BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5133

Length=896
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761575.1|  PREDICTED: uncharacterized protein LOC104213728    191   2e-64   Nicotiana sylvestris
gb|EYU25397.1|  hypothetical protein MIMGU_mgv1a000678mg                191   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_009629701.1|  PREDICTED: uncharacterized protein LOC104119814    191   7e-64   Nicotiana tomentosiformis
ref|XP_011083822.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   1e-63   
ref|XP_004499083.1|  PREDICTED: uncharacterized protein LOC101514142    188   3e-63   Cicer arietinum [garbanzo]
ref|XP_004238179.1|  PREDICTED: uncharacterized protein LOC101261408    193   5e-63   Solanum lycopersicum
ref|XP_010529533.1|  PREDICTED: uncharacterized protein LOC104806367    186   1e-62   Tarenaya hassleriana [spider flower]
gb|KJB58439.1|  hypothetical protein B456_009G209900                    189   2e-62   Gossypium raimondii
emb|CDP01374.1|  unnamed protein product                                187   2e-62   Coffea canephora [robusta coffee]
gb|KJB58437.1|  hypothetical protein B456_009G209900                    188   2e-62   Gossypium raimondii
gb|KJB58436.1|  hypothetical protein B456_009G209900                    188   2e-62   Gossypium raimondii
gb|KJB58438.1|  hypothetical protein B456_009G209900                    188   2e-62   Gossypium raimondii
gb|KJB58440.1|  hypothetical protein B456_009G209900                    188   3e-62   Gossypium raimondii
ref|XP_006473361.1|  PREDICTED: uncharacterized protein LOC102621...    189   3e-62   Citrus sinensis [apfelsine]
gb|KDO84273.1|  hypothetical protein CISIN_1g0017371mg                  188   4e-62   Citrus sinensis [apfelsine]
ref|XP_007017323.1|  Calcineurin-like metallo-phosphoesterase sup...    186   4e-62   Theobroma cacao [chocolate]
ref|XP_006595961.1|  PREDICTED: uncharacterized protein LOC100820...    185   4e-62   
ref|XP_003544449.1|  PREDICTED: uncharacterized protein LOC100820...    185   5e-62   Glycine max [soybeans]
ref|XP_009618505.1|  PREDICTED: uncharacterized protein LOC104110...    184   8e-62   Nicotiana tomentosiformis
ref|XP_006601298.1|  PREDICTED: uncharacterized protein LOC100819...    184   1e-61   Glycine max [soybeans]
gb|KHN12760.1|  hypothetical protein glysoja_008723                     184   1e-61   Glycine soja [wild soybean]
ref|XP_003550348.1|  PREDICTED: uncharacterized protein LOC100819...    184   1e-61   Glycine max [soybeans]
ref|XP_010268877.1|  PREDICTED: uncharacterized protein LOC104605707    180   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010062120.1|  PREDICTED: uncharacterized protein LOC104449...    183   3e-61   
ref|XP_010062121.1|  PREDICTED: uncharacterized protein LOC104449...    183   3e-61   Eucalyptus grandis [rose gum]
ref|XP_010062116.1|  PREDICTED: uncharacterized protein LOC104449...    183   3e-61   
ref|XP_010062117.1|  PREDICTED: uncharacterized protein LOC104449...    183   3e-61   
ref|XP_009765845.1|  PREDICTED: uncharacterized protein LOC104217...    183   4e-61   Nicotiana sylvestris
ref|XP_010538790.1|  PREDICTED: uncharacterized protein LOC104813013    180   8e-61   Tarenaya hassleriana [spider flower]
ref|XP_007160825.1|  hypothetical protein PHAVU_001G019800g             181   1e-60   Phaseolus vulgaris [French bean]
