRP
Sbjct  267   YDAHLRYHQRTDTFTARYPPHGRKAAKEEDGVKWNRVRAPPLATPAHDLHASDCLEELRP  326

Query  1411  GDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRT  1590
             GDH EIQWR+NK FPYGWWYGVVGH E+C+GN+H CRCH+ DTVVLEF  Y+PGSRWR+T
Sbjct  327   GDHFEIQWRKNKDFPYGWWYGVVGHQESCNGNEHLCRCHQDDTVVLEFQHYAPGSRWRQT  386

Query  1591  TVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             TV RKDHRE+G+E +GFYGGI+K+ +++ ISTW+R WP  VL
Sbjct  387   TVGRKDHREKGDETDGFYGGIRKLHTKDEISTWRRFWPVDVL  428



>ref|XP_010554764.1| PREDICTED: F-box protein At2g41170 isoform X1 [Tarenaya hassleriana]
 ref|XP_010554765.1| PREDICTED: F-box protein At2g41170 isoform X1 [Tarenaya hassleriana]
Length=372

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 230/321 (72%), Gaps = 11/321 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             +++S+LDLP+L LE +LEK+ P  LC +A VCS LRERCMSDHLWE+H+K KWG ++G A
Sbjct  56    NRVSLLDLPELALELVLEKLSPAELCVMACVCSELRERCMSDHLWEKHMKNKWGRLMGDA  115

Query  958   AYREWQWHIALRKDS-RLFNQAKEK-GLGSYLSRLWPLSVI-----VGPNLGAGDKRNNL  1116
             A REW+ H+A +    R  N++     L S L++  P S++     +G N   G +  + 
Sbjct  116   ATREWRSHVAAKMSCLRRSNRSNTNWNLLSVLAKSMPFSLLSAKTELGNNGNGGAEETS-  174

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
                 SVM WY +LE+GKF FPAQV+NRENGHVGFM+SCYDAE+ Y+ + DTF ARY P G
Sbjct  175   -SCLSVMSWYSSLENGKFSFPAQVFNRENGHVGFMMSCYDAEIRYNSKLDTFRARYSPCG  233

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R     E  VTW+RLR+P VD P+  LH SDCL++LRP DH+EIQWRR+K+FPYGWWYG+
Sbjct  234   RRTA--EENVTWERLRSPPVDTPSRALHESDCLHELRPDDHVEIQWRRSKEFPYGWWYGI  291

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHL+ C G++  C C   + VVLEF Q+ P S WR T + R DHRE GNE++GFYGG++
Sbjct  292   VGHLQICSGHEKNCLCESDENVVLEFRQFRPESPWRTTVIRRTDHRETGNESDGFYGGVR  351

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ ++E ISTW RLWP QVLE
Sbjct  352   KLYAKEEISTWNRLWPTQVLE  372



>ref|XP_010673037.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score =   365 bits (938),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 220/299 (74%), Gaps = 5/299 (2%)
 Frame = +1

Query  826   LEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSR  1005
             L+++ P  LC +A VCS LR +C S+H+WE+H+K KWG +IG AA  +W  H    ++ R
Sbjct  102   LDRLSPAELCSMAGVCSYLRGKCRSNHMWEKHMKNKWGRVIGNAALVKWHEHKHKPQNKR  161

Query  1006  LFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGD-KRNNLPPIDSVMFWYLALESGKFWFPA  1182
              F+    K  G   S LWP S++V P LG     + +LPP DS+M WYL+LESG+FWFPA
Sbjct  162   KFSLRGNKNGGIIFS-LWPFSLMVRPKLGGTSLIKGSLPP-DSIMSWYLSLESGEFWFPA  219

Query  1183  QVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDN  1362
             QVYNRENGH GF+LSCYDA+LSY+ ++DTF ARY  HGR  V  E  ++W R+RAP +DN
Sbjct  220   QVYNRENGHDGFVLSCYDAKLSYNSKSDTFQARYTVHGRETV--EENISWSRIRAPPIDN  277

Query  1363  PAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTV  1542
               +DLH+SD L DL+PGDH EIQWRRN+ FPYGWWYGVV HLE+C  N+ +C CH+ + V
Sbjct  278   SPYDLHVSDSLDDLKPGDHFEIQWRRNRGFPYGWWYGVVDHLESCTRNEDHCICHDNEMV  337

Query  1543  VLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +LEFNQY+  SRWRR +V+RK+HREEGNE +GFYGGI+K+   E ISTWK LWP +VL 
Sbjct  338   ILEFNQYATNSRWRRMSVNRKNHREEGNEGDGFYGGIRKIYCEEEISTWKSLWPTKVLN  396



>ref|XP_007162078.1| hypothetical protein PHAVU_001G121900g [Phaseolus vulgaris]
 gb|ESW34072.1| hypothetical protein PHAVU_001G121900g [Phaseolus vulgaris]
Length=398

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/300 (56%), Positives = 216/300 (72%), Gaps = 2/300 (1%)
 Frame = +1

Query  817   ECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRK  996
             ECIL  + P  LC +A+VC+ LR+   SDHLW++H+++KWG + G AA R+W+ H+A + 
Sbjct  98    ECILGHLSPAELCSVATVCTYLRDTSRSDHLWKKHMERKWGKVFGDAACRQWKCHVASKT  157

Query  997   DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWF  1176
               ++ NQ  +KG+ ++L   +   V +      G + ++  P DSVM  YL+LESGKFWF
Sbjct  158   REKISNQQNQKGIFAFLHGDFRPLVWIKAKSEKGTQSSSSFPEDSVMALYLSLESGKFWF  217

Query  1177  PAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLV  1356
             PAQVYNRENGH GFMLSCYDA+L YD R+DTF ARY PHGR     E  + WDRLR P +
Sbjct  218   PAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFQARYSPHGRWTT--EENIQWDRLRVPPI  275

Query  1357  DNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECD  1536
              +  H LHISD L +LRPGDHIEIQWRRNK FPYGWWYGV+GHLE C G+ ++C CH  D
Sbjct  276   ASSPHALHISDSLDNLRPGDHIEIQWRRNKDFPYGWWYGVIGHLEQCQGHGNHCLCHNND  335

Query  1537  TVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
              V+LEF QY+ GSRWR+T + RK H E+GNE +GFYGGI+K+ SRE I+ WK+LWP + +
Sbjct  336   MVILEFTQYTAGSRWRQTMIDRKHHIEKGNEIDGFYGGIRKLHSREEITRWKKLWPTKTV  395



>ref|XP_008240698.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Prunus mume]
Length=371

 Score =   362 bits (930),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 219/304 (72%), Gaps = 31/304 (10%)
 Frame = +1

Query  817   ECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRK  996
             ECILEK+ P GLC +  VC+SLRERC  D LWERH+ +KWG +IG AAYREWQ H+A R 
Sbjct  96    ECILEKLSPSGLCTMGGVCTSLRERCRDDRLWERHMMEKWGRLIGAAAYREWQLHVASRS  155

Query  997   DSR-LFNQAKEKGL-GSYLSRLWPLSVIVGPNLGAGD-KRNNLPPIDSVMFWYLALESGK  1167
               R + +Q K+KGL  S +S+ WP S I  P L   D K     P++SVM  Y++LESGK
Sbjct  156   RVRNISDQTKKKGLFESLVSKFWPFSWI-RPKLATSDCKARTSLPVESVMSLYISLESGK  214

Query  1168  FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA  1347
             FWFPAQVYNRENG+VGFMLSCYDA++SYD RT+TF ARY P+GR A   E  + WDRLRA
Sbjct  215   FWFPAQVYNRENGNVGFMLSCYDAQVSYDSRTNTFQARYSPYGRRAT--EDNIPWDRLRA  272

Query  1348  PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
               VD P+H LH++DCL+DL+PGDHIEIQWRRNK+FPY                       
Sbjct  273   APVDTPSHKLHVTDCLHDLKPGDHIEIQWRRNKEFPY-----------------------  309

Query  1528  ECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPA  1707
               DTV LEF+QY+PGSRWR+ T++RKDHREEG+EA+GFYGGI+K+ + E I+ WKRLWP 
Sbjct  310   --DTVTLEFSQYTPGSRWRQVTINRKDHREEGDEADGFYGGIRKLYNEEEIARWKRLWPT  367

Query  1708  QVLE  1719
             QVLE
Sbjct  368   QVLE  371



>ref|XP_004970298.1| PREDICTED: F-box protein At2g41170-like isoform X4 [Setaria italica]
Length=409

 Score =   361 bits (926),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 219/323 (68%), Gaps = 16/323 (5%)
 Frame = +1

Query  796   DLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQ  975
             DLP+L L+ +LE++ P  L  +A VC++LR RC +D LWERHL+ KWG ++G  A +EW+
Sbjct  88    DLPELALDRVLEELSPASLAAMACVCAALRGRCSADALWERHLRAKWGRVLGGTARKEWE  147

Query  976   WHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI---------  1125
               +  R   +     A+ +     L+  WP S I G  L  GD       +         
Sbjct  148   AELGARATRASAPRPARRRSWADSLACAWPFSWIAGRWL-KGDATPAPAAVAAEPAPATA  206

Query  1126  ----DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
                 D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPH
Sbjct  207   APPTDTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPH  266

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR     E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPYGWWYG
Sbjct  267   GRKPAKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGWWYG  326

Query  1474  VVGHLETCDGNQH-YCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGG  1650
             VVGH  +C+ N+H +CRCHE D +VLEF  Y+PGSRWR+TTVSRKDHRE G+E +GFYGG
Sbjct  327   VVGHQASCNANEHLWCRCHEDDMIVLEFQHYAPGSRWRQTTVSRKDHRETGDETDGFYGG  386

Query  1651  IQKVESREVISTWKRLWPAQVLE  1719
             I+K+++++ I+TW+R WP  VL 
Sbjct  387   IRKLQTKDEIATWRRFWPVDVLN  409



>gb|AAC32240.1| unknown protein [Arabidopsis thaliana]
Length=346

 Score =   357 bits (916),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/326 (54%), Positives = 228/326 (70%), Gaps = 35/326 (11%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D     + +MS+LDLPDL L+CILE +PP  LC +A VCSSLRERC+SDHLWE+HLK KW
Sbjct  51    DLASPVLGKMSILDLPDLPLDCILELLPPSELCTMARVCSSLRERCVSDHLWEKHLKTKW  110

Query  937   GGIIGPAAYREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRN  1110
             G I+GP+A++EWQ +++     DS   ++    GL   +S +  LS I   +    D R 
Sbjct  111   GKILGPSAHKEWQCYLSSPYHLDSP-HHKTSHLGLAKIISLMRSLSSIFRDD----DHRR  165

Query  1111  NLP---PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
               P   P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  T+TF AR
Sbjct  166   RYPSSIPLDSTMNFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTDTNTFQAR  225

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             YPPHG+ A+A+E  VTW+R+RA  VD   H+L++SD L +L+PGDHIEIQWRRNK+FPY 
Sbjct  226   YPPHGKRAIAVEKDVTWERIRAAPVDASPHNLYVSDSLNELKPGDHIEIQWRRNKEFPY-  284

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
                                     + +VLEFNQY+ GSRWR+T ++R+DHRE+GNE +GF
Sbjct  285   ------------------------EMMVLEFNQYTVGSRWRKTMINRRDHREKGNEEDGF  320

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K+  +E I  WKRLWP+ +LE
Sbjct  321   YGGIRKINCKEDIEMWKRLWPSSILE  346



>ref|XP_003564433.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Brachypodium 
distachyon]
Length=411

 Score =   359 bits (921),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 234/346 (68%), Gaps = 9/346 (3%)
 Frame = +1

Query  706   LRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLR  885
             LRM   ++K     +     +   + + VLDLP+LVL+ +L+++ P  L  +A VC+ LR
Sbjct  65    LRMPPSKAKAVKAEEPALAEDADAAALPVLDLPELVLDRVLQELSPASLAAVACVCAGLR  124

Query  886   ERCMS-DHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRL-FNQAKEKGLGSYLSRLW  1059
             +RC S D LWERH+++KWG ++  AA +EW+  + L   S L  + A+ +     L+  W
Sbjct  125   DRCSSMDGLWERHVRRKWGRVLSAAARQEWEAELLLAATSTLPRSAARRRSWVDSLACAW  184

Query  1060  PLSV---IVGPNLGAGDKRNNLPPIDS---VMFWYLALESGKFWFPAQVYNRENGHVGFM  1221
             P S    + G            PP DS      WY ALE G+FWFPAQVYNRE+GHVGF+
Sbjct  185   PFSWTRWLKGDAATTAAAARPAPPADSKSKAACWYRALECGQFWFPAQVYNREDGHVGFL  244

Query  1222  LSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA-PLVDNPAHDLHISDCLY  1398
             LSCYDA L YD RTDTF ARYPPHGR     E GV W R+RA P    P HDLH+S CL 
Sbjct  245   LSCYDAHLRYDRRTDTFTARYPPHGRKLAKEEDGVQWCRVRAAPASTPPPHDLHVSACLD  304

Query  1399  DLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSR  1578
             DLRPGDH EIQWR+NK FPYGWWYG VGHLE+C+ N+H CRCHE D +VLEF  Y+PGS+
Sbjct  305   DLRPGDHFEIQWRKNKDFPYGWWYGAVGHLESCNANEHLCRCHEDDAIVLEFKHYAPGSK  364

Query  1579  WRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             WR+TTVSRKDHRE+G+E +GFYGGI+K+++++ I+TW+R WP  VL
Sbjct  365   WRQTTVSRKDHREKGDETDGFYGGIRKLQTKDEITTWRRFWPVDVL  410



>ref|NP_850347.1| F-box protein [Arabidopsis thaliana]
 sp|Q6NKN8.1|FB132_ARATH RecName: Full=F-box protein At2g41170 [Arabidopsis thaliana]
 gb|AAT06475.1| At2g41170 [Arabidopsis thaliana]
 gb|AEC09940.1| F-box protein [Arabidopsis thaliana]
Length=371

 Score =   356 bits (913),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 233/321 (73%), Gaps = 11/321 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             ++MS+LDLPDL L+CILEK+ P  LC + SVCS LR++C+SDHLWE+H++ KWG ++G A
Sbjct  55    NKMSLLDLPDLTLDCILEKLSPSELCAMTSVCSELRDKCVSDHLWEKHMETKWGRLMGDA  114

Query  958   AYREWQWHIA-----LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN--L  1116
             A +EW+ H+A     L   S    ++K      +++ L P + +   N G  ++ ++  L
Sbjct  115   AIQEWKSHVATIMRCLTSSSSSSRKSKPNWSSRFVANLKPFAWL-SSNHGCENRGSSSYL  173

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
              PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  HG
Sbjct  174   APIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQARYSAHG  233

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G+
Sbjct  234   RRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFGI  291

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHL+ CDG Q+ CRC   + VV+EF Q+ P S WRRT + RKDHRE GNE  GFYGG++
Sbjct  292   VGHLQNCDGVQN-CRCDSDENVVMEFRQFRPESPWRRTVIKRKDHRETGNEENGFYGGVK  350

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ + E ISTWK+LWP+Q LE
Sbjct  351   KLGTEEEISTWKQLWPSQALE  371



>ref|XP_010517604.1| PREDICTED: F-box protein At2g41170-like [Camelina sativa]
Length=368

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 234/319 (73%), Gaps = 10/319 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             ++MS+LDLPDL L+CILEK+ P  LC  A VCS LR++C+SDHLW++H++ KWG ++G A
Sbjct  55    NKMSLLDLPDLTLDCILEKLSPSELCATACVCSELRDKCVSDHLWQKHMETKWGRLMGDA  114

Query  958   AYREWQWHIA-LRKDSRLFNQAKEKG--LGSYLSRLWPLSVIVGPNLGAGDKRNN--LPP  1122
             A +EW+ H+A L +  R  NQ+  K      +++ L P S +   N G  DKR +    P
Sbjct  115   ATQEWKSHVATLMRCLRSSNQSSSKPNWRSRFVASLKPFSWL-SSNHGC-DKRGSSYFAP  172

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             IDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF A+Y  HGR 
Sbjct  173   IDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQAKYSAHGRR  232

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A   E  VTW RLR   VD  + DLH+SD L+ LRPGDH EIQWRR K+FPYGWW+G+VG
Sbjct  233   AA--EEKVTWQRLRPSQVDTKSRDLHVSDSLHGLRPGDHFEIQWRRTKEFPYGWWFGIVG  290

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             H + CDG ++ CRCH  + VV+EF Q+ P S W RT ++RK+HRE GNE +GFYGG++K+
Sbjct  291   HQQNCDGEEN-CRCHTDENVVMEFRQFRPESPWSRTVINRKEHRETGNEDDGFYGGVKKL  349

Query  1663  ESREVISTWKRLWPAQVLE  1719
              + + +STWKRLWP+Q LE
Sbjct  350   GTEDEVSTWKRLWPSQSLE  368



>ref|XP_010508750.1| PREDICTED: F-box protein At2g41170-like isoform X1 [Camelina 
sativa]
Length=372

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 243/345 (70%), Gaps = 17/345 (5%)
 Frame = +1

Query  706   LRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLR  885
             LR L  R++       +D      ++MS+LDLPDL L+CILEK+ P  LC +A VCS LR
Sbjct  38    LRTLLRRTEAKRNKNQEDE-----NKMSLLDLPDLTLDCILEKLSPSELCAMACVCSELR  92

Query  886   ERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA-LRKDSRLFNQAKEKG--LGSYLSRL  1056
             ++C+ DHLW++H++ KWG ++G AA +EW+ H+A L +  R  NQ+  K      +++ L
Sbjct  93    DKCVIDHLWQKHMEAKWGRLMGDAATQEWKSHVATLMRCLRSSNQSSSKPNWRSRFVASL  152

Query  1057  WPLSVIVGPNLGAGDKRNNL----PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFML  1224
              P S +   N G  DKR +L     PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+
Sbjct  153   KPFSWL-SSNHGC-DKRGSLSSYFAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMM  210

Query  1225  SCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDL  1404
             SCYDA++ YD +TDTF A+Y  HGR A   E  VTW RLR   VD  + DLH+SDCL  L
Sbjct  211   SCYDAKIRYDFKTDTFQAKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRDLHVSDCLDGL  268

Query  1405  RPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWR  1584
             RPGDH EIQWR+ K+FP+GWW+G+VGH + CDG ++ CRCH  + VV+EF Q+ P S W 
Sbjct  269   RPGDHFEIQWRKTKEFPFGWWFGIVGHQQNCDGEEN-CRCHTDENVVMEFRQFRPESPWS  327

Query  1585  RTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             RT ++RK+HRE GNE +GFYGG++K+ + + +STWKRLWP+Q LE
Sbjct  328   RTVINRKEHRETGNEEDGFYGGVKKLGTEDEVSTWKRLWPSQSLE  372



>dbj|BAD94811.1| hypothetical protein [Arabidopsis thaliana]
Length=371

 Score =   354 bits (909),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 233/321 (73%), Gaps = 11/321 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             ++MS+LDLPDL L+CILEK+ P  LC + SVCS LR++C+SDHLWE+H++ KWG ++G A
Sbjct  55    NKMSLLDLPDLTLDCILEKLSPSELCAMTSVCSELRDKCVSDHLWEKHMETKWGRLMGDA  114

Query  958   AYREWQWHIA-----LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNN--L  1116
             A ++W+ H+A     L   S    ++K      +++ L P + +   N G  ++ ++  L
Sbjct  115   AIQKWKSHVATIMRCLTSSSSSSRKSKPNWSSRFVANLKPFAWL-SSNHGCENRGSSSYL  173

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
              PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  HG
Sbjct  174   APIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQARYSAHG  233

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             R A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G+
Sbjct  234   RRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFGI  291

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHL+ CDG Q+ CRC   + VV+EF Q+ P S WRRT + RKDHRE GNE  GFYGG++
Sbjct  292   VGHLQNCDGVQN-CRCDSDENVVMEFRQFRPESPWRRTVIKRKDHRETGNEENGFYGGVK  350

Query  1657  KVESREVISTWKRLWPAQVLE  1719
             K+ + E ISTWK+LWP+Q LE
Sbjct  351   KLGTEEEISTWKQLWPSQALE  371



>ref|XP_002881759.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58018.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=370

 Score =   353 bits (906),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 240/344 (70%), Gaps = 15/344 (4%)
 Frame = +1

Query  706   LRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLR  885
             +R LA R +       +D      ++MS+LDLPDL L+CILEK+ P  LC +  VCS LR
Sbjct  36    IRTLAWRKERKKKKNQEDK-----NKMSLLDLPDLTLDCILEKLSPSELCAMTCVCSELR  90

Query  886   ERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA--LRKDSRLFNQAKEKGLGS-YLSRL  1056
             ++C+SDHLWE+H+++KWG ++G AA +EW+ H+A  +R      ++  +    S +++ L
Sbjct  91    DKCVSDHLWEKHMEKKWGRLMGDAATQEWKSHVATIMRCLRSSSSRKSKPNWSSRFVASL  150

Query  1057  WPLSVIVGPNLGA---GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLS  1227
              P + +   N G    G     L PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+S
Sbjct  151   KPFAWL-SSNHGCENRGSSSTYLAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMS  209

Query  1228  CYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLR  1407
             CYDA++ YD +TDTF ARY  HGR A   E  VTW RLR    D  + DLH+SDCL+ LR
Sbjct  210   CYDAKIRYDFKTDTFQARYSAHGRRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLR  267

Query  1408  PGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRR  1587
             PGDH EIQWRR K+FPYGWW+G+VGHL+ CDG ++ CRCH  + VV+EF Q+   S WRR
Sbjct  268   PGDHFEIQWRRTKEFPYGWWFGIVGHLQNCDGGEN-CRCHSDENVVMEFRQFRQESPWRR  326

Query  1588  TTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             T ++RK+HRE G+E  GFYGG++K+ + E ISTWKRLWP+Q LE
Sbjct  327   TVINRKEHRETGDEENGFYGGVKKLGTEEEISTWKRLWPSQALE  370



>gb|KFK36964.1| hypothetical protein AALP_AA4G195400 [Arabis alpina]
Length=310

 Score =   351 bits (900),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 225/316 (71%), Gaps = 10/316 (3%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MS+LDLP+L L+CILEK+    LC ++ V S LRE+C+SDH W++H+++KW  ++G AA 
Sbjct  1     MSLLDLPELTLDCILEKLSASELCAMSCVSSELREKCVSDHFWKKHMEKKWSRLMGDAAI  60

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSR----LWPLSVIVGPNLGAGDKRNNLPPIDS  1131
             +EW+ H++    S + N  + +   S+ SR    L P S +   +    D   +L P+DS
Sbjct  61    KEWKSHVSTLM-SCVSNSNQSRTQWSWSSRIVANLNPFSWLTSNHGCCSDV--SLAPVDS  117

Query  1132  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             +M+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  HGR A  
Sbjct  118   LMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDYKTDTFQARYSAHGRRAA-  176

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
              E  VTW RLR  LV+  + DLH+SDCL  L PGDH EIQWRR K+FPYGWWYG+VGHL+
Sbjct  177   -EEKVTWQRLRPSLVEAGSRDLHVSDCLDGLCPGDHFEIQWRRTKEFPYGWWYGIVGHLQ  235

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
              C+G ++ C CH+ + VV+EF Q+   S WR T ++RK+HRE GNE  GFYGG++K+ + 
Sbjct  236   YCEG-ENNCNCHDDENVVMEFRQFRLESPWRTTVINRKNHRETGNEENGFYGGVKKLGTE  294

Query  1672  EVISTWKRLWPAQVLE  1719
             E ISTWK+LWP Q LE
Sbjct  295   EEISTWKQLWPPQTLE  310



>ref|XP_010232469.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Brachypodium 
distachyon]
Length=412

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 234/347 (67%), Gaps = 10/347 (3%)
 Frame = +1

Query  706   LRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLR  885
             LRM   ++K     +     +   + + VLDLP+LVL+ +L+++ P  L  +A VC+ LR
Sbjct  65    LRMPPSKAKAVKAEEPALAEDADAAALPVLDLPELVLDRVLQELSPASLAAVACVCAGLR  124

Query  886   ERCMS-DHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRL-FNQAKEKGLGSYLSRLW  1059
             +RC S D LWERH+++KWG ++  AA +EW+  + L   S L  + A+ +     L+  W
Sbjct  125   DRCSSMDGLWERHVRRKWGRVLSAAARQEWEAELLLAATSTLPRSAARRRSWVDSLACAW  184

Query  1060  PLSV---IVGPNLGAGDKRNNLPPIDS---VMFWYLALESGKFWFPAQVYNRE-NGHVGF  1218
             P S    + G            PP DS      WY ALE G+FWFPAQVYNRE +GHVGF
Sbjct  185   PFSWTRWLKGDAATTAAAARPAPPADSKSKAACWYRALECGQFWFPAQVYNREQDGHVGF  244

Query  1219  MLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRA-PLVDNPAHDLHISDCL  1395
             +LSCYDA L YD RTDTF ARYPPHGR     E GV W R+RA P    P HDLH+S CL
Sbjct  245   LLSCYDAHLRYDRRTDTFTARYPPHGRKLAKEEDGVQWCRVRAAPASTPPPHDLHVSACL  304

Query  1396  YDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGS  1575
              DLRPGDH EIQWR+NK FPYGWWYG VGHLE+C+ N+H CRCHE D +VLEF  Y+PGS
Sbjct  305   DDLRPGDHFEIQWRKNKDFPYGWWYGAVGHLESCNANEHLCRCHEDDAIVLEFKHYAPGS  364

Query  1576  RWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             +WR+TTVSRKDHRE+G+E +GFYGGI+K+++++ I+TW+R WP  VL
Sbjct  365   KWRQTTVSRKDHREKGDETDGFYGGIRKLQTKDEITTWRRFWPVDVL  411



>ref|XP_010112853.1| F-box protein [Morus notabilis]
 gb|EXC34976.1| F-box protein [Morus notabilis]
Length=340

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 219/331 (66%), Gaps = 7/331 (2%)
 Frame = +1

Query  736   GGCSKADD-HVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLW  912
               CS+ +   ++   +  S+LDLP L LECI E++ P  LC +  VCS LRE C SDHLW
Sbjct  2     ASCSRVEKVKLKEKENMFSLLDLPKLGLECIFERLSPADLCSMVRVCSVLREMCSSDHLW  61

Query  913   ERHLKQKWGGIIGPAAYREWQWHIALR-KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL  1089
             ERHL+QKWG +IG AAYREW+ ++A +   S L  Q KEKG+   L     LS I G   
Sbjct  62    ERHLQQKWGKVIGDAAYREWRSNVASKIGQSSLSKQKKEKGVLESLRNSRRLSWI-GIKP  120

Query  1090  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
                 K     P+DSVM +Y ALESGKFWFPAQ+Y R+NG+ G ML CYDA++SYD RT+T
Sbjct  121   EKSSKVRTTLPVDSVMAFYFALESGKFWFPAQIYYRQNGYTGVMLLCYDAQISYDSRTNT  180

Query  1270  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDL--HISDCLYDLRPGDHIEIQWRRN  1443
             F ARY   G      E  + WDR+RAP V  P      H+SDCL+DL+PGDHIEIQW+  
Sbjct  181   FRARYTSQGWGTG--EENIGWDRVRAPPVGVPLDPFVPHVSDCLHDLKPGDHIEIQWKSR  238

Query  1444  KKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEG  1623
                PY WWY ++GHLE CD NQ++C CHE DT+V+EFNQY P SRWRRTT SRK H  +G
Sbjct  239   TDLPYAWWYALIGHLEPCDKNQNHCLCHENDTIVVEFNQYHPTSRWRRTTTSRKYHPRQG  298

Query  1624  NEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             NE +GFYGGI+K+  +E I+ W   WP  VL
Sbjct  299   NEIDGFYGGIRKLSDQEEIAKWLSFWPNHVL  329



>ref|XP_009421118.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/387 (47%), Positives = 240/387 (62%), Gaps = 21/387 (5%)
 Frame = +1

Query  592   FKLVPTWASEFRLQLLFRLWKDLSLLTLVRKN---LFSLIPLRMLAMRSKPGGCSKADDH  762
              K +P WA E  L L     + L  L  + KN   + + +  +  +   K          
Sbjct  8     VKFLPPWAYEMGLLLALICRELLCSLIDLMKNCCRVSTSVSFKKASTSRKKSDPRSEGSE  67

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
               T     ++L+LP+L L+CILEK+ P+ L  +A VCS LR+RC SDHLWE H+++KWG 
Sbjct  68    ERTAERGTNILNLPELTLDCILEKLSPKELVTVACVCSCLRDRCRSDHLWESHMRKKWGR  127

Query  943   IIGPAAYREWQWHIALRK----DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR-  1107
             ++G AA R W+ + A RK     + L    K K    YL            +    D+R 
Sbjct  128   LLGEAARRAWESYAASRKHALGSATLVQHTKPKNWMGYL---------FSRSNSDADRRL  178

Query  1108  ---NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                NN  P D  M  Y ALESG+ W PAQ+ NRENG+VGF+LSCYDAEL YD  +DTF+A
Sbjct  179   NIVNNTSPADVTMSCYSALESGRLWVPAQICNRENGNVGFVLSCYDAELRYDRHSDTFYA  238

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RY PHG  AV  E GV+W+R+R P VD   H++H+S+CL +L PGDHIE+QWRR++KFP 
Sbjct  239   RYYPHGSKAVQEEEGVSWNRVRVPPVDISPHEIHVSECLSELSPGDHIEVQWRRSQKFPC  298

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHRE-EGNEAE  1635
             GWWYGV+GHL++CDG++  C C+  DT++LEF QY PGSRWRR TVSRK+H E +GNE  
Sbjct  299   GWWYGVIGHLDSCDGDEQRCLCNLSDTIILEFKQYPPGSRWRRATVSRKNHEEGKGNETT  358

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVL  1716
             GFYGGI+K+  ++ I  W R WP + L
Sbjct  359   GFYGGIRKLHCKDEICMWLRHWPEESL  385



>emb|CDM84605.1| unnamed protein product [Triticum aestivum]
Length=400

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 183/323 (57%), Positives = 224/323 (69%), Gaps = 5/323 (2%)
 Frame = +1

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
              E     + VLDLP+L LE +LE++ P  L  +A VC+ LR+RC  D LW RH+++KWG 
Sbjct  77    AEDDADALPVLDLPELALERVLEELSPASLAAMACVCAGLRDRCSMDSLWARHVRRKWGR  136

Query  943   IIGPAAYREWQWHIALRKDSR-LFNQAKEKGLGSYLSRLWPLSVIVGPNLG---AGDKRN  1110
             ++G AA  EW+  +A R  +  L   A+ +G    L+  WP S I    L    A  +  
Sbjct  137   VLGAAARSEWEAELAARAAAATLPRPARRRGWADSLACAWPFSWIGRRWLKEDAAAARSA  196

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRE-NGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
               PP D+V  WY ALE G FWFPAQVYNRE +GHVGF+LSCYDA L YD RTDTF ARYP
Sbjct  197   PAPPADTVAAWYRALECGDFWFPAQVYNREQDGHVGFLLSCYDAHLRYDRRTDTFTARYP  256

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
             PHGR     E GV W R+RA  +  PA DLH S CL DLRPGDH EIQWR+NK FPYGWW
Sbjct  257   PHGRKPAKEEEGVQWCRVRAAPLSTPAQDLHASACLEDLRPGDHFEIQWRKNKDFPYGWW  316

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             YGVVGHLE C+ N+H CRCHE DT++LEF  Y+ GSRWR+TTVSRKDHRE+G+E +GFYG
Sbjct  317   YGVVGHLEPCNANEHLCRCHEDDTIMLEFKHYAAGSRWRQTTVSRKDHREKGDETDGFYG  376

Query  1648  GIQKVESREVISTWKRLWPAQVL  1716
             GI+K+++ + ISTW+R WP  VL
Sbjct  377   GIRKLQTEDEISTWRRFWPVDVL  399



>ref|XP_010505881.1| PREDICTED: F-box protein At2g41170-like [Camelina sativa]
Length=368

 Score =   351 bits (900),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 179/319 (56%), Positives = 232/319 (73%), Gaps = 10/319 (3%)
 Frame = +1

Query  778   SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPA  957
             ++MS+LDLPDL L+CILEK+ P  LC +A VCS LR++C+SDHLW+ H++ KWG ++G A
Sbjct  55    NKMSLLDLPDLTLDCILEKLSPSELCAMACVCSELRDKCVSDHLWQNHMETKWGRLMGDA  114

Query  958   AYREWQWHIA-LRKDSRLFNQAKEKG--LGSYLSRLWPLSVIVGPNLGAGDKRNN--LPP  1122
             A +EW+ H+A + +  R  NQ+  K      +++ L P S +   N G  DKR +    P
Sbjct  115   ATQEWKSHVATIMRCLRSSNQSSSKPNWRSRFVASLKPFSWL-SSNHGC-DKRGSSYFAP  172

Query  1123  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  1302
             IDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD R+DTF A+Y  HGR 
Sbjct  173   IDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFRSDTFQAKYSAHGRR  232

Query  1303  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  1482
             A   E  VTW RLR   VD  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G+VG
Sbjct  233   AA--EEKVTWQRLRPSQVDIKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFGIVG  290

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             H   C G ++ CRCH  + VV+EF Q+   S W RT ++RK+HRE GNE +GFYGG++K+
Sbjct  291   HQRNCGGEEN-CRCHTDENVVMEFRQFRRESPWSRTVINRKEHRETGNEEDGFYGGVKKL  349

Query  1663  ESREVISTWKRLWPAQVLE  1719
              + E +STWKRLWP+Q LE
Sbjct  350   GTEEEVSTWKRLWPSQSLE  368



>gb|EYU35951.1| hypothetical protein MIMGU_mgv1a008147mg [Erythranthe guttata]
Length=348

 Score =   348 bits (894),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 215/325 (66%), Gaps = 24/325 (7%)
 Frame = +1

Query  583   SLAFKLV--PTWASEFRLQLLFRLWKDLSLLTLVRKNLFSLIPLRMLAMRSKPGGCSKAD  756
             S +F L   P +A E RL L    WK       ++  LFS   L     R  P     A 
Sbjct  9     SFSFILFYSPLFACEMRL-LSLCFWKS------IKNTLFS-ATLSFFTTRMLPSKKIYAV  60

Query  757   DHVETTV------SQMSVLD-LPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
               V+ T        QMSVLD LPDLVLE ILEK+PP+GLC +  V  SLR  C+SDHLWE
Sbjct  61    PKVQRTAFDTNSGDQMSVLDYLPDLVLETILEKLPPKGLCRMGCVSKSLRGMCVSDHLWE  120

Query  916   RHLKQKWGGIIGPAAYREWQWHIALR-KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLG  1092
             RH++ KWG ++G +AYREW      R +DS  F++  EKG       L  L  +V     
Sbjct  121   RHVRSKWGRVVGTSAYREWLCSAHSRNQDSIFFDRIGEKGF------LGCLIALVRSRFC  174

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             +  K    PP++SVM WY+ALESGK WFPAQVYNRENGHVGFMLSCYDA +SYD RTDTF
Sbjct  175   SVGKDKIFPPVNSVMSWYIALESGKLWFPAQVYNRENGHVGFMLSCYDAVVSYDRRTDTF  234

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              ARYP HG    AIE+GVTWDRLRAPLVD   HDLHISDCL +LRPGD IEIQWRRNK+F
Sbjct  235   LARYPAHGTRTSAIESGVTWDRLRAPLVDTSPHDLHISDCLNELRPGDQIEIQWRRNKEF  294

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCH  1527
             PYGWWYGVVGHLETCDGN +YCRCH
Sbjct  295   PYGWWYGVVGHLETCDGNANYCRCH  319



>emb|CDY23870.1| BnaC04g01670D [Brassica napus]
Length=391

 Score =   350 bits (897),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 237/355 (67%), Gaps = 14/355 (4%)
 Frame = +1

Query  673   LVRKNLFSLIPLRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGL  852
             L R  +++      L  R K       DD      ++MS+LDLPDL L+CILEK+ P  L
Sbjct  45    LARNVIYTNGLSTTLTWRRKTRKKKNQDDE-----NKMSLLDLPDLTLDCILEKLSPSEL  99

Query  853   CHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIAL------RKDSRLFN  1014
             C +A VCS LR++C+ DHLW++H++++WG ++G AA +EW+ H+A         +   + 
Sbjct  100   CAMACVCSELRDKCVCDHLWKKHMEKRWGRLMGDAAIKEWKTHVATLMACLKNSNPSSYR  159

Query  1015  QAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYN  1194
                ++      + L P S +   +       ++  PIDSVM+WY  LESGKFWFPAQVYN
Sbjct  160   SNAQQWRSRLAANLKPFSWLKTNHGCHNGGSSSSSPIDSVMYWYSNLESGKFWFPAQVYN  219

Query  1195  RENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHD  1374
             RENGHVGFM+SCYDA++ YD RT+TF ARY  HGR A   E  VTW RLR  LV+  + D
Sbjct  220   RENGHVGFMMSCYDAKVRYDNRTNTFQARYSAHGRRAA--EENVTWQRLRPALVETESRD  277

Query  1375  LHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEF  1554
             LH+SDCL  LRPGDH EIQWRR K+FPYGWW+GVVGHL+ C G ++ CRC   + VV+EF
Sbjct  278   LHVSDCLQGLRPGDHFEIQWRRTKEFPYGWWFGVVGHLQNCVGEEN-CRCVSDENVVMEF  336

Query  1555  NQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
              Q+ P S W+ T ++RKDHRE GNE  GFYGG++K+ + E +STWKRLWP+QVL+
Sbjct  337   RQFRPESPWKTTVLNRKDHRETGNEVSGFYGGVKKLGTEEEVSTWKRLWPSQVLD  391



>ref|XP_002967788.1| hypothetical protein SELMODRAFT_88058 [Selaginella moellendorffii]
 gb|EFJ31135.1| hypothetical protein SELMODRAFT_88058 [Selaginella moellendorffii]
Length=327

 Score =   347 bits (889),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 225/329 (68%), Gaps = 10/329 (3%)
 Frame = +1

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
             C K  ++VE +  Q+  LDLP+LV+E IL ++P   LC +A VC  LR++C S+HLWE  
Sbjct  6     CVKKVENVEDS-RQLGFLDLPELVMEGILTRLPAVALCQMAGVCRELRKKCRSNHLWEAL  64

Query  922   LKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGP---NLG  1092
             + +KWG + G  A+ EWQ  +A R++      ++  G+      LWPLS I+     N  
Sbjct  65    VYEKWGKVTGRLAFAEWQLGLAAREECGSEPCSRSSGIW-----LWPLSCILPVSWMNPQ  119

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             A  +       +S+M WY  LE+G+F FPAQVYNRENGHVGFMLSCYDAE+SY+  TD F
Sbjct  120   AQRRSKAAVGENSLMAWYWDLETGRFRFPAQVYNRENGHVGFMLSCYDAEVSYNSATDVF  179

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              A YPPHG      E  V W+R+RAP VD  AH+LH SDCL+DLRPGDHIE+QWRRN+ F
Sbjct  180   LASYPPHGPRTSVYEEDVPWERVRAPPVDTAAHELHASDCLHDLRPGDHIEVQWRRNRDF  239

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYG+VGH + C  N H C+CH  + V LEFNQY+ GSRWR+  ++R +H EEGNE 
Sbjct  240   PYGWWYGIVGHTDLCPRN-HQCQCHLHEIVWLEFNQYTLGSRWRKAPINRANHCEEGNEG  298

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             EGFYGG++K+ ++E IS W +LWP++ LE
Sbjct  299   EGFYGGVRKLRTKEEISIWTKLWPSEKLE  327



>ref|XP_002992630.1| hypothetical protein SELMODRAFT_135657 [Selaginella moellendorffii]
 gb|EFJ06332.1| hypothetical protein SELMODRAFT_135657 [Selaginella moellendorffii]
Length=327

 Score =   347 bits (889),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 225/329 (68%), Gaps = 10/329 (3%)
 Frame = +1

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
             C K  ++VE +  Q+  LDLP+LV+E IL ++P   LC +A VC  LR++C S+HLWE  
Sbjct  6     CVKKVENVEDS-RQLGFLDLPELVMEGILTRLPAVALCQMAGVCRELRKKCRSNHLWEAL  64

Query  922   LKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGP---NLG  1092
             + +KWG + G  A+ EWQ  +A R++      ++  G+      LWPLS I+     N  
Sbjct  65    VYEKWGKVTGRLAFAEWQLGLAAREECGSEPCSRSSGIW-----LWPLSCILPVSWMNPQ  119

Query  1093  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  1272
             A  +       +S+M WY  LE+G+F FPAQVYNRENGHVGFMLSCYDAE+SY+  TD F
Sbjct  120   AQRRSKAAVGENSLMAWYWDLETGRFRFPAQVYNRENGHVGFMLSCYDAEVSYNSATDAF  179

Query  1273  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  1452
              A YPPHG      E  V W+R+RAP VD  AH+LH SDCL+DLRPGDHIE+QWRRN+ F
Sbjct  180   LASYPPHGPRTSVYEEDVPWERVRAPPVDTAAHELHASDCLHDLRPGDHIEVQWRRNRDF  239

Query  1453  PYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEA  1632
             PYGWWYG+VGH + C  N H C+CH  + V LEFNQY+ GSRWR+  ++R +H EEGNE 
Sbjct  240   PYGWWYGIVGHTDLCPRN-HQCQCHLHEIVWLEFNQYTLGSRWRKAPINRANHCEEGNEG  298

Query  1633  EGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             EGFYGG++K+ ++E IS W +LWP++ LE
Sbjct  299   EGFYGGVRKLRTKEEISIWTKLWPSEKLE  327



>ref|XP_002458655.1| hypothetical protein SORBIDRAFT_03g037510 [Sorghum bicolor]
 gb|EES03775.1| hypothetical protein SORBIDRAFT_03g037510 [Sorghum bicolor]
Length=419

 Score =   350 bits (897),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 225/330 (68%), Gaps = 21/330 (6%)
 Frame = +1

Query  790   VLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYRE  969
             +LDLP+L L+ +LE++ P  L  +A VC+ LR+RC +D LWERHL+ KWG ++G AA +E
Sbjct  89    LLDLPELALDRVLEELSPASLAAMACVCAPLRDRCSADALWERHLRLKWGHVLGAAARKE  148

Query  970   WQWHIALRKDSRLFNQAKEKGLGSYLSRLW----PLSVIVGPN-LGAGD-----------  1101
             W+  +   + +   +  +     S++  L     P S  +G   L  GD           
Sbjct  149   WEAELLGGRGAARGSATRPTRRRSWVDSLACACRPFSSWIGCRWLLKGDHAPAPSSAVAA  208

Query  1102  -----KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  1266
                       PP D+V  WY ALE G+F FPAQVYNRE+GHVGF+LSCYDA L Y  RTD
Sbjct  209   EPTPTTAPAAPPTDTVAAWYRALECGEFSFPAQVYNREDGHVGFVLSCYDAHLRYHRRTD  268

Query  1267  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  1446
             TF ARYPP GR     E GV W+R+RAP V  PA DLH SDCL +LRPGDH EIQWR+NK
Sbjct  269   TFTARYPPLGRKPGKEEDGVQWNRVRAPPVSTPAQDLHASDCLEELRPGDHFEIQWRKNK  328

Query  1447  KFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGN  1626
              FPYGWWYGVVGH E+C+GN+H CRCH+ D VVLEF  Y+PGSRWR+TTVSRKDHRE+G+
Sbjct  329   DFPYGWWYGVVGHQESCNGNEHMCRCHQDDMVVLEFQHYAPGSRWRQTTVSRKDHREKGD  388

Query  1627  EAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
             E +GFYGGI+K+++++ ISTW+R WP  VL
Sbjct  389   ETDGFYGGIRKLQTKDEISTWRRFWPVDVL  418



>emb|CDX79953.1| BnaA05g02030D [Brassica napus]
Length=391

 Score =   348 bits (894),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 231/341 (68%), Gaps = 14/341 (4%)
 Frame = +1

Query  715   LAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERC  894
             LA R K       DD      ++MS+LDLPDL L+CILEK+ P  LC +  VCS LR++C
Sbjct  59    LAWRRKTRKKKNQDDE-----NKMSLLDLPDLTLDCILEKLSPSELCAMTFVCSELRDKC  113

Query  895   MSDHLWERHLKQKWGGIIGPAAYREWQWHIAL------RKDSRLFNQAKEKGLGSYLSRL  1056
             +SDHLW++H++ KWG ++G AA +EW+ H+A         +   +    ++      + L
Sbjct  114   VSDHLWKKHMENKWGRLMGDAAIKEWKTHVATLMACLKNSNPSSYRSNTQQWRSRLAANL  173

Query  1057  WPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYD  1236
              P S +   +       ++  PIDSVM+WY  LESGKFWFPAQVYNRENGHVGFM+SCYD
Sbjct  174   KPFSWLKTNHGCHNRGSSSSSPIDSVMYWYSNLESGKFWFPAQVYNRENGHVGFMMSCYD  233

Query  1237  AELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGD  1416
             A++ YD +T+TF ARY  HGR A   E  VTW RLR  LV+  + DLH+SDCL  LRPGD
Sbjct  234   AKVRYDNKTNTFQARYSAHGRRAA--EENVTWQRLRPALVETESRDLHVSDCLQGLRPGD  291

Query  1417  HIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTV  1596
             H EIQWRR K+FPYGWW+GVVGHL  C G ++ CRC   + VV+EF Q+ P S W+ T +
Sbjct  292   HFEIQWRRTKEFPYGWWFGVVGHLRNCGGEEN-CRCISDENVVMEFRQFRPESPWKTTVL  350

Query  1597  SRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +RKDHRE GNE  GFYGG++K+ + E +STWKRLWP+QVL+
Sbjct  351   NRKDHRETGNEVSGFYGGVKKLGTEEEVSTWKRLWPSQVLD  391



>ref|XP_009142728.1| PREDICTED: F-box protein At2g41170 [Brassica rapa]
Length=391

 Score =   348 bits (893),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 231/341 (68%), Gaps = 14/341 (4%)
 Frame = +1

Query  715   LAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERC  894
             LA R K       DD      ++MS+LDLPDL L+CILEK+ P  LC +  VCS LR++C
Sbjct  59    LAWRRKTRKKKNQDDE-----NKMSLLDLPDLTLDCILEKLSPSELCAMTFVCSELRDKC  113

Query  895   MSDHLWERHLKQKWGGIIGPAAYREWQWHIAL------RKDSRLFNQAKEKGLGSYLSRL  1056
             +SDHLW++H++ KWG ++G AA +EW+ H+A         +   +    ++      + L
Sbjct  114   VSDHLWKKHMENKWGRLMGDAAIKEWKTHVATLMACLKNSNPSSYRSNTQQWRSRLAANL  173

Query  1057  WPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYD  1236
              P S +   +       ++  PIDSVM+WY  LESGKFWFPAQVYNRENGHVGFM+SCYD
Sbjct  174   KPFSWLKTNHGCHNRGSSSSSPIDSVMYWYSNLESGKFWFPAQVYNRENGHVGFMMSCYD  233

Query  1237  AELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGD  1416
             A++ YD +T+TF ARY  HGR A   E  VTW RLR  LV+  + DLH+SDCL  LRPGD
Sbjct  234   AKVRYDNKTNTFQARYSAHGRRAA--EENVTWQRLRPALVETESRDLHVSDCLQGLRPGD  291

Query  1417  HIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTV  1596
             H EIQWRR K+FPYGWW+GVVGHL  C G ++ CRC   + VV+EF Q+ P S W+ T +
Sbjct  292   HFEIQWRRTKEFPYGWWFGVVGHLHNCVGEEN-CRCVSDENVVMEFRQFRPESPWKTTVL  350

Query  1597  SRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +RKDHRE GNE  GFYGG++K+ + E +STWKRLWP+QVL+
Sbjct  351   NRKDHRETGNEVSGFYGGVKKLGTEEEVSTWKRLWPSQVLD  391



>ref|XP_010112851.1| F-box protein [Morus notabilis]
 gb|EXC34974.1| F-box protein [Morus notabilis]
Length=340

 Score =   345 bits (886),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 207/309 (67%), Gaps = 6/309 (2%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
              S+LDLP L LECI E++ P  LC +  VCS LRE C SDHLWERHL+QKWG +IG AAY
Sbjct  19    FSLLDLPQLSLECIFERLSPADLCSMVRVCSVLREMCSSDHLWERHLQQKWGKVIGDAAY  78

Query  964   REWQWHIALR-KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMF  1140
             REW+ H++ +   S L  Q KE+GL   L      S I G       K     P+DSVM 
Sbjct  79    REWRSHVSSKIGQSSLSKQKKERGLLESLRNSQRFSCI-GIKPEKSSKVRTTLPVDSVMA  137

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
             +Y ALESGKFWFPAQ+Y R+NG+   ML CYDA++SYD RT+TF ARY   G      E 
Sbjct  138   FYFALESGKFWFPAQIYYRQNGYTEVMLLCYDAQISYDSRTNTFRARYSSQGWGRG--EE  195

Query  1321  GVTWDRLRAPLVDNPAHDL--HISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
              + WDR+RAP VD P      H+SDCL+DL+PGDHIEIQW+     PY WWY ++GHLE 
Sbjct  196   NIGWDRVRAPPVDVPLDPFVPHVSDCLHDLKPGDHIEIQWKSRTDLPYAWWYALIGHLEL  255

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CD NQ++C CHE DT+V+EFNQY P SRWRRT +SRK H  +GNE +GFYGGI+K+   E
Sbjct  256   CDKNQNHCLCHENDTIVVEFNQYHPTSRWRRTMISRKYHPRQGNEIDGFYGGIRKLSGEE  315

Query  1675  VISTWKRLW  1701
              I+ W   W
Sbjct  316   EIAKWLSFW  324



>gb|KJB55452.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=314

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 212/302 (70%), Gaps = 12/302 (4%)
 Frame = +1

Query  580   KSLAFKLVPTWASEFRL-QLLFRLWKDLSLLTLVR--KNLFSLIPLRMLAMR---SKPGG  741
             KSL  K  P WA+E RL    FR  KD+S     R  KN+  L     +  +    K   
Sbjct  17    KSLTLKPPPPWAAEMRLLSPWFR--KDVSFFLSSRLIKNILGLAYFTTVVSKMSLKKMSF  74

Query  742   CSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERH  921
              SK D+  E   S MS+LDLPDLVLECILE++PP  LC +A VCSSLR RC+SDH WE+H
Sbjct  75    TSKVDNFEEVEESAMSILDLPDLVLECILERLPPAALCSMAGVCSSLRSRCISDHFWEKH  134

Query  922   LKQKWGGIIGPAAYREWQWHIALR--KDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGA  1095
             +K+KWG IIGPAAYREWQWHIALR  KDS    Q K KGL   LS + P S  +   +  
Sbjct  135   MKKKWGRIIGPAAYREWQWHIALRTRKDSSHLMQGKPKGLMRVLSIVRP-SWWIKSKVDD  193

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               K+ +LP  DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF 
Sbjct  194   SSKQCSLPD-DSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFK  252

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARYPPHGR AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  253   ARYPPHGRRAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  312

Query  1456  YG  1461
             YG
Sbjct  313   YG  314



>gb|KEH33372.1| F-box plant-like protein [Medicago truncatula]
Length=378

 Score =   344 bits (883),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 230/328 (70%), Gaps = 22/328 (7%)
 Frame = +1

Query  580   KSLAF-KLVPTWASEFRLQLLFRLWKDLSLLTLVR--KNLFSL-----IPLRMLAMRSKP  735
              SL+F K  P+W SE  ++      + LSL T  +  KN F +     I  RM  +R   
Sbjct  19    NSLSFLKSFPSWTSENEMKH-----QVLSLKTFSKLFKNHFWIGLLCEIHTRMSMVRK--  71

Query  736   GGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
                S   ++VE    ++S+LDLP+L+LECILEK+PP  LC +A +C SLRERC+SD+ WE
Sbjct  72    -SLSSRVENVEEIEDKLSLLDLPELILECILEKLPPSSLCQMAGICHSLRERCVSDYFWE  130

Query  916   RHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGL-GSYLSRLWP---LSVIVGP  1083
             RH+K+KWGG+IG AAYREW+WH+A           K+ GL     S LWP   + + VG 
Sbjct  131   RHMKKKWGGVIGQAAYREWKWHVASNMGVGSLKHGKQSGLWMKIFSLLWPFQGMKLKVGD  190

Query  1084  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  1263
                + + R++L P+++VM WYLA+E+G+FWFPAQVYNRENGH+GF+LSCYDAELSYD RT
Sbjct  191   GNDSCNHRSSL-PVEAVMNWYLAIETGRFWFPAQVYNRENGHLGFLLSCYDAELSYDSRT  249

Query  1264  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  1443
             +TF ARYP HGR   A E G+ W+R+RAP VD   HDLHIS+CL DL PG+HIEIQWRR 
Sbjct  250   NTFLARYPSHGRRE-ARECGIPWERIRAPPVDISPHDLHISNCLNDLHPGNHIEIQWRRK  308

Query  1444  KKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
             K+FPYGWWYGVVGHLE+C+ N+++CRCH
Sbjct  309   KEFPYGWWYGVVGHLESCNNNENHCRCH  336



>ref|XP_006411383.1| hypothetical protein EUTSA_v10016802mg [Eutrema salsugineum]
 gb|ESQ52836.1| hypothetical protein EUTSA_v10016802mg [Eutrema salsugineum]
Length=379

 Score =   343 bits (880),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 213/304 (70%), Gaps = 12/304 (4%)
 Frame = +1