ref|XP_010540555.1|  PREDICTED: uncharacterized protein LOC104814...    180   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010540547.1|  PREDICTED: uncharacterized protein LOC104814...    179   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_010044195.1|  PREDICTED: uncharacterized protein LOC104433...    177   3e-60   Eucalyptus grandis [rose gum]
gb|KJB63807.1|  hypothetical protein B456_010G017500                    179   9e-60   Gossypium raimondii
ref|XP_004152730.2|  PREDICTED: uncharacterized protein LOC101204257    178   1e-59   Cucumis sativus [cucumbers]
ref|XP_006413590.1|  hypothetical protein EUTSA_v10024304mg             173   5e-59   Eutrema salsugineum [saltwater cress]
ref|XP_008444644.1|  PREDICTED: uncharacterized protein LOC103487913    176   1e-58   Cucumis melo [Oriental melon]
gb|KFK28866.1|  hypothetical protein AALP_AA7G058700                    174   1e-58   Arabis alpina [alpine rockcress]
ref|XP_009367394.1|  PREDICTED: uncharacterized protein LOC103957048    184   2e-58   
ref|XP_008393832.1|  PREDICTED: uncharacterized protein LOC103455...    184   2e-58   
ref|XP_010433955.1|  PREDICTED: uncharacterized protein LOC104718...    171   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010433954.1|  PREDICTED: uncharacterized protein LOC104718...    171   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_012071694.1|  PREDICTED: uncharacterized protein LOC105633...    172   2e-58   Jatropha curcas
ref|XP_008383912.1|  PREDICTED: uncharacterized protein LOC103446557    182   2e-58   
ref|NP_194031.5|  calcineurin-like metallo-phosphoesterase family...    171   3e-58   
ref|XP_012071695.1|  PREDICTED: uncharacterized protein LOC105633...    172   3e-58   Jatropha curcas
ref|XP_002869795.1|  hypothetical protein ARALYDRAFT_914305             171   3e-58   Arabidopsis lyrata subsp. lyrata
emb|CAB45564.1|  hypothetical protein                                   171   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370173.1|  PREDICTED: uncharacterized protein LOC103959542    182   3e-58   Pyrus x bretschneideri [bai li]
emb|CDY13280.1|  BnaC09g23760D                                          172   6e-58   Brassica napus [oilseed rape]
ref|XP_006396852.1|  hypothetical protein EUTSA_v10028387mg             171   9e-58   Eutrema salsugineum [saltwater cress]
ref|XP_010448789.1|  PREDICTED: uncharacterized protein LOC104731...    168   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010448786.1|  PREDICTED: uncharacterized protein LOC104731...    168   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006285736.1|  hypothetical protein CARUB_v10007209mg             168   2e-57   Capsella rubella
emb|CDX98782.1|  BnaA03g45670D                                          172   5e-57   
ref|XP_009137306.1|  PREDICTED: uncharacterized protein LOC103861350    172   5e-57   
ref|XP_009102715.1|  PREDICTED: uncharacterized protein LOC103828821    169   6e-57   Brassica rapa
ref|XP_008220172.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    177   7e-57   Prunus mume [ume]
ref|XP_007227027.1|  hypothetical protein PRUPE_ppa000724mg             177   7e-57   Prunus persica
emb|CDY52938.1|  BnaCnng23820D                                          168   7e-57   Brassica napus [oilseed rape]
ref|XP_011458950.1|  PREDICTED: uncharacterized protein LOC101313...    182   3e-56   Fragaria vesca subsp. vesca
ref|XP_011458951.1|  PREDICTED: uncharacterized protein LOC101313...    182   3e-56   Fragaria vesca subsp. vesca
ref|XP_004291134.1|  PREDICTED: uncharacterized protein LOC101313...    182   3e-56   Fragaria vesca subsp. vesca