Query  820   CILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA----  987
             CILEK+ P  LC +  VCS LR++C+SDH WE+H+++KWG ++  AA +EW+ H++    
Sbjct  73    CILEKLSPSELCAMTCVCSELRDKCVSDHFWEKHMEKKWGRLMSDAAIQEWKSHVSTLMG  132

Query  988   -LRKDSRLFNQAKEKGLGSYLSRLWPLSVIV----GPNLGAGDKRNNLPPIDSVMFWYLA  1152
              L    R  +++  +     ++ L P S +         G+    +NL PIDSVM+WY  
Sbjct  133   CLGNSKRSSSRSNTQWRSRLVANLKPFSWLSRNHGCEKRGSSSSSSNLAPIDSVMYWYSN  192

Query  1153  LESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTW  1332
             LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  HGR A   E  VTW
Sbjct  193   LENGKFWFPAQVYNRENGHVGFMMSCYDAKVRYDCKTDTFQARYSAHGRRAA--EENVTW  250

Query  1333  DRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQH  1512
              RLR  L+D  + DLH+SDCL  LRPGDH EIQWRR K+FPYGWWYG+VGHL+ CDG  +
Sbjct  251   QRLRPSLIDTESRDLHVSDCLQGLRPGDHFEIQWRRTKEFPYGWWYGIVGHLQNCDGEDN  310

Query  1513  YCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWK  1692
              CRC+  + VV+EF Q+ P S WR T ++RKDHRE GNEA GFYGG++K+ + E ISTWK
Sbjct  311   -CRCNSDENVVMEFRQFRPESPWRTTVLNRKDHRETGNEANGFYGGVKKLGTEEEISTWK  369

Query  1693  RLWP  1704
              LWP
Sbjct  370   GLWP  373



>ref|XP_006446320.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
 gb|ESR59560.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
Length=335

 Score =   339 bits (870),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 216/307 (70%), Gaps = 9/307 (3%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSLIPLRMLAMR-SKPGGCSKA  753
             LA K +P WA    L+LL    WK++S  ++    KN  ++  + + + + S     S +
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHMMSTS  78

Query  754   DDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             +DHVE     ++MSVLDL +LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+H+K
Sbjct  79    NDHVEEVSGGAEMSVLDLHELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEKHMK  138

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
             QKWG I+GPAAYREWQWH+A RKDS    Q K++      S +   S +         + 
Sbjct  139   QKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTSKQT  198

Query  1108  NNLP-PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                  P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF A
Sbjct  199   TTTRLPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQA  258

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RYPPHGR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPY
Sbjct  259   RYPPHGRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPY  318

Query  1459  GWWYGVV  1479
             G +Y  +
Sbjct  319   GMFYSHI  325



>ref|XP_009421126.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 236/387 (61%), Gaps = 26/387 (7%)
 Frame = +1

Query  592   FKLVPTWASEFRLQLLFRLWKDLSLLTLVRKN---LFSLIPLRMLAMRSKPGGCSKADDH  762
              K +P WA E  L L     + L  L  + KN   + + +  +  +   K          
Sbjct  8     VKFLPPWAYEMGLLLALICRELLCSLIDLMKNCCRVSTSVSFKKASTSRKKSDPRSEGSE  67

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
               T     ++L+LP+L L+CILEK+ P+ L  +A VCS LR+RC SDHLWE H+++KWG 
Sbjct  68    ERTAERGTNILNLPELTLDCILEKLSPKELVTVACVCSCLRDRCRSDHLWESHMRKKWGR  127

Query  943   IIGPAAYREWQWHIALRK----DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR-  1107
             ++G AA R W+ + A RK     + L    K K    YL            +    D+R 
Sbjct  128   LLGEAARRAWESYAASRKHALGSATLVQHTKPKNWMGYL---------FSRSNSDADRRL  178

Query  1108  ---NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
                NN  P D  M  Y ALESG+ W PAQ+ NRENG+VGF+LSCYDAEL YD  +DTF+A
Sbjct  179   NIVNNTSPADVTMSCYSALESGRLWVPAQICNRENGNVGFVLSCYDAELRYDRHSDTFYA  238

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RY PHG  AV  E GV+W+R+R P VD   H++H+S+CL +L PGDHIE+QWRR++KFP 
Sbjct  239   RYYPHGSKAVQEEEGVSWNRVRVPPVDISPHEIHVSECLSELSPGDHIEVQWRRSQKFPC  298

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHRE-EGNEAE  1635
             GWWYGV+GHL++CDG++  C C+     + EF QY PGSRWRR TVSRK+H E +GNE  
Sbjct  299   GWWYGVIGHLDSCDGDEQRCLCN-----LSEFKQYPPGSRWRRATVSRKNHEEGKGNETT  353

Query  1636  GFYGGIQKVESREVISTWKRLWPAQVL  1716
             GFYGGI+K+  ++ I  W R WP + L
Sbjct  354   GFYGGIRKLHCKDEICMWLRHWPEESL  380



>ref|XP_004970297.1| PREDICTED: F-box protein At2g41170-like isoform X3 [Setaria italica]
Length=451

 Score =   342 bits (877),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 219/365 (60%), Gaps = 58/365 (16%)
 Frame = +1

Query  796   DLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQ  975
             DLP+L L+ +LE++ P  L  +A VC++LR RC +D LWERHL+ KWG ++G  A +EW+
Sbjct  88    DLPELALDRVLEELSPASLAAMACVCAALRGRCSADALWERHLRAKWGRVLGGTARKEWE  147

Query  976   WHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI---------  1125
               +  R   +     A+ +     L+  WP S I G  L  GD       +         
Sbjct  148   AELGARATRASAPRPARRRSWADSLACAWPFSWIAGRWL-KGDATPAPAAVAAEPAPATA  206

Query  1126  ----DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
                 D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPH
Sbjct  207   APPTDTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPH  266

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY-----  1458
             GR     E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPY     
Sbjct  267   GRKPAKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGTYAR  326

Query  1459  -------------------------------------GWWYGVVGHLETCDGNQH-YCRC  1524
                                                  GWWYGVVGH  +C+ N+H +CRC
Sbjct  327   ITSPAFKPQYAAARHDSTISVGSSVADTMPFLRCVTTGWWYGVVGHQASCNANEHLWCRC  386

Query  1525  HECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWP  1704
             HE D +VLEF  Y+PGSRWR+TTVSRKDHRE G+E +GFYGGI+K+++++ I+TW+R WP
Sbjct  387   HEDDMIVLEFQHYAPGSRWRQTTVSRKDHRETGDETDGFYGGIRKLQTKDEIATWRRFWP  446

Query  1705  AQVLE  1719
               VL 
Sbjct  447   VDVLN  451



>gb|EEE55551.1| hypothetical protein OsJ_03804 [Oryza sativa Japonica Group]
Length=404

 Score =   334 bits (857),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 211/321 (66%), Gaps = 24/321 (7%)
 Frame = +1

Query  772   TVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIG  951
               + + +LDLP+L LE +LE++ P  L  +A VC +LR+RC +D LW RH+ +KWG ++G
Sbjct  101   NAAALPLLDLPELALERVLEELEPPSLAAMACVCVALRDRCSADTLWGRHVNRKWGRVLG  160

Query  952   PAAYREWQWHIALRKDS-RLFNQAKEKGLGSYLSRLWPLSVIV-----GPNLGAGDKRNN  1113
              AA +EW+  +A R+ S  L   A+ + L   L+  WP S I      G  + A      
Sbjct  161   AAARKEWEAELAARRSSGALPRPARRRSLADSLACAWPFSWITCRWLKGNAVAAEPAAAT  220

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
               P+ S               PA      +GHVGF+LSCYDA L YD RTDTF ARYPPH
Sbjct  221   PSPLPS---------------PA---TDTDGHVGFVLSCYDAHLRYDRRTDTFTARYPPH  262

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR     E+GV W R+R+P V  PAHDLH S CL DLRPGDH EIQWR+NK FPYGWWYG
Sbjct  263   GRKPAKEESGVQWSRVRSPPVSTPAHDLHASGCLGDLRPGDHFEIQWRKNKDFPYGWWYG  322

Query  1474  VVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGI  1653
             VVGH ETC+ N+H CRCHE D VVLEF  Y+ GSRWR+TTVSRKDHRE+G+E +GFYGGI
Sbjct  323   VVGHQETCNANEHLCRCHEDDMVVLEFKHYAAGSRWRQTTVSRKDHREKGDETDGFYGGI  382

Query  1654  QKVESREVISTWKRLWPAQVL  1716
             +K+++ + ISTW++ WP  VL
Sbjct  383   RKLQTSDEISTWRKFWPVDVL  403



>ref|XP_010653619.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Vitis vinifera]
Length=415

 Score =   333 bits (853),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 218/318 (69%), Gaps = 24/318 (8%)
 Frame = +1

Query  610   WASEFRLQLLFRLWKDL--SLLTLVRKNLFSLI---------PLRMLAMRSKPGGCSKAD  756
             W SE RL L    W++L   L++ +RK    +I         PL+M  + SK     + +
Sbjct  86    WESETRL-LSPWFWRELWSFLVSCIRKGRLGIISFLQVPFVFPLKM-TISSKVVNAEEEE  143

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D        +S+LDLP+L LECIL+++ P GLC +A VC+SLR+RC SDHLWE+H+KQKW
Sbjct  144   D--------VSLLDLPELALECILQRLSPSGLCSMARVCTSLRDRCRSDHLWEKHMKQKW  195

Query  937   GGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNL  1116
             G +IGPAAYREWQWHIA RK   L  +  ++GL   L  + PLS I  P L +  + +  
Sbjct  196   GRVIGPAAYREWQWHIASRKRPSLLKKCNKRGLFRSLFSVCPLSWI-RPKLESSGEPSCS  254

Query  1117  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
               +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD RTDTF ARY P G
Sbjct  255   LSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSRTDTFRARYSPQG  314

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
                  IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+NK+ PYGWWYG+
Sbjct  315   PQ--TIEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRKNKELPYGWWYGI  372

Query  1477  VGHLETCDGNQHYCRCHE  1530
             + HLETC+GN+++C CH 
Sbjct  373   ISHLETCNGNENHCCCHN  390



>ref|XP_006644069.1| PREDICTED: F-box protein At2g32560-like [Oryza brachyantha]
Length=195

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = +1

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M  YL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHGR  V +
Sbjct  1     MSCYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHGRRTVVL  60

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
             E GV WDR+RAP V+  AHDLH+SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGHLE+
Sbjct  61    EDGVQWDRVRAPPVNTHAHDLHVSDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGHLES  120

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CDG++H+CRCH  DTVVLEFNQY+PGSRWR+  V+RKDHREEGNE +GFYGGI+K+ S++
Sbjct  121   CDGSEHFCRCHLSDTVVLEFNQYTPGSRWRQALVNRKDHREEGNEGDGFYGGIRKLRSKD  180

Query  1675  VISTWKRLWPAQVLE  1719
              IS W++LWP  +LE
Sbjct  181   EISKWRQLWPTDILE  195



>emb|CBI32779.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   328 bits (840),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 189/247 (77%), Gaps = 3/247 (1%)
 Frame = +1

Query  922   LKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGD  1101
             +KQKWG +IGPAAYREWQWHIA RK   L  +  ++GL   L  + PLS I  P L +  
Sbjct  1     MKQKWGRVIGPAAYREWQWHIASRKRPSLLKKCNKRGLFRSLFSVCPLSWI-RPKLESSG  59

Query  1102  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  1281
             + +    +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD RTDTF AR
Sbjct  60    EPSCSLSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSRTDTFRAR  119

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             Y P G     IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+NK+ PYG
Sbjct  120   YSPQGPQT--IEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRKNKELPYG  177

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYG++ HLETC+GN+++C CH  D ++LEFNQYSPGS+WRR  ++RK+H+EEGN A+GF
Sbjct  178   WWYGIISHLETCNGNENHCCCHNNDMLILEFNQYSPGSQWRRVVINRKNHQEEGNGADGF  237

Query  1642  YGGIQKV  1662
             YGGI+K+
Sbjct  238   YGGIRKI  244



>gb|KDO53603.1| hypothetical protein CISIN_1g040396mg, partial [Citrus sinensis]
Length=226

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = +1

Query  1045  LSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFML  1224
             L   WP S          + R++LP +DS+M WY++LESGKFWFPAQVYNRENGHVGFML
Sbjct  5     LYSCWPFSWSERKTESNTEPRSSLP-VDSIMAWYVSLESGKFWFPAQVYNRENGHVGFML  63

Query  1225  SCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDL  1404
             SCYDA+LSYD RTDTF ARY PHGR  V  E  ++WDRLRAP VD P+H LH SDCL+DL
Sbjct  64    SCYDAQLSYDSRTDTFRARYSPHGRRMV--EENISWDRLRAPAVDTPSHVLHNSDCLHDL  121

Query  1405  RPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWR  1584
             +PGDHIEIQWRRNK+FPYGWWYGVVGHLE+C  N+H+C C   DTVVLEFNQY  GSRWR
Sbjct  122   KPGDHIEIQWRRNKEFPYGWWYGVVGHLESCGRNEHHCLCFYKDTVVLEFNQYPTGSRWR  181

Query  1585  RTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVLE  1719
             +T ++RKDHRE GNEA+GFYGGI+K+   E IS WK LWP   LE
Sbjct  182   QTMINRKDHREVGNEADGFYGGIRKIYKEEEISMWKSLWPRHALE  226



>ref|XP_011027255.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Populus euphratica]
Length=346

 Score =   325 bits (832),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 206/308 (67%), Gaps = 14/308 (5%)
 Frame = +1

Query  628   LQLLFRLWKDLS--LLTLVRKNLFSL----IPLRMLAMRSKPGGCSKADDHVETTVSQM-  786
             L L  R W + S  L++   K  F +    +P++M   +   G  S+  + VE    +  
Sbjct  8     LSLGPRFWGEFSSFLVSWFNKGRFVVSLFQVPMKMPLKKVNLG--SRVQEIVEEEEEEEE  65

Query  787   --SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
               S+LDLP+L LE ILE++ P GLC +A VCSSLR+RC SDHLWE+HLKQKWG +IG +A
Sbjct  66    EPSLLDLPELALERILERLSPAGLCSMAGVCSSLRDRCRSDHLWEKHLKQKWGRVIGESA  125

Query  961   YREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMF  1140
             Y+EWQWHIA  K   L +Q   KG    L  +WP          +  K     P+DS+M 
Sbjct  126   YKEWQWHIASSKRPSLLDQRNRKGFMGSLISMWPF-CWFKLKCESRSKPKTCLPVDSIMA  184

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
              YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+L+YD +TDTF ARY P  R    IE 
Sbjct  185   LYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLNYDSKTDTFQARYSPFARQ--TIEQ  242

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCD  1500
              + W+RLRAP VD PAH LH SDCL DL+PGDHIEIQWRR+K+FPYGWWY VVGH E CD
Sbjct  243   SIHWERLRAPPVDTPAHVLHPSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVVGHQELCD  302

Query  1501  GNQHYCRC  1524
             GN++ C C
Sbjct  303   GNENRCHC  310



>gb|KHN30351.1| F-box protein [Glycine soja]
Length=267

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 193/266 (73%), Gaps = 3/266 (1%)
 Frame = +1

Query  922   LKQKWGGIIGPAAYREWQWHIALRKDSRLF-NQAKEKGLGSYLSRLWPLSVIVGPNLGAG  1098
             +++KWG + G AAYR+W+WH+A +   ++  N   +KG+ ++L   +   + +      G
Sbjct  1     MERKWGKVFGDAAYRQWKWHVASKNREKISSNPHNQKGIFAFLRGGFLPFIWIKAKSEKG  60

Query  1099  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  1278
              + ++  P DS+   YL+LESGKFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF A
Sbjct  61    TESSSSLPEDSIAALYLSLESGKFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFLA  120

Query  1279  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  1458
             RY PHGR     E  + WDRLR P +    H LHISDCL DLRPGDHIEIQWRRNK+FPY
Sbjct  121   RYSPHGRWTT--EENIQWDRLRVPPIATSPHALHISDCLDDLRPGDHIEIQWRRNKEFPY  178

Query  1459  GWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEG  1638
             GWWYGV+GHLE C G+ ++C CH  D V+LEF QY+ GSRWR+T ++RK H E+GNE +G
Sbjct  179   GWWYGVIGHLEQCQGHGNHCHCHYNDIVILEFTQYTAGSRWRQTVINRKHHIEKGNEIDG  238

Query  1639  FYGGIQKVESREVISTWKRLWPAQVL  1716
             FYGGI+K+ S+E I+ WK LWP +++
Sbjct  239   FYGGIRKLHSKEEIARWKNLWPTKIV  264



>ref|XP_002975888.1| hypothetical protein SELMODRAFT_104188 [Selaginella moellendorffii]
 gb|EFJ22793.1| hypothetical protein SELMODRAFT_104188 [Selaginella moellendorffii]
Length=358

 Score =   322 bits (825),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 202/313 (65%), Gaps = 19/313 (6%)
 Frame = +1

Query  832   KVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLF  1011
             ++P + L  L  VC  LR+RC S H WE  + +KWG I GP AYREW  +  L    R  
Sbjct  48    RLPADSLLRLGGVCQELRQRCKSGHFWEALVYEKWGKIAGPGAYREWCRNPVLESSPRKG  107

Query  1012  NQAKEKGLGSYLSR----------------LWPLSVIVGPNLGAGDKRNNLPPIDSVMFW  1143
               A+E    +   R                LWPLSV     + +  K     P DS+M W
Sbjct  108   RTAQEIAAKNACERPNCGWKLLWPSIAAACLWPLSVARERLMASRSKAPT--PSDSLMAW  165

Query  1144  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETG  1323
             Y ALE+G  WF  QV+NRENGHVGF+LSCYDAELSY   +D+F ARYPPHG  A+ +E  
Sbjct  166   YWALETGNLWFRGQVFNRENGHVGFLLSCYDAELSYVRSSDSFRARYPPHGPRALVMEDD  225

Query  1324  VTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC-D  1500
             ++W+R+RA  V  PAHDLH SDCL +LRPGDHIE+QWRR K+FPYGWWYG+VGH E+C +
Sbjct  226   ISWERVRASPVQTPAHDLHTSDCLAELRPGDHIEVQWRRTKEFPYGWWYGIVGHSESCSN  285

Query  1501  GNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVI  1680
                +  +C   DTV L FNQ++ GSRW+RT + R  HREEGNE +G+YGGI+K+ S++ +
Sbjct  286   AGNNSIQCFFVDTVWLVFNQFTSGSRWKRTPIDRVSHREEGNETDGYYGGIRKLRSKDEV  345

Query  1681  STWKRLWPAQVLE  1719
             S W+RLWP  +LE
Sbjct  346   SMWERLWPVDILE  358



>ref|XP_002968595.1| hypothetical protein SELMODRAFT_409561 [Selaginella moellendorffii]
 gb|EFJ30849.1| hypothetical protein SELMODRAFT_409561 [Selaginella moellendorffii]
Length=362

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 205/318 (64%), Gaps = 25/318 (8%)
 Frame = +1

Query  832   KVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLF  1011
             ++P + L  L  VC  LR+RC S H WE  + +KWG I GP AYREW  +  L    R  
Sbjct  48    RLPADSLLRLGGVCQELRQRCKSGHFWESLVYEKWGEIAGPGAYREWCRNPVLESSPRKG  107

Query  1012  NQAKEKGLGSYLSR----------------LWPLSVIVGPNLGAGDKRNNLP-PIDSVMF  1140
               A+E    +   R                LWPLSV     +     R+  P P DS+M 
Sbjct  108   RTAQEIAAKNACERPNCGWKLLWPSIAAACLWPLSVARERLMAL---RSKAPRPSDSLMA  164

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
             WY ALE+G  WF  QV+NRENGHVGF+LSCYDAELSY   +D+F ARYPPHG  A+ +E 
Sbjct  165   WYWALETGNLWFRGQVFNRENGHVGFLLSCYDAELSYVRSSDSFRARYPPHGPRALVMED  224

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC-  1497
              ++W+R+RA  V  PAHDLH SDCL +LRPGDHIE+QWRR K+FPYGWWYG+VGH ++C 
Sbjct  225   DISWERVRASPVQTPAHDLHTSDCLAELRPGDHIEVQWRRTKEFPYGWWYGIVGHSDSCS  284

Query  1498  ----DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
                 + ++ +C C   +TV L FNQ++ GSRW+RT + R  HREEGNE +G+YGGI+K+ 
Sbjct  285   NAGNNSSRQHCSCQSDNTVWLVFNQFTSGSRWKRTPIDRVSHREEGNETDGYYGGIRKLR  344

Query  1666  SREVISTWKRLWPAQVLE  1719
             S++ IS W+RLWP  +LE
Sbjct  345   SKDEISMWERLWPVDILE  362



>ref|XP_010521562.1| PREDICTED: LOW QUALITY PROTEIN: hydroxymethylglutaryl-CoA lyase, 
mitochondrial [Tarenaya hassleriana]
Length=799

 Score =   333 bits (853),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 195/273 (71%), Gaps = 18/273 (7%)
 Frame = +1

Query  751   ADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQ  930
             A + V     +MS+LDLP+L L CIL+++PP GLC +  VCSSLRERC+SDHLW++HLK 
Sbjct  93    ASEVVFPAAGEMSILDLPELALRCILDRLPPSGLCSMVGVCSSLRERCVSDHLWQKHLKM  152

Query  931   KWGGIIGPAAYREWQWHIALRKDSRLFN-QAKEKGLGSYLSRLWPLSVIVGPNL------  1089
             KWG  +GP+A+REWQ +IA R +    + Q   +     +S  WP+S I    +      
Sbjct  153   KWGKFLGPSAHREWQRYIASRNNLGFVDKQTGHRRFVKLVSLFWPISSIFLSKVVDSHNF  212

Query  1090  -GAGDKRNNLP------PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELS  1248
               +GD+           P+DS+M  YLALE+ +FWFPAQV+NRENGHVGFMLSCYDAELS
Sbjct  213   NXSGDENKQRKQSSVSLPVDSIMNLYLALETDRFWFPAQVFNRENGHVGFMLSCYDAELS  272

Query  1249  YDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEI  1428
             YDP TDTF ARY PHGR  VA+E GVTW+RLRAP +D   H LH+SDCL +L+PGDHIEI
Sbjct  273   YDPHTDTFEARYTPHGRRVVAVEKGVTWERLRAPPLDTSPHHLHVSDCLNELKPGDHIEI  332

Query  1429  QWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  1527
             QWRRNK+FPYGWWYGV    E+CDGN+++C CH
Sbjct  333   QWRRNKEFPYGWWYGV----ESCDGNENHCHCH  361



>ref|XP_007028346.1| F-box family protein isoform 5 [Theobroma cacao]
 gb|EOY08848.1| F-box family protein isoform 5 [Theobroma cacao]
Length=318

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/302 (56%), Positives = 209/302 (69%), Gaps = 16/302 (5%)
 Frame = +1

Query  580   KSLAFK-LVPTWASEFRLQLLFRLWKDLS--LLTLVRKN----LFSLIPLRMLAMRSKPG  738
             KSL+FK   P    E+RL L    W+  S  +++  +K      F  +P+ +L +R K  
Sbjct  16    KSLSFKNQYPRMKGEWRL-LSPWFWEGFSSFMVSWFQKGRLGICFYQLPM-ILTLRKKMR  73

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
                K D+  E    ++S+LDLP+L LECILE++ P GLC +A VCSS RERC SDHLWE+
Sbjct  74    LGPKVDNVEE---ERISLLDLPELTLECILERLSPAGLCSMAGVCSSFRERCTSDHLWEK  130

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL-GA  1095
             H+KQKWG +IG AA+REWQWHIA RK   L   +K+KG    L+ +WP S    PNL G+
Sbjct  131   HMKQKWGKVIGDAAHREWQWHIASRKRPNLLGPSKQKGFLGSLTNMWPFSWFT-PNLEGS  189

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD +TDTF 
Sbjct  190   SSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDSKTDTFQ  249

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWRRNK+FP
Sbjct  250   ARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWRRNKEFP  307

Query  1456  YG  1461
             YG
Sbjct  308   YG  309



>ref|XP_007028343.1| F-box family protein isoform 2 [Theobroma cacao]
 gb|EOY08845.1| F-box family protein isoform 2 [Theobroma cacao]
Length=311

 Score =   312 bits (800),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 208/301 (69%), Gaps = 16/301 (5%)
 Frame = +1

Query  580   KSLAFK-LVPTWASEFRLQLLFRLWKDLS--LLTLVRKN----LFSLIPLRMLAMRSKPG  738
             KSL+FK   P    E+RL L    W+  S  +++  +K      F  +P+ +L +R K  
Sbjct  16    KSLSFKNQYPRMKGEWRL-LSPWFWEGFSSFMVSWFQKGRLGICFYQLPM-ILTLRKKMR  73

Query  739   GCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWER  918
                K D+  E    ++S+LDLP+L LECILE++ P GLC +A VCSS RERC SDHLWE+
Sbjct  74    LGPKVDNVEE---ERISLLDLPELTLECILERLSPAGLCSMAGVCSSFRERCTSDHLWEK  130

Query  919   HLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNL-GA  1095
             H+KQKWG +IG AA+REWQWHIA RK   L   +K+KG    L+ +WP S    PNL G+
Sbjct  131   HMKQKWGKVIGDAAHREWQWHIASRKRPNLLGPSKQKGFLGSLTNMWPFSWFT-PNLEGS  189

Query  1096  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  1275
               +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD +TDTF 
Sbjct  190   SSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDSKTDTFQ  249

Query  1276  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  1455
             ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWRRNK+FP
Sbjct  250   ARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWRRNKEFP  307

Query  1456  Y  1458
             Y
Sbjct  308   Y  308



>ref|XP_011075626.1| PREDICTED: F-box protein At2g32560-like [Sesamum indicum]
Length=373

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 222/340 (65%), Gaps = 17/340 (5%)
 Frame = +1

Query  604   PTWASEFRL----QLLFRLWKDLSLLTLVRKNLF---SLIPLRMLAMRSKPGGCSKADDH  762
             PT   EFR+    ++ F L+   S+L   ++ +F   S +P    +++       +  + 
Sbjct  23    PTSEIEFRIWAFPRISFELFHRFSVLMGRKRKIFISVSQVPKAFPSIKRFLSARFENLNQ  82

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             VE     +S+LDLPDLVL+CILEK+ P  LC +A VCS LRE C SDHLWE+ LKQKWGG
Sbjct  83    VEEEKDGISLLDLPDLVLDCILEKLSPADLCSMAGVCSYLRETCASDHLWEKRLKQKWGG  142

Query  943   IIGPAAYREWQW-HIALRKDSRLFNQAKEKGLGSYLSRLWPLSVI----VGPNLGAGDKR  1107
             +IG AAY+EWQ   IA + D +  +   ++      S   PL  +              R
Sbjct  143   VIGEAAYKEWQCRQIASKMDPKFLHSTAKRSKFRLFSG--PLEFLKHKSELKESSKSSSR  200

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
               LPP +SVM  YLALESGKFWFPAQV+NR NG+VGFMLSCYDA+LSYD   D F ARYP
Sbjct  201   CPLPP-NSVMSCYLALESGKFWFPAQVFNRGNGNVGFMLSCYDAQLSYDSIADNFVARYP  259

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
               GR    IE G+ WDR+RAP VD PA+ LHISDCL++L+P DHIEIQW +NK+FPYGWW
Sbjct  260   AQGRSM--IEEGIEWDRIRAPSVDTPANVLHISDCLHELKPDDHIEIQWTKNKEFPYGWW  317

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRR  1587
             YGVVGHL++C+ N+  C CH  DTV+LEF QYS  SRWR+
Sbjct  318   YGVVGHLDSCNANEFNCYCHISDTVILEFKQYSRESRWRK  357



>ref|XP_006646414.1| PREDICTED: F-box protein At2g26850-like [Oryza brachyantha]
Length=301

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = +1

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
             D+V  WY A+E G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  104   DTVAAWYRAVECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKP  163

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  1485
                E+GV W R+RAP V  PAHDLH S CL +LRPGDH EIQWR+NK FPYGWWYGVVGH
Sbjct  164   AKEESGVQWSRIRAPPVSTPAHDLHASGCLGNLRPGDHFEIQWRKNKDFPYGWWYGVVGH  223

Query  1486  LETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVE  1665
              ETC+ N H CRCHE D VVLEF  Y+ GSRWR+TTVSRKDHRE+G+E +GFYGGI+K++
Sbjct  224   QETCNANDHLCRCHEDDMVVLEFKHYAAGSRWRQTTVSRKDHREKGDETDGFYGGIRKLQ  283

Query  1666  SREVISTWKRLWPAQVL  1716
             + + ISTW++ WP  VL
Sbjct  284   TNDEISTWRKFWPVDVL  300



>ref|XP_010112850.1| F-box protein [Morus notabilis]
 gb|EXC34973.1| F-box protein [Morus notabilis]
Length=344

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 216/341 (63%), Gaps = 28/341 (8%)
 Frame = +1

Query  745   SKADDHVETTVSQ---MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
             S    HVE    +   +S+LDLP+L+LECI E++ P  LC++  VC+ LR  C SDH+WE
Sbjct  10    SSCSSHVENEKDEEKTISLLDLPELILECIFERLLPADLCNMIGVCTFLRVMCTSDHIWE  69

Query  916   RHLKQKWGGIIGPAAYREW---------QWHIAL-RKDSRLFNQAKEKGLGSYLSRLWPL  1065
             +HL +KWG +IG AAYR+W         Q H+A     + L+N+ +++    Y+ +  P+
Sbjct  70    KHLTRKWGKLIGEAAYRKWIGDAAYRAWQAHVASWNGPNFLYNRKRQR---EYMLKSPPV  126

Query  1066  SVI---VGPNL--GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSC  1230
             ++    + P+L   + +  +   P+  VM +YLALESGKFWFPAQVY   NG+ G  L C
Sbjct  127   ALRFSRIRPDLVEKSCEASSGTLPVGHVMAFYLALESGKFWFPAQVYYGGNGYTGVTLLC  186

Query  1231  YDAELSYDPRTDTFHARYPPH--GRMAVAIETGVTWDRLRAPLVDN-PAHDLHISDCLYD  1401
             YDA++SYD  TDTF A YP    GR     ET + WDRLRAP VD       H+SD L+D
Sbjct  187   YDAQVSYDYSTDTFRASYPAQVWGRN----ETNIKWDRLRAPPVDTLDPFTPHVSDYLHD  242

Query  1402  LRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRW  1581
             L+PGDHIEIQW+ + K PYGWWY +VGHL+ CD N ++CRCH  DT+V+EF QY PGS W
Sbjct  243   LKPGDHIEIQWKSHDKSPYGWWYALVGHLDQCDENVNHCRCHYSDTLVVEFKQYPPGSIW  302

Query  1582  RRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWP  1704
             RRT ++RK    EGN A+  YGGI+K+   E IS W    P
Sbjct  303   RRTMLNRKHRLREGNGADRLYGGIRKISDEEEISKWLHYLP  343



>gb|EPS66079.1| hypothetical protein M569_08700, partial [Genlisea aurea]
Length=366

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/311 (46%), Positives = 198/311 (64%), Gaps = 14/311 (5%)
 Frame = +1

Query  787   SVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYR  966
             S+LDLPDL ++ I EK+ P  LC ++ VC+SL++ C S+HLW+ H KQKWG + G AAY+
Sbjct  69    SLLDLPDLPMDAIFEKLSPAELCVMSMVCTSLKQTCTSNHLWDGHFKQKWGDVFGEAAYK  128

Query  967   EWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWY  1146
             +W+ +          + +      ++    W    I     G+           S+M  Y
Sbjct  129   QWEENNVTSSRRASSSSSSRWKGNNFFLGFWRKREIDSWEKGS-----------SLMALY  177

Query  1147  LALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGV  1326
             +ALE+GKFWFPAQV+NRENG +GF LSCYDA++ YD  TD F ARYP  G     IE  +
Sbjct  178   IALETGKFWFPAQVFNRENGFLGFALSCYDAKICYDSTTDHFIARYPSQG--VSLIEESI  235

Query  1327  TWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGN  1506
              W+R+RAP+VD P++ LH+SDCL +L+P D +EIQWR+N  FPYGWWYGVVGHL++C GN
Sbjct  236   GWNRIRAPVVDTPSNILHVSDCLNELKPDDQVEIQWRKNNLFPYGWWYGVVGHLDSCSGN  295

Query  1507  QHY-CRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVIS  1683
              +  C C   D++++EF QY  GSRWR+  +SRK     G+E +G+YGGI+++     I 
Sbjct  296   TYCGCSCRFNDSLIVEFKQYEVGSRWRKVKISRKKQGVVGDEVDGYYGGIRRICREREIE  355

Query  1684  TWKRLWPAQVL  1716
              W+R WP   L
Sbjct  356   KWRRFWPKCAL  366



>gb|EMS62261.1| hypothetical protein TRIUR3_33055 [Triticum urartu]
Length=176

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 159/195 (82%), Gaps = 19/195 (10%)
 Frame = +1

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M WYL LES KFWFPAQVYNRE+GHVGFM+SCYDAELSYD RTDTFHAR           
Sbjct  1     MSWYLHLESSKFWFPAQVYNREHGHVGFMMSCYDAELSYDFRTDTFHAR-----------  49

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  1494
                     +RAP V   AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGHLE+
Sbjct  50    --------VRAPPVGTLAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGHLES  101

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CDGN+H+CRCH  DTVVLEFNQY+PGSRWR++ V+RKDHREEGNE++GFYGGI+K++ ++
Sbjct  102   CDGNEHFCRCHLSDTVVLEFNQYTPGSRWRQSLVNRKDHREEGNESDGFYGGIRKLQDKD  161

Query  1675  VISTWKRLWPAQVLE  1719
              IS WK+LWP  +LE
Sbjct  162   EISKWKQLWPTDILE  176



>ref|XP_010112859.1| F-box protein [Morus notabilis]
 gb|EXC34982.1| F-box protein [Morus notabilis]
Length=344

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 210/333 (63%), Gaps = 22/333 (7%)
 Frame = +1

Query  745   SKADDHVETTVSQ---MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWE  915
             S    HVE    +   +S+LDLP+L+LECI E++ P  LC++  VC+ LR  C SDH+WE
Sbjct  10    SSYSSHVENEKDKEKTISLLDLPELILECIFERLLPADLCNMIGVCTFLRVMCTSDHIWE  69

Query  916   RHLKQKWGGIIGPAAYREW---------QWHIAL-RKDSRLFNQAKEKGLGSYLSRLWPL  1065
             +HL +KWG +IG AAYR+W         Q H+A     + L+N+ +++       R+   
Sbjct  70    KHLTRKWGKLIGEAAYRKWIGDAAYRAWQAHVASWNGPNFLYNRKRKREYMLKSPRVALR  129

Query  1066  SVIVGPNL--GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDA  1239
                +  NL   + +  +   P+  VM +YLALESGKFWFPAQ+Y   NG+ G ML CYDA
Sbjct  130   FSRIRDNLEEKSCEASSGTLPVGHVMAFYLALESGKFWFPAQIYYGGNGYTGAMLLCYDA  189

Query  1240  ELSYDPRTDTFHARYPPH--GRMAVAIETGVTWDRLRAPLVDNP-AHDLHISDCLYDLRP  1410
             ++SYD  TDTF A YP H  GR     ET + WDRLRA  VD P     H+SD L+DL+P
Sbjct  190   QVSYDYSTDTFRASYPAHVWGRK----ETNIKWDRLRAAPVDTPDPFTPHVSDYLHDLKP  245

Query  1411  GDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRT  1590
             GDHIEIQW+ + K PYGWWY +VGHL+ CD N ++CRC   DT+V+EF QY P S  RRT
Sbjct  246   GDHIEIQWKSHDKSPYGWWYALVGHLDQCDENVNHCRCPYSDTLVVEFKQYPPVSIHRRT  305