ref|XP_002510264.1|  hydrolase, putative                                163   3e-56   Ricinus communis
ref|XP_004252774.1|  PREDICTED: uncharacterized protein LOC101266203    163   4e-56   Solanum lycopersicum
ref|XP_006342611.1|  PREDICTED: uncharacterized protein LOC102601564    163   4e-56   Solanum tuberosum [potatoes]
emb|CBI19565.3|  unnamed protein product                                168   5e-56   Vitis vinifera
ref|XP_010275607.1|  PREDICTED: uncharacterized protein LOC104610601    162   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010664588.1|  PREDICTED: uncharacterized protein LOC100267...    168   6e-56   Vitis vinifera
gb|EPS68439.1|  hypothetical protein M569_06328                         170   1e-55   Genlisea aurea
emb|CDX94143.1|  BnaC07g37770D                                          176   3e-55   
ref|NP_001058702.1|  Os07g0106000                                       170   3e-55   
ref|XP_006434822.1|  hypothetical protein CICLE_v10000140mg             163   1e-54   
ref|XP_006434821.1|  hypothetical protein CICLE_v10000140mg             163   1e-54   
gb|KCW69186.1|  hypothetical protein EUGRSUZ_F02708                     160   3e-54   Eucalyptus grandis [rose gum]
ref|XP_003557697.1|  PREDICTED: uncharacterized protein LOC100823404    165   4e-54   
ref|XP_010455595.1|  PREDICTED: uncharacterized protein LOC104737182    159   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010434128.1|  PREDICTED: uncharacterized protein LOC104718144    159   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010422134.1|  PREDICTED: uncharacterized protein LOC104707474    159   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009128650.1|  PREDICTED: uncharacterized protein LOC103853501    162   1e-53   Brassica rapa
ref|XP_006286984.1|  hypothetical protein CARUB_v10000128mg             158   2e-53   Capsella rubella
ref|XP_002874725.1|  predicted protein                                  157   3e-53   
ref|XP_011074457.1|  PREDICTED: uncharacterized protein LOC105159184    157   4e-53   Sesamum indicum [beniseed]
ref|XP_008651923.1|  PREDICTED: uncharacterized protein LOC103631...    168   2e-52   
ref|XP_008651921.1|  PREDICTED: uncharacterized protein LOC103631...    168   2e-52   
ref|NP_192917.3|  calcineurin-like phosphoesterase domain-contain...    153   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002461307.1|  hypothetical protein SORBIDRAFT_02g000620          166   6e-52   Sorghum bicolor [broomcorn]
ref|XP_004987257.1|  PREDICTED: uncharacterized protein LOC101786...    166   9e-52   Setaria italica
ref|XP_006374985.1|  hypothetical protein POPTR_0014s03370g             189   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011030451.1|  PREDICTED: uncharacterized protein LOC105129897    189   4e-50   Populus euphratica
ref|XP_010684140.1|  PREDICTED: uncharacterized protein LOC104898734    145   2e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS47321.1|  hypothetical protein TRIUR3_13192                       152   2e-49   Triticum urartu
emb|CAB44318.1|  putative protein                                       144   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40050.1|  calcineurin-like metallo-phosphoesterase superfam...    183   4e-48   Medicago truncatula
gb|KEH40051.1|  calcineurin-like metallo-phosphoesterase superfam...    182   5e-48   Medicago truncatula
gb|KEH40052.1|  calcineurin-like metallo-phosphoesterase superfam...    182   6e-48   Medicago truncatula