Query  1591  TVSRKDHREEGNEAEGFYGGIQKVESREVISTW  1689
              ++RK H  EGN A+  YGGI+K+ + E IS W
Sbjct  306   MLNRKHHLREGNAADRLYGGIRKISNEEEISKW  338



>gb|AAC25938.1| unknown protein [Arabidopsis thaliana]
Length=228

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 172/229 (75%), Gaps = 5/229 (2%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MSVLDLP+L L+CIL+ +PP GLC +A VCSSLRERC+SDHLWE+HLK KWG I+GPAA+
Sbjct  1     MSVLDLPELALDCILDLLPPSGLCSMARVCSSLRERCVSDHLWEKHLKTKWGKILGPAAH  60

Query  964   REWQWHIALRK---DSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSV  1134
             REWQ +I+      DS   +Q    G    +S +  LS +   +       ++LP +DS 
Sbjct  61    REWQCYISSSTYHLDSP-HHQTGNLGFAKIISLIRSLSSVFREDKQRRGYASSLP-LDSS  118

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR A AI
Sbjct  119   MSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGRRASAI  178

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             E GVTWDR+RA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYG
Sbjct  179   EKGVTWDRIRAAPIDASPHLLHVSDSLKELKPGDHIEIQWRRNKEFPYG  227



>gb|ADE76919.1| unknown [Picea sitchensis]
Length=324

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 195/313 (62%), Gaps = 9/313 (3%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S LDLP+LVLE I  ++PP+ LC LA  C +LR +C SD +WE    ++WG +IGP A+
Sbjct  20    LSFLDLPELVLESIFRRLPPQSLCRLAQTCRNLRMKCRSDAIWEPLFYERWGKVIGPTAF  79

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLP-PIDSVMF  1140
               W+  +   +++R+ N++         S  W L +    +    ++++ L  P +    
Sbjct  80    TAWE-RMVKGENARILNRS------DMPSCFWMLPLTCIWSFSRHNEKSVLEEPSERFAS  132

Query  1141  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  1320
              Y  LESGK WFPAQVYNR+NGHVGF+LSCYDAEL+Y   +DTF ARY P+    V IE 
Sbjct  133   MYSDLESGKLWFPAQVYNRQNGHVGFVLSCYDAELNYVRDSDTFCARYSPY-YPRVIIED  191

Query  1321  GVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCD  1500
             G+ W R+R P V+    ++HI D   + RPGDHIE+QW+R + FPYGWWYG+VGH   C 
Sbjct  192   GIPWARIRKPAVETSPSEIHIPDIAEEFRPGDHIEVQWKRCQYFPYGWWYGIVGHAANCT  251

Query  1501  GNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVI  1680
              +   C CH  + + LEF QY  GSRWR+  + RK  RE+ +  +GFYGGI+K+   + I
Sbjct  252   RDDQDCECHLDEVLWLEFRQYIRGSRWRKVQIKRKRTREDSSGLDGFYGGIRKLYREDEI  311

Query  1681  STWKRLWPAQVLE  1719
             S W  LWP Q L+
Sbjct  312   SAWLDLWPKQTLQ  324



>ref|XP_010673039.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=348

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 177/251 (71%), Gaps = 8/251 (3%)
 Frame = +1

Query  826   LEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSR  1005
             L+++ P  LC +A VCS LR +C S+H+WE+H+K KWG +IG AA  +W  H    ++ R
Sbjct  102   LDRLSPAELCSMAGVCSYLRGKCRSNHMWEKHMKNKWGRVIGNAALVKWHEHKHKPQNKR  161

Query  1006  LFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGD-KRNNLPPIDSVMFWYLALESGKFWFPA  1182
              F+    K  G   S LWP S++V P LG     + +LPP DS+M WYL+LESG+FWFPA
Sbjct  162   KFSLRGNKNGGIIFS-LWPFSLMVRPKLGGTSLIKGSLPP-DSIMSWYLSLESGEFWFPA  219

Query  1183  QVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDN  1362
             QVYNRENGH GF+LSCYDA+LSY+ ++DTF ARY  HGR  V  E  ++W R+RAP +DN
Sbjct  220   QVYNRENGHDGFVLSCYDAKLSYNSKSDTFQARYTVHGRETV--EENISWSRIRAPPIDN  277

Query  1363  PAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHE---C  1533
               +DLH+SD L DL+PGDH EIQWRRN+ FPYGWWYGVV HLE+C  N+ +C CH+   C
Sbjct  278   SPYDLHVSDSLDDLKPGDHFEIQWRRNRGFPYGWWYGVVDHLESCTRNEDHCICHDNGSC  337

Query  1534  DTVVLEFNQYS  1566
              + V + + YS
Sbjct  338   TSYVQQNDYYS  348



>ref|XP_003537295.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=316

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/312 (44%), Positives = 196/312 (63%), Gaps = 15/312 (5%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S+LDLP+  L+ IL+   P  LC ++ VC SL+++C SDH WE H+K KWG +IG A Y
Sbjct  10    VSLLDLPEPTLDLILKCFSPNELCTVSEVCVSLKDKCQSDHFWEHHIKHKWGRVIGDAVY  69

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +EW+WHI + K+    NQ      GS    + +WP ++ +G  L      N   P + +M
Sbjct  70    KEWEWHITIAKEGSFLNQNTNNQTGSMGTFTGVWP-NLYLGSYLEDCKVLNGQRPNNFLM  128

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y +LESG+FWFPAQVY       G ML  ++A +SYD  ++TF ARY   G   +   
Sbjct  129   SLYFSLESGRFWFPAQVYK------GLML--HNALVSYDSESNTFQARYQTGGWRCLG--  178

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
               + WD +R P VD+P + +H+SDCL +L+P DHIEIQWR N   PY WWY V+GHL++C
Sbjct  179   RNIEWDMVRVPSVDSPPYVMHVSDCLDNLKPEDHIEIQWRGNTHCPYDWWYAVIGHLDSC  238

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
             + N   C+CH  DT+++EF QY   S  RR  +SRK+  E+G+   G+YGGI+K+ + + 
Sbjct  239   NKNN--CQCHWSDTLIVEFRQYPEISSMRRIRLSRKNTGEQGDPRSGYYGGIRKLHNEDE  296

Query  1678  ISTWKRLWPAQV  1713
             I  WK+L+P+QV
Sbjct  297   IEKWKKLFPSQV  308



>ref|XP_004970296.1| PREDICTED: F-box protein At2g41170-like isoform X2 [Setaria italica]
Length=458

 Score =   273 bits (699),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 167/260 (64%), Gaps = 16/260 (6%)
 Frame = +1

Query  796   DLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQ  975
             DLP+L L+ +LE++ P  L  +A VC++LR RC +D LWERHL+ KWG ++G  A +EW+
Sbjct  88    DLPELALDRVLEELSPASLAAMACVCAALRGRCSADALWERHLRAKWGRVLGGTARKEWE  147

Query  976   WHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI---------  1125
               +  R   +     A+ +     L+  WP S I G  L  GD       +         
Sbjct  148   AELGARATRASAPRPARRRSWADSLACAWPFSWIAGRWL-KGDATPAPAAVAAEPAPATA  206

Query  1126  ----DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
                 D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPH
Sbjct  207   APPTDTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPH  266

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR     E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPYGWWYG
Sbjct  267   GRKPAKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGWWYG  326

Query  1474  VVGHLETCDGNQH-YCRCHE  1530
             VVGH  +C+ N+H +CRCHE
Sbjct  327   VVGHQASCNANEHLWCRCHE  346



>gb|EMT27387.1| hypothetical protein F775_17219 [Aegilops tauschii]
Length=181

 Score =   263 bits (672),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +1

Query  1198  ENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDL  1377
             E+GHVGF+LSCYDA L YD RTDTF ARYPPHGR     E GV W R+RA  +  PA DL
Sbjct  8     EDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRKPAKEEEGVQWCRVRAAPLSTPAQDL  67

Query  1378  HISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFN  1557
             H S CL DLRPGDH EIQWR+NK FPYGWWYGVVGHLE C+ N+H CRCHE DT++LEF 
Sbjct  68    HASGCLEDLRPGDHFEIQWRKNKDFPYGWWYGVVGHLEPCNANEHLCRCHEDDTIMLEFK  127

Query  1558  QYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWPAQVL  1716
              Y+ GSRWR+TTVSRKDHRE+G+E +GFYGGI+K+++++ ISTW+R WP  VL
Sbjct  128   HYAAGSRWRQTTVSRKDHREKGDETDGFYGGIRKLQTKDEISTWRRFWPVDVL  180



>gb|AAD11995.1| unknown protein [Arabidopsis thaliana]
Length=371

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 141/216 (65%), Gaps = 36/216 (17%)
 Frame = +1

Query  1114  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
             L PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  H
Sbjct  42    LAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQARYSAH  101

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  1473
             GR A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G
Sbjct  102   GRRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFG  159

Query  1474  VVGHLETCDGNQHYCRCHE---------------------------------CDTVVLEF  1554
             +VGHL+ CDG Q+ CRC                                    + VV+EF
Sbjct  160   IVGHLQNCDGVQN-CRCDSDGNNLISVFIFWSETVDSLIKENKMFNGILLAMAENVVMEF  218

Query  1555  NQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
              Q+ P S WRRT + RKDHRE GNE  GFYGGI ++
Sbjct  219   RQFRPESPWRRTVIKRKDHRETGNEENGFYGGISEL  254



>ref|XP_003520488.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Glycine max]
Length=321

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 192/329 (58%), Gaps = 15/329 (5%)
 Frame = +1

Query  721   MRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMS  900
             M S+    SK D   +  VS  S+LDLP+  L+CILE +PP+ LC +A VC+SLR+R  S
Sbjct  1     MSSEKNYASKLDKQKDCKVS--SLLDLPEWTLDCILECLPPQDLCRVAQVCTSLRDRIRS  58

Query  901   DHLWERHLKQKWGGIIGPAAYREWQWHIA-LRKDSRLFNQAKEKGLGSYLSRLWPLSVIV  1077
             D LWE+ +K KWG ++G  A++EWQ H   +   S L  Q  + G     S +WP  +I 
Sbjct  59    DALWEKKIKHKWGRLLGDVAHQEWQLHTTKINTQSFLLLQQNQSGSYGSFSGVWPF-LIF  117

Query  1078  GPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  1257
                L       +L    S M  Y++LESG FWFP QV+   N      L CYDA +SYD 
Sbjct  118   HSYLENFIDLISLFKNCSKMALYISLESGLFWFPVQVFKITN------LFCYDAIVSYDS  171

Query  1258  RTDTFHARYPPHG-RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQW  1434
             RTDTF +R P  G RM   IE  +  DRLR    +      ++S+ + DL+PGDHIEIQ 
Sbjct  172   RTDTFKSRSPTGGWRM---IEGNIQRDRLRLAPAETSPMTFYMSNSMNDLKPGDHIEIQI  228

Query  1435  RRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHR  1614
             RR K+ PY WWY V+GHLETC+ N ++C C   D++V+EF QY P +R RR  ++R  + 
Sbjct  229   RRRKESPYNWWYAVIGHLETCNQNVNHCHCQYSDSLVVEFKQYQPENRMRRAMLNRNVNV  288

Query  1615  EEGNEAE-GFYGGIQKVESREVISTWKRL  1698
             E+G+     ++GGI+K+   E I  W  L
Sbjct  289   EQGSTFRLRWFGGIRKLYKEEEIEKWNNL  317



>ref|XP_004970295.1| PREDICTED: F-box protein At2g41170-like isoform X1 [Setaria italica]
Length=500

 Score =   254 bits (649),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 167/302 (55%), Gaps = 58/302 (19%)
 Frame = +1

Query  796   DLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQ  975
             DLP+L L+ +LE++ P  L  +A VC++LR RC +D LWERHL+ KWG ++G  A +EW+
Sbjct  88    DLPELALDRVLEELSPASLAAMACVCAALRGRCSADALWERHLRAKWGRVLGGTARKEWE  147

Query  976   WHIALRKD-SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI---------  1125
               +  R   +     A+ +     L+  WP S I G  L  GD       +         
Sbjct  148   AELGARATRASAPRPARRRSWADSLACAWPFSWIAGRWL-KGDATPAPAAVAAEPAPATA  206

Query  1126  ----DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  1293
                 D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPH
Sbjct  207   APPTDTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPH  266

Query  1294  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY-----  1458
             GR     E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPY     
Sbjct  267   GRKPAKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGTYAR  326

Query  1459  -------------------------------------GWWYGVVGHLETCDGNQH-YCRC  1524
                                                  GWWYGVVGH  +C+ N+H +CRC
Sbjct  327   ITSPAFKPQYAAARHDSTISVGSSVADTMPFLRCVTTGWWYGVVGHQASCNANEHLWCRC  386

Query  1525  HE  1530
             HE
Sbjct  387   HE  388



>ref|XP_007162082.1| hypothetical protein PHAVU_001G122300g [Phaseolus vulgaris]
 gb|ESW34076.1| hypothetical protein PHAVU_001G122300g [Phaseolus vulgaris]
Length=325

 Score =   248 bits (633),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 194/319 (61%), Gaps = 17/319 (5%)
 Frame = +1

Query  757   DHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKW  936
             D++E   S +S+L  P+ +LECIL+ + P+ L  +  VC+ LR+RC SD LWE H+KQKW
Sbjct  2     DNIEPGGS-ISLLHFPEPILECILKLLSPKELVGMTEVCTCLRDRCRSDPLWEVHIKQKW  60

Query  937   GGIIGPAAYREWQWHIALRKD---SRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKR  1107
             GG+IG  A++EWQWHI   K+   ++L  Q  +KG     + +WP+ + +   +      
Sbjct  61    GGVIGDVAFKEWQWHITTTKEKQINQLDEQINQKGSLGSFNGIWPM-LYLRSYVEDCSHL  119

Query  1108  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  1287
             N+      +M  Y +LE+GKFWFPAQVY       G  +   DA + YD ++D F AR  
Sbjct  120   NSSLSNSFMMSLYFSLENGKFWFPAQVYR------GVFVR--DALVRYDSKSDNFQARQQ  171

Query  1288  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  1467
               G   +     + WD LRAP VD+PA   ++ DCL +L+PGDHIEIQ R  ++ PY W 
Sbjct  172   SGGWHIMG--NNIQWDNLRAPPVDSPACVRYVCDCLQELKPGDHIEIQRRFRRETPYDWC  229

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYG  1647
             Y V+GHLE+C+ N+++C CH  DT++LEF QYS GS  RR  + R    E+  EA   YG
Sbjct  230   YAVIGHLESCNENENFCSCHHSDTLILEFKQYSEGSSMRRIKLHRNG--EQYEEASRCYG  287

Query  1648  GIQKVESREVISTWKRLWP  1704
             GI+K++S E I  W++ +P
Sbjct  288   GIRKLQSEEEIQRWEKHFP  306



>ref|XP_007162085.1| hypothetical protein PHAVU_001G122600g [Phaseolus vulgaris]
 gb|ESW34079.1| hypothetical protein PHAVU_001G122600g [Phaseolus vulgaris]
Length=315

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 188/316 (59%), Gaps = 25/316 (8%)
 Frame = +1

Query  793   LDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREW  972
             ++LP+ +L+CIL  + P  L  ++ VC+ LR+RC SD LWE H+K+KWGG+IG  A++EW
Sbjct  1     MNLPEPMLDCILRLLSPMELVIMSEVCTCLRDRCRSDPLWEVHIKKKWGGVIGDVAFKEW  60

Query  973   QWHIALRKDSRLFN---QAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFW  1143
             QWHI   K+ ++ +   Q  +KG     S  WP+ + +   L      N+      +M  
Sbjct  61    QWHITTTKEKQINHSDKQINQKGSLGSFSGTWPV-LHLRSYLEDCSYLNSSLSNSFMMTL  119

Query  1144  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETG  1323
             Y +LE+GKFWFPAQVY       G ++   DA + YD +TD F AR    G  AV     
Sbjct  120   YFSLENGKFWFPAQVYR------GGLVR--DALVRYDSKTDNFQARQQNGGWQAVG--NN  169

Query  1324  VTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY---------GWWYGV  1476
             + W+ LRAP VD P    +ISDCL DL+PGDHIEIQW+  ++  Y         GWWY V
Sbjct  170   IQWEILRAPPVDTPPCVRYISDCLEDLKPGDHIEIQWKSRREISYESTKYLNDAGWWYAV  229

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGH+E+C+ NQ++C C   DT++LEF QY  GS  RR  + R   + E  EA G YGGI+
Sbjct  230   VGHMESCNENQNFCCCRYSDTLILEFKQYCEGSSMRRVKLVRNGEQYE--EASGCYGGIR  287

Query  1657  KVESREVISTWKRLWP  1704
             K++S E I  W++L P
Sbjct  288   KLQSEEEIQRWEKLLP  303



>gb|KDO54749.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=259

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 170/244 (70%), Gaps = 15/244 (6%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSLIPLRMLAMR-SKPGGCSKA  753
             LA K +P WA    L+LL    WK++S  ++    KN  ++  + + + + S     S +
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHMMSTS  78

Query  754   DDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             +DHVE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+H+K
Sbjct  79    NDHVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEKHMK  138

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEK---GLGSYL-SRLWPLSVIVGPNLGA  1095
             QKWG I+GPAAYREWQWH+A RKDS    Q K++    L S++ S  W  S +   +   
Sbjct  139   QKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTSKQT  198

Query  1096  GDKRNNLPPID--SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  1269
                R    P+D  S+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDT
Sbjct  199   TTTR---LPVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDT  255

Query  1270  FHAR  1281
             F AR
Sbjct  256   FQAR  259



>ref|XP_007145513.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
 gb|ESW17507.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
Length=322

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 182/312 (58%), Gaps = 15/312 (5%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S+LDLP   L+ IL+ + P  LC ++ VC  L+ +C SD+LWE H+K+KWG +IG   Y
Sbjct  11    ISLLDLPKSTLDFILKYLSPIDLCTMSMVCVFLKGKCQSDNLWENHIKEKWGRVIGDVVY  70

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +EW+WHI + KD       +    GS    S +WP ++ +G  L      N     + +M
Sbjct  71    KEWEWHIGMAKDGVFLKNEQNNQSGSMGSFSGVWP-NLYLGSYLEDCKVLNGQQSNNFMM  129

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y +LESG FWFPAQVY          L  +DA ++YD +++TF ARY   G   +   
Sbjct  130   SLYFSLESGSFWFPAQVYKG--------LVIHDALVNYDSQSNTFQARYQNGGWSCLG--  179

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
               + WD +RAPLVD P + +H+S    +L+P DHIEIQWR N + PY WWY ++GHL++C
Sbjct  180   RNIEWDMVRAPLVDTPPYLVHLSHFSDNLKPDDHIEIQWRSNTECPYEWWYAIIGHLDSC  239

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
               N   C+C   D+ ++EF QY   S  RR    RK ++EE +   G+YGGI K+E+   
Sbjct  240   --NHKSCQCQYNDSFIVEFRQYPEVSNLRRIKFFRKTNKEEDDPTGGYYGGIIKLENEHQ  297

Query  1678  ISTWKRLWPAQV  1713
             I  WK+L+  Q+
Sbjct  298   IQIWKKLFQLQM  309



>ref|XP_003520491.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=308

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/314 (43%), Positives = 189/314 (60%), Gaps = 22/314 (7%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MS+L+LP+ +L+CIL+ + P  L  ++ VC+ LR+RC SD LWE H+K+KWGG+IG  AY
Sbjct  1     MSLLNLPEPILDCILKLLSPMELVSMSEVCTCLRDRCRSDPLWEVHIKKKWGGVIGDVAY  60

Query  964   REWQWHIALRKDSRLFNQAKEK------GLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPI  1125
             +EW WHI   K+  + NQ  ++       LG + S  WP+ + +   L      N     
Sbjct  61    KEWHWHITTTKEKGI-NQLHQQHNIQNGSLGPF-SGTWPM-LYLRSYLEDCSHLNTSLAN  117

Query  1126  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  1305
               +M  Y +LE+GKFWFPAQ+Y       G ++   DA + YD +TD F AR    G   
Sbjct  118   SFMMALYFSLENGKFWFPAQIYR------GLLVR--DALVRYDSKTDKFQARQQNGGWQV  169

Query  1306  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR-RNKKFPYGWWYGVVG  1482
             +     + WD LRAP VD P  +LH+SDCL DL+P DHIEIQ + R +  PY WWY V+G
Sbjct  170   MG--NNIQWDILRAPPVDTPPWNLHVSDCLQDLKPEDHIEIQRKPRRESTPYDWWYAVIG  227

Query  1483  HLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKV  1662
             H+E+C+ NQ++CRC   +T+++EF QYS GS  RR  + R    E+  E    YGGI+K+
Sbjct  228   HMESCNENQNFCRCRYSETLIVEFKQYSHGSSMRRVKLPRNG--EQFEEPTRCYGGIRKL  285

Query  1663  ESREVISTWKRLWP  1704
              S E I  W++L P
Sbjct  286   HSDEEIQRWEKLLP  299



>ref|XP_003624987.1| F-box protein [Medicago truncatula]
 gb|ABD33047.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES81205.1| F-box plant-like protein [Medicago truncatula]
Length=314

 Score =   244 bits (624),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/318 (41%), Positives = 187/318 (59%), Gaps = 18/318 (6%)
 Frame = +1

Query  763   VETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGG  942
             +  +VS +S+L+ P+ +L+ ILE++ P  L  ++ VC  LR +C SDH WE H+KQKWG 
Sbjct  4     IANSVS-ISLLNFPESILDGILERLSPIELIKMSEVCICLRNKCRSDHFWEIHMKQKWGR  62

Query  943   IIGPAAYREWQWHIA--LRKDSRLFNQA----KEKGLGSYLSRLWPLSVIVGPNLGAGDK  1104
             +IG  A +EWQWH+     ++  + NQ     +   LGS+ S  WP+  +          
Sbjct  63    VIGHVALKEWQWHVTSITAEEGSVLNQQINNIQNGSLGSF-SGAWPMLCLGSYFEECTHL  121

Query  1105  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  1284
             ++ L   +  M  YL+LESGKFWFPAQ++          L  ++A LSYD +TDTF AR 
Sbjct  122   KSLLLSNNFKMALYLSLESGKFWFPAQLFRG--------LYVHEALLSYDSKTDTFQART  173

Query  1285  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  1464
                    V     + WD+LR  LV+  +   H+SDC  DL+ GDHIEIQWR N + PY W
Sbjct  174   RSGNWRIVG--NKIHWDKLRPSLVETSSCVRHVSDCYQDLKLGDHIEIQWRGNTQTPYDW  231

Query  1465  WYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFY  1644
             WY V+GHL++C+ N++YC C   +T+V+EF QY  GS  R+T + R ++ E+   + G Y
Sbjct  232   WYAVIGHLDSCNENENYCFCQNSETLVVEFKQYPRGSSMRKTMLRRHNNGEQAENSIGNY  291

Query  1645  GGIQKVESREVISTWKRL  1698
             GGI+K+   E I  WK L
Sbjct  292   GGIRKLRDEEEIEKWKEL  309



>ref|XP_003520490.1| PREDICTED: F-box protein At2g32560-like [Glycine max]
 gb|KHN30353.1| F-box protein [Glycine soja]
Length=307

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 182/309 (59%), Gaps = 17/309 (6%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             MS+L+LP  +L+CIL+ + P  L  ++ VC+ LR+RC SD LWE H+KQKWGG+IG  AY
Sbjct  1     MSLLNLPYPILDCILKLLSPMDLTRMSEVCTFLRDRCRSDPLWELHMKQKWGGVIGDVAY  60

Query  964   REWQWHIALRKDSRLFNQAKEK---GLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSV  1134
             +EW WHI   K+  +    +     G     S  WP+ + +   L      N+    +S 
Sbjct  61    KEWLWHITTPKEKGINQLNQHNNQNGSMGPFSGTWPM-LYLRSYLEDCSYLNSSSLANSF  119

Query  1135  MF-WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  1311
             M   Y +LE+G FWFPAQ+Y          L   DA + YD +TD F AR    G   + 
Sbjct  120   MMALYFSLENGNFWFPAQIYRG--------LYFRDALVRYDSKTDNFQARQQNAGWKIMG  171

Query  1312  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  1491
                 + WD+LRAP VD      ++SDCL DL+PGDHIE+QW+ ++  PY WWY V+GH+E
Sbjct  172   --NNIQWDKLRAPPVDTLPSVRYVSDCLQDLKPGDHIELQWKSSRDIPYDWWYAVIGHME  229

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +C+ N+++CRC   +T+++EF QY  GSR RR  + +   + E  E+ G YGGI+K+ S 
Sbjct  230   SCNENENFCRCRYSETLIVEFEQYPLGSRMRRVKLLKNGDQCE--ESTGCYGGIRKLYSE  287

Query  1672  EVISTWKRL  1698
             E I  W+ +
Sbjct  288   EEIQRWENI  296



>ref|XP_010508751.1| PREDICTED: F-box protein At2g41170-like isoform X2 [Camelina 
sativa]
Length=325

 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 172/255 (67%), Gaps = 16/255 (6%)
 Frame = +1

Query  706   LRMLAMRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLR  885
             LR L  R++       +D      ++MS+LDLPDL L+CILEK+ P  LC +A VCS LR
Sbjct  38    LRTLLRRTEAKRNKNQEDE-----NKMSLLDLPDLTLDCILEKLSPSELCAMACVCSELR  92

Query  886   ERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIA-LRKDSRLFNQAKEKG--LGSYLSRL  1056
             ++C+ DHLW++H++ KWG ++G AA +EW+ H+A L +  R  NQ+  K      +++ L
Sbjct  93    DKCVIDHLWQKHMEAKWGRLMGDAATQEWKSHVATLMRCLRSSNQSSSKPNWRSRFVASL  152

Query  1057  WPLSVIVGPNLGAGDKRNNL----PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFML  1224
              P S +   N G  DKR +L     PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+
Sbjct  153   KPFSWL-SSNHGC-DKRGSLSSYFAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMM  210

Query  1225  SCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDL  1404
             SCYDA++ YD +TDTF A+Y  HGR A   E  VTW RLR   VD  + DLH+SDCL  L
Sbjct  211   SCYDAKIRYDFKTDTFQAKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRDLHVSDCLDGL  268

Query  1405  RPGDHIEIQWRRNKK  1449
             RPGDH EIQWR+ K+
Sbjct  269   RPGDHFEIQWRKTKE  283



>ref|XP_007162081.1| hypothetical protein PHAVU_001G122200g [Phaseolus vulgaris]
 gb|ESW34075.1| hypothetical protein PHAVU_001G122200g [Phaseolus vulgaris]
Length=321

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/327 (41%), Positives = 183/327 (56%), Gaps = 11/327 (3%)
 Frame = +1

Query  721   MRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMS  900
             M S+    SK +   +  V   S+LDLP+  L+CILE + P  L  +A VC+ LR++  S
Sbjct  1     MSSEKNCVSKLEKQKDCKV--YSLLDLPEWTLDCILECLSPLDLFRVAQVCNCLRDKTRS  58

Query  901   DHLWERHLKQKWGGIIGPAAYREWQWHIA-LRKDSRLFNQAKEKGLGSYLSRLWPLSVIV  1077
             D LWE+ +KQKWG ++G  AY+EW WH   +   S L  Q  + GL    S +WP S+  
Sbjct  59    DALWEKLIKQKWGRLVGDVAYQEWLWHTTKINTQSLLLLQHNQSGLCGSFSGVWP-SLSF  117

Query  1078  GPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  1257
                L       +L    S M  Y+ LESG+FWFP QVY   N +    L C DA +SYD 
Sbjct  118   HSYLENFIDLISLFKNCSKMALYICLESGRFWFPLQVYKNGNQN----LFCCDAIVSYDC  173

Query  1258  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  1437
             RT+TF AR P  G     IE  V W+RLR   V+      ++S+ + DL+PGD IEIQ R
Sbjct  174   RTNTFQARSPRGGWQM--IEGNVPWNRLRISPVETSTRAFYMSNSMNDLKPGDQIEIQIR  231

Query  1438  RNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHRE  1617
             R K   Y WWY V+GHLE C+ +   C C   + +V+EF Q+   SRWRR+ ++R  H E
Sbjct  232   RRKDSHYNWWYAVIGHLEACEEDVSQCHCQHNEMLVVEFKQFQSQSRWRRSVLNRNMHEE  291

Query  1618  EGNEAEGFYGGIQKVESREVISTWKRL  1698
             +G+    F GGI+K+++ E I  W   
Sbjct  292   QGSRTRWF-GGIRKLDNVEEIKRWNNF  317



>ref|XP_003624981.1| F-box protein [Medicago truncatula]
 gb|ABD33041.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES81199.1| F-box plant-like protein [Medicago truncatula]
Length=318

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 183/307 (60%), Gaps = 27/307 (9%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LDLP+  L+CILE + P  LC +A VCS LR R  +D+LWE+ + Q+WG ++G  A
Sbjct  13    KVSLLDLPEWALDCILEYLSPLDLCKVAQVCSCLRNRSKNDYLWEKQVNQRWGELLGDIA  72

Query  961   YREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSV  1134
             Y EWQWH A  + ++  L +Q +    G++          V P+L       N   + S+
Sbjct  73    YHEWQWHTAKMVNEEILLLHQNQSGSCGTFTG--------VWPSLHLHSYLENFRDMISL  124

Query  1135  ------MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  1296
                   M  ++ALE+G+FWFPAQVY +        LSCYDA +SYD R DTF AR P +G
Sbjct  125   LRNCPKMSLFIALETGQFWFPAQVYKK-------ALSCYDALISYDSRNDTFKARSPSNG  177

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
                  I   V WD LR P       D +  + + +L+PGD++E+Q RR K++PY WW+ +
Sbjct  178   ---WRIRGDVEWDMLRIPPPQTFLSDYYKPNYINNLKPGDYVEVQKRRRKEYPYDWWFAI  234

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             +GHLE+CD + ++C C   +T+V+E   Y+ GSRWRR+ + R  + E+G+    ++GGI+
Sbjct  235   IGHLESCDEDMNHCHCQYSETLVVELILYALGSRWRRSMLHRNLYEEQGSRI-CWFGGIR  293

Query  1657  KVESREV  1677
             K+   E+
Sbjct  294   KLNEEEI  300



>gb|KHN32241.1| F-box protein [Glycine soja]
Length=297

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 178/327 (54%), Gaps = 47/327 (14%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S+LDLP+  L+ IL+   P  LC ++ VC SL+++C SDH WE H+K KWG +IG A Y
Sbjct  6     VSLLDLPEPTLDLILKCFSPNELCTVSEVCVSLKDKCQSDHFWEHHIKHKWGRVIGDAVY  65

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +EW+WHI + K+    NQ      GS    + +WP ++ +G  L      N   P + +M
Sbjct  66    KEWEWHITIAKEGSFLNQNTNNQTGSMGTFTGVWP-NLYLGSYLEDCKVLNGQRPNNFLM  124

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y +LESG                                      RY   G   +   
Sbjct  125   SLYFSLESG--------------------------------------RYQTGGWRCLG--  144

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
               + WD +R P VD+P + +H+SDCL +L+P DHIEIQWR N   PY WWY V+GHL++C
Sbjct  145   RNIEWDMVRVPSVDSPPYVMHVSDCLDNLKPEDHIEIQWRGNTHCPYDWWYAVIGHLDSC  204

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
             + N   C+CH  DT+++EF QY   S  RR  +SRK+  E+G+   G+YGGI+K+ + + 
Sbjct  205   NKNN--CQCHWSDTLIVEFRQYPEISSMRRIRLSRKNTGEQGDPRSGYYGGIRKLHNEDE  262

Query  1678  ISTWKRLWPAQVLE*IARTGTLEIAVF  1758
             I  WK+L+P+QV   +  T TL + + 
Sbjct  263   IEKWKKLFPSQVQ--VHATWTLLVTIL  287



>gb|AFK35889.1| unknown [Lotus japonicus]
Length=317

 Score =   220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 179/314 (57%), Gaps = 24/314 (8%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LDLP  +L+ ILE +PP  L  +A VC+ LR R  SD+L ++ +KQKW  +IG  A
Sbjct  18    RISLLDLPGCILDVILELLPPSDLYRVAQVCTYLRNRSRSDNLRDKQVKQKWSNLIGDVA  77

Query  961   YREWQWHIA-LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSV-  1134
              +EWQWH   +   S L  Q + +G     S +WP       +L       N   I S+ 
Sbjct  78    LQEWQWHTTKINTQSILLLQNQSRGSCGSFSGVWP-------SLSLNSYLKNFGDITSLF  130

Query  1135  -----MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG-  1296
                  M  ++ LESG+FWFPAQ Y +        L  YD  +SY+  TDTF AR P +  
Sbjct  131   QNCPKMALFVCLESGRFWFPAQAYLKR-----MPLYFYDVIVSYNSETDTFRARSPNNEW  185

Query  1297  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  1476
             RM   I   + WDRLR+   +N +   ++S+   DL+PGDHIEIQ R+ ++ PY WWY +
Sbjct  186   RM---IGRNIEWDRLRSSPAENFSRKFYMSN-KNDLKPGDHIEIQRRKRRECPYDWWYAI  241

Query  1477  VGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQ  1656
             VGHLE+CD N ++C C + D +V+EF QY     WR+T ++R  + ++ +    + GGI+
Sbjct  242   VGHLESCDENVNHCSCQQSDMLVVEFMQYQHWIGWRKTVLNRNVYEDQADSRLSWLGGIR  301

Query  1657  KVESREVISTWKRL  1698
             K++  E I  WK L
Sbjct  302   KLDKEEEIERWKSL  315



>ref|XP_004499916.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Cicer arietinum]
 ref|XP_004499917.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Cicer arietinum]
Length=337

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 177/319 (55%), Gaps = 24/319 (8%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LD+PD++L+CIL+++PP  L  ++ VC+ LR    SD LWE H++ KW  ++G  A
Sbjct  18    KVSLLDIPDVILDCILKRLPPLDLFRVSQVCTYLRNIGRSDDLWETHIEHKWSKLVGNDA  77

Query  961   YREWQWHIA--LRKDSRLFNQAKEKGLGSYLSRLWPLSVIVGPN--------LGAGDKRN  1110
             + EWQWH    + + S +F    ++ L    S       I G +        L +    N
Sbjct  78    HHEWQWHTTKIINEGSIIFLPENKENLLLQQSLSGSCGTISGDSPFLRLHSYLKSYKGLN  137

Query  1111  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  1290
              L    S M  Y+ LE+G+F FPAQVY        F L CYDA + YD +TDTF AR P 
Sbjct  138   GLIRNYSKMALYICLETGRFCFPAQVYKA----TRFTLYCYDALVCYDSKTDTFRARSPN  193

Query  1291  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG-WW  1467
              GR    IE  + WDRLR P  +    D + S+CL DL+PGDHIEIQ RR +  PY  WW
Sbjct  194   GGRH--MIEKDIHWDRLRKPPHNTFLVDFYHSNCLNDLKPGDHIEIQKRRRRALPYCEWW  251

Query  1468  YGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWR--RTTVSRKDHREEGNEAEGF  1641
             Y VV HL +CD + ++C C   DT+VLEFNQYS    +   R+ ++ K + E    A   
Sbjct  252   YAVVCHLGSCDKDINHCSCRNSDTLVLEFNQYSHTVTYSLTRSAINSKVYVELTCLA---  308

Query  1642  YGGIQKVESREVISTWKRL  1698
               GI+K+   E I  WK L
Sbjct  309   --GIRKLTDDEEIIKWKNL  325



>ref|XP_007145514.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
 gb|ESW17508.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
Length=299

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 167/312 (54%), Gaps = 38/312 (12%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S+LDLP   L+ IL+ + P  LC ++ VC  L+ +C SD+LWE H+K+KWG +IG   Y
Sbjct  11    ISLLDLPKSTLDFILKYLSPIDLCTMSMVCVFLKGKCQSDNLWENHIKEKWGRVIGDVVY  70