ref|XP_010936846.1|  PREDICTED: uncharacterized protein LOC105056370    176   1e-45   Elaeis guineensis
ref|XP_008799898.1|  PREDICTED: uncharacterized protein LOC103714...    175   2e-45   Phoenix dactylifera
ref|XP_008799897.1|  PREDICTED: uncharacterized protein LOC103714...    175   2e-45   Phoenix dactylifera
ref|XP_010044196.1|  PREDICTED: uncharacterized protein LOC104433...    174   3e-45   
ref|XP_008811243.1|  PREDICTED: uncharacterized protein LOC103722...    174   6e-45   Phoenix dactylifera
ref|XP_010932753.1|  PREDICTED: uncharacterized protein LOC105053...    172   1e-44   
ref|XP_009392959.1|  PREDICTED: uncharacterized protein LOC103978...    172   2e-44   
ref|XP_009392951.1|  PREDICTED: uncharacterized protein LOC103978...    172   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932752.1|  PREDICTED: uncharacterized protein LOC105053...    172   2e-44   Elaeis guineensis
ref|XP_009393277.1|  PREDICTED: uncharacterized protein LOC103979011    172   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN18128.1|  hypothetical protein AMTR_s00054p00046250               160   5e-40   Amborella trichopoda
ref|XP_011627911.1|  PREDICTED: uncharacterized protein LOC18446479     158   2e-39   Amborella trichopoda
gb|KHG27254.1|  aat                                                     108   2e-38   Gossypium arboreum [tree cotton]
gb|KHG27255.1|  aat                                                     108   2e-38   Gossypium arboreum [tree cotton]
ref|XP_006657430.1|  PREDICTED: uncharacterized protein LOC102702861    155   3e-38   Oryza brachyantha
ref|XP_001772190.1|  predicted protein                                  120   8e-38   
ref|XP_001765009.1|  predicted protein                                  113   1e-37   
ref|XP_004956163.1|  PREDICTED: uncharacterized protein LOC101776542    146   3e-35   Setaria italica
ref|XP_010238512.1|  PREDICTED: uncharacterized protein LOC100842...    146   4e-35   Brachypodium distachyon [annual false brome]
ref|XP_010238513.1|  PREDICTED: uncharacterized protein LOC100842...    145   4e-35   Brachypodium distachyon [annual false brome]
ref|XP_008670049.1|  PREDICTED: uncharacterized protein LOC103647275    145   6e-35   Zea mays [maize]
ref|XP_002461963.1|  hypothetical protein SORBIDRAFT_02g011280          138   1e-32   
emb|CDY47423.1|  BnaA02g21590D                                        85.9    4e-32   Brassica napus [oilseed rape]
ref|XP_002963358.1|  hypothetical protein SELMODRAFT_80477              136   1e-31   
ref|XP_002974647.1|  hypothetical protein SELMODRAFT_102099             136   1e-31   
emb|CDX86745.1|  BnaA09g21350D                                        84.0    1e-31   
ref|XP_010044199.1|  PREDICTED: uncharacterized protein LOC104433215  76.3    3e-23   Eucalyptus grandis [rose gum]
ref|XP_010040937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.4    7e-17   
gb|KCW86241.1|  hypothetical protein EUGRSUZ_B02927                   84.7    1e-14   Eucalyptus grandis [rose gum]
gb|EEC81473.1|  hypothetical protein OsI_24798                        82.4    5e-14   Oryza sativa Indica Group [Indian rice]
gb|EMT21375.1|  hypothetical protein F775_01280                       73.2    4e-11   
gb|KCW44766.1|  hypothetical protein EUGRSUZ_L01671                   60.5    2e-07   Eucalyptus grandis [rose gum]
ref|XP_010664589.1|  PREDICTED: uncharacterized protein LOC100267...  51.6    6e-04   Vitis vinifera



>ref|XP_009761575.1| PREDICTED: uncharacterized protein LOC104213728 [Nicotiana sylvestris]
Length=1019

 Score =   191 bits (484),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQS+GLLDTL M+ VRTILTH YPYPHEHSRHL IAV VGCLFFISSDNMHTLIQK
Sbjct  1    MGSDKQSSGLLDTLKMETVRTILTHSYPYPHEHSRHLVIAVFVGCLFFISSDNMHTLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD+N+KWWSMY CLLGFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDSNVKWWSMYACLLGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 83.6 bits (205),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YIVWI VAALYHLPSFQSMGVDLRMNLSLFLT++VSSI FLLVFHV
Sbjct  101  YIVWILVAALYHLPSFQSMGVDLRMNLSLFLTLFVSSILFLLVFHV  146



>gb|EYU25397.1| hypothetical protein MIMGU_mgv1a000678mg [Erythranthe guttata]
Length=1021

 Score =   191 bits (485),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ  GLLDTLNM+KVRTI TH YPYPHEHSRH  IAV +GCLFFISSDNMHTLIQK
Sbjct  1    MGSDKQPVGLLDTLNMEKVRTIFTHTYPYPHEHSRHAVIAVFIGCLFFISSDNMHTLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD+NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDSNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 82.4 bits (202),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIGWILVAALYHLPSFQSMGVDMRMNLSLFLTIYISSILFLLVFHI  146



>ref|XP_009629701.1| PREDICTED: uncharacterized protein LOC104119814 [Nicotiana tomentosiformis]
Length=1020

 Score =   191 bits (484),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQS+GLLDTL M+ VRTILTH YPYPHEHSRHL IAV VGCLFFISSDNMHTLIQK
Sbjct  1    MGSDKQSSGLLDTLKMETVRTILTHSYPYPHEHSRHLVIAVFVGCLFFISSDNMHTLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD+N+KWWSMY CLLGFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDSNVKWWSMYACLLGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 82.0 bits (201),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLFLT++VSSI FLL+FHV
Sbjct  101  YIAWILVAALYHLPSFQSMGVDLRMNLSLFLTLFVSSILFLLIFHV  146



>ref|XP_011083822.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105166233 
[Sesamum indicum]
Length=1005

 Score =   187 bits (475),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK   GLLDTLNM+ VRTI TH YPYPHEHSRH  IAV +GCLFFISSDNMHTLIQK
Sbjct  1    MGSDKHPVGLLDTLNMETVRTIFTHTYPYPHEHSRHAVIAVFIGCLFFISSDNMHTLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD+NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDSNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 84.3 bits (207),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSILFLLVFHI  146



>ref|XP_004499083.1| PREDICTED: uncharacterized protein LOC101514142 [Cicer arietinum]
Length=1017

 Score =   188 bits (477),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ AGLLD L M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSDKQPAGLLDNLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMYGCL GFFYFFSSPF+GKTI+PSYSNFSRW
Sbjct  61   LDNNVKWWSMYGCLFGFFYFFSSPFVGKTIKPSYSNFSRW  100


 Score = 82.4 bits (202),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_004238179.1| PREDICTED: uncharacterized protein LOC101261408 [Solanum lycopersicum]
Length=1010

 Score =   193 bits (490),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQS+GLLDTL M+ VRTILTH YPYPHEHSRHL IAV VGCLFFISSDNMHTLIQK
Sbjct  1    MGSDKQSSGLLDTLKMETVRTILTHSYPYPHEHSRHLVIAVFVGCLFFISSDNMHTLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD+NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDSNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 76.6 bits (187),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI +AALYHLPSF SMGVDLRMNLSLFLT++VSSI FLLVFHV
Sbjct  101  YISWILLAALYHLPSFLSMGVDLRMNLSLFLTLFVSSILFLLVFHV  146



>ref|XP_010529533.1| PREDICTED: uncharacterized protein LOC104806367 [Tarenaya hassleriana]
Length=1014

 Score =   186 bits (471),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK   GLLDTL M++VRTILTH YPYPHEHSRH  IAV++GCLFFISSDNMHTL++K
Sbjct  1    MGSDKHPVGLLDTLKMERVRTILTHTYPYPHEHSRHAIIAVILGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFIGKTIRPSYSNFSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIGKTIRPSYSNFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>gb|KJB58439.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=975

 Score =   189 bits (479),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.3 bits (194),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+D+RMNLSLFL+IY+SSI FL+VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDMRMNLSLFLSIYISSILFLIVFHI  146



>emb|CDP01374.1| unnamed protein product [Coffea canephora]
Length=1010

 Score =   187 bits (476),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS++QS G LDTLNM+ VRTILTH  PYPHEHSRH  IAVVVGCLFFISSDNMHTLIQK
Sbjct  1    MGSNRQSVGFLDTLNMETVRTILTHTSPYPHEHSRHAVIAVVVGCLFFISSDNMHTLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LDTNIKWWSMY CL GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDTNIKWWSMYACLFGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 80.5 bits (197),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTI++SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIFISSILFLLVFHI  146