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +EW+WHI + KD       +    GS    S +WP ++ +G  L      N     + +M
Sbjct  71    KEWEWHIGMAKDGVFLKNEQNNQSGSMGSFSGVWP-NLYLGSYLEDCKVLNGQQSNNFMM  129

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y +LESG FWFPAQVY          L  +DA ++YD +++TF ARY   G   +   
Sbjct  130   SLYFSLESGSFWFPAQVYKG--------LVIHDALVNYDSQSNTFQARYQNGGWSCLG--  179

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
               + WD +RAPLVD P + +H+S    +L+P DHIEIQWR N + PY             
Sbjct  180   RNIEWDMVRAPLVDTPPYLVHLSHFSDNLKPDDHIEIQWRSNTECPY-------------  226

Query  1498  DGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREV  1677
                         D+ ++EF QY   S  RR    RK ++EE +   G+YGGI K+E+   
Sbjct  227   ------------DSFIVEFRQYPEVSNLRRIKFFRKTNKEEDDPTGGYYGGIIKLENEHQ  274

Query  1678  ISTWKRLWPAQV  1713
             I  WK+L+  Q+
Sbjct  275   IQIWKKLFQLQM  286



>ref|XP_007145512.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
 gb|ESW17506.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
Length=271

 Score =   200 bits (509),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/259 (40%), Positives = 149/259 (58%), Gaps = 15/259 (6%)
 Frame = +1

Query  784   MSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAY  963
             +S+LDLP   L+ IL+ + P  LC ++ VC  L+ +C SD+LWE H+K+KWG +IG   Y
Sbjct  11    ISLLDLPKSTLDFILKYLSPIDLCTMSMVCVFLKGKCQSDNLWENHIKEKWGRVIGDVVY  70

Query  964   REWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             +EW+WHI + KD       +    GS    S +WP ++ +G  L      N     + +M
Sbjct  71    KEWEWHIGMAKDGVFLKNEQNNQSGSMGSFSGVWP-NLYLGSYLEDCKVLNGQQSNNFMM  129

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y +LESG FWFPAQVY          L  +DA ++YD +++TF ARY   G   +   
Sbjct  130   SLYFSLESGSFWFPAQVYKG--------LVIHDALVNYDSQSNTFQARYQNGGWSCLG--  179

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  1497
               + WD +RAPLVD P + +H+S    +L+P DHIEIQWR N + PY WWY ++GHL++C
Sbjct  180   RNIEWDMVRAPLVDTPPYLVHLSHFSDNLKPDDHIEIQWRSNTECPYEWWYAIIGHLDSC  239

Query  1498  DGNQHYCRCHECDTVVLEF  1554
               N   C+C   D   L +
Sbjct  240   --NHKSCQCQYNDDTCLIY  256



>gb|KHN30352.1| F-box protein [Glycine soja]
Length=296

 Score =   200 bits (509),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 128/330 (39%), Positives = 179/330 (54%), Gaps = 42/330 (13%)
 Frame = +1

Query  721   MRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMS  900
             M S+    SK D   +  VS  S+LDLP+  L+CILE +PP+ LC +A VC+SLR+R  S
Sbjct  1     MSSEKNYTSKLDKQKDCKVS--SLLDLPEWTLDCILECLPPQDLCRVAQVCTSLRDRIRS  58

Query  901   DHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEKGLGSY--LSRLWPLSVI  1074
             D LWE+ +K KWG ++G  A++EWQ H   + +++ F   K+   GSY   S +WP  +I
Sbjct  59    DALWEKKIKHKWGRLLGDVAHQEWQLHTT-KINTQSFLLLKQNQSGSYGSFSGVWPF-LI  116

Query  1075  VGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD  1254
                 L       +L    S M  Y++LESG FWFP QV+   N      L CYDA +SYD
Sbjct  117   FHSYLENFIDLISLFKNCSKMALYISLESGLFWFPVQVFKITN------LFCYDAIVSYD  170

Query  1255  PRTDTFHARYPPHG-RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQ  1431
              RTDTF +R P  G RM   IE  +  DRLR    +      ++S+ + DL+PGDHIEIQ
Sbjct  171   SRTDTFKSRSPTGGWRM---IEGNIQRDRLRLAPAETSPMTFYMSNSMNDLKPGDHIEIQ  227

Query  1432  WRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDH  1611
              RR K+ PY                         +++V+EF QY P +R RR  ++R  +
Sbjct  228   IRRRKESPY-------------------------NSLVVEFKQYQPENRMRRAMLNRNVN  262

Query  1612  REEGNEAE-GFYGGIQKVESREVISTWKRL  1698
              E+G+     ++GGI+K+   E I  W  L
Sbjct  263   VEQGSTFRLRWFGGIRKLYKEEEIEKWNNL  292



>gb|EYU18616.1| hypothetical protein MIMGU_mgv1a0077792mg, partial [Erythranthe 
guttata]
Length=144

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +1

Query  1282  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  1461
             Y   GR    IE G+ WDR+RAP V+ P + LHISDCL  ++PGDHIEIQWR+NK+FP+G
Sbjct  1     YRAQGRSM--IEEGIEWDRIRAPSVNTPPNSLHISDCLDQIKPGDHIEIQWRKNKEFPFG  58

Query  1462  WWYGVVGHLETCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGF  1641
             WWYGVV HLE+C+GN+  C+CH  D V LEF QYS  SRWRRT +SRKDH   GNE +GF
Sbjct  59    WWYGVVEHLESCNGNEFNCQCHITDAVSLEFKQYSRASRWRRTVISRKDHTVIGNEIDGF  118

Query  1642  YGGIQKVESREVISTWKRLWPAQVLE  1719
             YGGI+K+ +++ I+ WK+LWP   LE
Sbjct  119   YGGIRKLCNKQEIAKWKQLWPNCTLE  144



>gb|KDO54748.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=298

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 152/234 (65%), Gaps = 15/234 (6%)
 Frame = +1

Query  586   LAFKLVPTWASEFRLQLL-FRLWKDLSLLTLVR--KNLFSLIPLRMLAMR-SKPGGCSKA  753
             LA K +P WA    L+LL    WK++S  ++    KN  ++  + + + + S     S +
Sbjct  19    LALKPLPPWARPTELRLLSLCFWKEISFFSIPSSLKNSLNITTIIIPSPKLSFKHMMSTS  78

Query  754   DDHVETTV--SQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLK  927
             +DHVE     ++MSVLDLP+LVLECILEK+PP GLC++A+VCSSLR+RCMSDHLWE+H+K
Sbjct  79    NDHVEEVSGGAEMSVLDLPELVLECILEKLPPSGLCNMAAVCSSLRDRCMSDHLWEKHMK  138

Query  928   QKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEK---GLGSYL-SRLWPLSVIVGPNLGA  1095
             QKWG I+GPAAYREWQWH+A RKDS    Q K++    L S++ S  W  S +   +   
Sbjct  139   QKWGRIVGPAAYREWQWHLASRKDSTHLKQGKQRLWMKLFSFVRSFSWVRSKVHDTSKQT  198

Query  1096  GDKRNNLPPID--SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  1251
                R    P+D  S+M WYLALE+G+FWFPAQVYNRE      M +    +LS+
Sbjct  199   TTTRL---PVDSNSIMSWYLALETGRFWFPAQVYNREVYTYTLMHAKTSIQLSF  249



>gb|ABD33044.1| Cyclin-like F-box [Medicago truncatula]
Length=330

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 167/301 (55%), Gaps = 15/301 (5%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LDLPD +++CIL+ + P+ L  +A VC+ LR     DHLWE+H++QKW  ++G  A
Sbjct  25    KVSLLDLPDELVDCILKCLSPQDLFRVAQVCTHLRNISRRDHLWEKHVEQKWSRLLGNDA  84

Query  961   YREWQWHIALRKDSRL-FNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             Y EW++H    K+  +  N +   G  S  S    +   +  N    D   N     S M
Sbjct  85    YHEWEYHTTKYKELLVDRNLSDSLGTTSGNSSFQRIHSYLRINRSMTDLIKN----HSKM  140

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y+ LE+G+FWFPAQVY          L CYDA +SYD RTDTF  R  P+GR  + IE
Sbjct  141   ALYIFLETGRFWFPAQVYKA----TLLTLHCYDAIVSYDSRTDTFQTR-CPYGRKRL-IE  194

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGHLET  1494
               ++WD LR P       D +  + L +L+PGDHIEIQ R  + FP Y W + VV HLE+
Sbjct  195   RDISWDMLRMPPPKTYLVDYYEYNDLNNLKPGDHIEIQKRGRRLFPIYDWAHAVVCHLES  254

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CD + ++C C + D +V+ F++ +    +   ++S+     E      F  GI+K++  E
Sbjct  255   CDQDVNHCSCKDSDILVMGFSRCNFHLEY---SLSKSTKHAEAYREFNFLNGIRKLDEEE  311

Query  1675  V  1677
             +
Sbjct  312   I  312



>gb|AES81202.2| F-box plant-like protein [Medicago truncatula]
Length=324

 Score =   188 bits (477),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 167/301 (55%), Gaps = 15/301 (5%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LDLPD +++CIL+ + P+ L  +A VC+ LR     DHLWE+H++QKW  ++G  A
Sbjct  19    KVSLLDLPDELVDCILKCLSPQDLFRVAQVCTHLRNISRRDHLWEKHVEQKWSRLLGNDA  78

Query  961   YREWQWHIALRKDSRL-FNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             Y EW++H    K+  +  N +   G  S  S    +   +  N    D   N     S M
Sbjct  79    YHEWEYHTTKYKELLVDRNLSDSLGTTSGNSSFQRIHSYLRINRSMTDLIKN----HSKM  134

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y+ LE+G+FWFPAQVY          L CYDA +SYD RTDTF  R  P+GR  + IE
Sbjct  135   ALYIFLETGRFWFPAQVYKA----TLLTLHCYDAIVSYDSRTDTFQTR-CPYGRKRL-IE  188

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGHLET  1494
               ++WD LR P       D +  + L +L+PGDHIEIQ R  + FP Y W + VV HLE+
Sbjct  189   RDISWDMLRMPPPKTYLVDYYEYNDLNNLKPGDHIEIQKRGRRLFPIYDWAHAVVCHLES  248

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CD + ++C C + D +V+ F++ +    +   ++S+     E      F  GI+K++  E
Sbjct  249   CDQDVNHCSCKDSDILVMGFSRCNFHLEY---SLSKSTKHAEAYREFNFLNGIRKLDEEE  305

Query  1675  V  1677
             +
Sbjct  306   I  306



>ref|XP_003624984.1| F-box protein [Medicago truncatula]
Length=353

 Score =   188 bits (477),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 167/301 (55%), Gaps = 15/301 (5%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LDLPD +++CIL+ + P+ L  +A VC+ LR     DHLWE+H++QKW  ++G  A
Sbjct  48    KVSLLDLPDELVDCILKCLSPQDLFRVAQVCTHLRNISRRDHLWEKHVEQKWSRLLGNDA  107

Query  961   YREWQWHIALRKDSRL-FNQAKEKGLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVM  1137
             Y EW++H    K+  +  N +   G  S  S    +   +  N    D   N     S M
Sbjct  108   YHEWEYHTTKYKELLVDRNLSDSLGTTSGNSSFQRIHSYLRINRSMTDLIKN----HSKM  163

Query  1138  FWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  1317
               Y+ LE+G+FWFPAQVY          L CYDA +SYD RTDTF  R  P+GR  + IE
Sbjct  164   ALYIFLETGRFWFPAQVYKA----TLLTLHCYDAIVSYDSRTDTFQTR-CPYGRKRL-IE  217

Query  1318  TGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGHLET  1494
               ++WD LR P       D +  + L +L+PGDHIEIQ R  + FP Y W + VV HLE+
Sbjct  218   RDISWDMLRMPPPKTYLVDYYEYNDLNNLKPGDHIEIQKRGRRLFPIYDWAHAVVCHLES  277

Query  1495  CDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESRE  1674
             CD + ++C C + D +V+ F++ +    +   ++S+     E      F  GI+K++  E
Sbjct  278   CDQDVNHCSCKDSDILVMGFSRCNFHLEY---SLSKSTKHAEAYREFNFLNGIRKLDEEE  334

Query  1675  V  1677
             +
Sbjct  335   I  335



>ref|XP_003624986.1| F-box protein [Medicago truncatula]
 gb|ABD33046.2| Cyclin-like F-box [Medicago truncatula]
 gb|AES81204.1| F-box plant-like protein [Medicago truncatula]
Length=323

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/302 (37%), Positives = 167/302 (55%), Gaps = 17/302 (6%)
 Frame = +1

Query  781   QMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAA  960
             ++S+LDLPD +++CIL+ + P+ L  +A VC+ LR     DHLWE+H++QKW  ++G  A
Sbjct  18    KVSLLDLPDELVDCILKFLSPQDLFRVAQVCTHLRNISRRDHLWEKHVEQKWSRLLGNDA  77

Query  961   YREWQWHIALRKDSRLFNQAKEKGLGSYL--SRLWPLSVIVGPNLGAGDKRNNLPPIDSV  1134
             Y EW++H    K+  L +Q     LG+    S    +   +  N    D   N     S 
Sbjct  78    YHEWEYHTTKYKE-LLVDQNLSDSLGTTSGNSSFQRIHSYLRINRSMTDLIKN----HSK  132

Query  1135  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  1314
             M  Y+ LE+G+FWFPAQVY          L CYDA ++YD +T+TF  R  PHGR  V I
Sbjct  133   MALYIFLETGRFWFPAQVYKA----TLLTLYCYDAIVTYDSKTNTFQTR-TPHGRRRV-I  186

Query  1315  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGHLE  1491
             E  + W+ LR P       D +  + L +L+PGD+IEIQ R  K FP Y W + VV HLE
Sbjct  187   ERDIPWNMLRMPPPKTYLVDYYEYNDLNNLKPGDYIEIQTRGRKAFPLYDWAHAVVCHLE  246

Query  1492  TCDGNQHYCRCHECDTVVLEFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESR  1671
             +CD + ++C C + D +V+ F   S  + ++  ++S+     +      F  GI+K+  +
Sbjct  247   SCDQDVNHCSCKDNDILVMGF---SRCNFYKEYSLSKSMKHAQAYVEFNFLNGIRKLNEQ  303

Query  1672  EV  1677
             E+
Sbjct  304   EI  305



>gb|KHN30354.1| F-box protein [Glycine soja]
Length=263

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 153/292 (52%), Gaps = 47/292 (16%)
 Frame = +1

Query  850   LCHLASVCSSLRERCMSDHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSRLFNQAKEK  1029
             L  ++ VC+ LR+RC SD LWE H+K+KWGG+IG  AY+EW WHI   K+  + NQ  ++
Sbjct  3     LVSMSEVCTCLRDRCRSDPLWEVHIKKKWGGVIGDVAYKEWHWHITTTKEKGI-NQLHQQ  61

Query  1030  ------GLGSYLSRLWPLSVIVGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVY  1191
                    LG + S  WP+ + +   L      N       +M  Y +LE+GKFWFPAQ+Y
Sbjct  62    HNIQNGSLGPF-SGTWPM-LYLRSYLEDCSHLNTSLANSFMMALYFSLENGKFWFPAQIY  119

Query  1192  NRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAH  1371
                    G ++   DA + YD +TD F AR    G   +     + WD LRAP VD P  
Sbjct  120   R------GLLVR--DALVRYDSKTDKFQARQQNGGWQVMG--NNIQWDILRAPPVDTPPW  169

Query  1372  DLHISDCLYDLRPGDHIEIQ-WRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHECDTVVL  1548
             +LH+SDCL DL+P DHIEIQ  RR +  PY                         +T+++
Sbjct  170   NLHVSDCLQDLKPEDHIEIQRKRRRESTPY-------------------------ETLIV  204

Query  1549  EFNQYSPGSRWRRTTVSRKDHREEGNEAEGFYGGIQKVESREVISTWKRLWP  1704
             EF QYS GS  RR  + R    E+  E    YGGI+K+ S E I  W++L P
Sbjct  205   EFKQYSHGSSMRRVKLPRNG--EQFEEPTRCYGGIRKLHSDEEIQRWEKLLP  254



>ref|XP_007162079.1| hypothetical protein PHAVU_001G122000g [Phaseolus vulgaris]
 gb|ESW34073.1| hypothetical protein PHAVU_001G122000g [Phaseolus vulgaris]
Length=238

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 142/249 (57%), Gaps = 15/249 (6%)
 Frame = +1

Query  721   MRSKPGGCSKADDHVETTVSQMSVLDLPDLVLECILEKVPPEGLCHLASVCSSLRERCMS  900
             M S+    SK +   +  V   S+LDLP+  ++CILE + P  L  +A VC++LR++  +
Sbjct  1     MSSEKNCVSKLEKQKDCKV--YSLLDLPEWTMDCILECLSPMDLFRVAQVCTNLRDKTRN  58

Query  901   DHLWERHLKQKWGGIIGPAAYREWQWHIALRKDSR-LFN-QAKEKGLGSYLSRLWPLSVI  1074
             D LWE+ +KQKWG ++G AAY EWQWH     +++ +F+ Q  + G     S +WP  + 
Sbjct  59    DALWEKLIKQKWGRLLGDAAYHEWQWHTTKFANTQSIFSLQQNQTGSCGSFSGVWPF-LN  117

Query  1075  VGPNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD  1254
                 L        L    S M  Y+ LESG+FWFP Q+Y   N      L CYDA +SYD
Sbjct  118   FHSYLENFTDLITLFKNCSKMALYICLESGRFWFPVQLYKAAN------LLCYDAIVSYD  171

Query  1255  PRTDTFHARYPPHG-RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQ  1431
              + DTF AR    G R+    E  + WDRLR+  V+    ++H+S+C+ DL+PGD IEIQ
Sbjct  172   SKRDTFKARCQTGGWRLT---EENIQWDRLRSSPVETSPREVHMSNCMNDLKPGDQIEIQ  228

Query  1432  WRRNKKFPY  1458
              ++ K+ PY
Sbjct  229   LKKRKESPY  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6585060780894