>gb|KJB58437.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=824

 Score =   188 bits (478),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.3 bits (194),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+D+RMNLSLFL+IY+SSI FL+VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDMRMNLSLFLSIYISSILFLIVFHI  146



>gb|KJB58436.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=1021

 Score =   188 bits (478),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.3 bits (194),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+D+RMNLSLFL+IY+SSI FL+VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDMRMNLSLFLSIYISSILFLIVFHI  146



>gb|KJB58438.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=957

 Score =   188 bits (477),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.3 bits (194),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+D+RMNLSLFL+IY+SSI FL+VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDMRMNLSLFLSIYISSILFLIVFHI  146



>gb|KJB58440.1| hypothetical protein B456_009G209900 [Gossypium raimondii]
Length=859

 Score =   188 bits (477),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLL TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLPTLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.3 bits (194),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+D+RMNLSLFL+IY+SSI FL+VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDMRMNLSLFLSIYISSILFLIVFHI  146



>ref|XP_006473361.1| PREDICTED: uncharacterized protein LOC102621653 isoform X1 [Citrus 
sinensis]
 ref|XP_006473362.1| PREDICTED: uncharacterized protein LOC102621653 isoform X2 [Citrus 
sinensis]
Length=1019

 Score =   189 bits (479),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLLDTL M++VRTILTH +PYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLDTLRMERVRTILTHTHPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTITPSYSNFSRW  100


 Score = 78.6 bits (192),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVDLRMNLSLFLTI+++S+ FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDLRMNLSLFLTIFLASVLFLLVFHI  146



>gb|KDO84273.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84274.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84275.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84276.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84277.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84278.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
 gb|KDO84279.1| hypothetical protein CISIN_1g0017371mg, partial [Citrus sinensis]
Length=561

 Score =   188 bits (477),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLLDTL M++VRTILTH +PYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSAGLLDTLRMERVRTILTHTHPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTITPSYSNFSRW  100


 Score = 78.6 bits (192),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVDLRMNLSLFLTI+++S+ FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDLRMNLSLFLTIFLASVLFLLVFHI  146



>ref|XP_007017323.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY14548.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
isoform 1 [Theobroma cacao]
Length=1019

 Score =   186 bits (471),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SAGLL TL M +VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTLI+K
Sbjct  1    MGSDKHSAGLLPTLGMDRVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNIHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 80.5 bits (197),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFL+IY+SSI FLLVFH+
Sbjct  101  YIAWILVAAIYHLPSFQSMGVDMRMNLSLFLSIYISSILFLLVFHI  146



>ref|XP_006595961.1| PREDICTED: uncharacterized protein LOC100820584 isoform X3 [Glycine 
max]
Length=910

 Score =   185 bits (470),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS KQSAG+LDTL MQ+VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSSKQSAGILDTLKMQRVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CL GFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDNNVKWWSMYACLFGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYLSSILFLLVFHI  146



>ref|XP_003544449.1| PREDICTED: uncharacterized protein LOC100820584 isoform X1 [Glycine 
max]
 ref|XP_006595960.1| PREDICTED: uncharacterized protein LOC100820584 isoform X2 [Glycine 
max]
 gb|KHN46303.1| hypothetical protein glysoja_045314 [Glycine soja]
Length=1021

 Score =   185 bits (470),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS KQSAG+LDTL MQ+VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSSKQSAGILDTLKMQRVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CL GFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDNNVKWWSMYACLFGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 81.3 bits (199),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYLSSILFLLVFHI  146



>ref|XP_009618505.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618510.1| PREDICTED: uncharacterized protein LOC104110671 isoform X1 [Nicotiana 
tomentosiformis]
Length=1019

 Score =   184 bits (467),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQS+GLLDTLNM+ VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+H+LIQK
Sbjct  1    MGSDKQSSGLLDTLNMETVRTILTHSYPYPHEHSRHFVIAVVVGCLFFISSDNLHSLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
             D  IKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   FD--IKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  98


 Score = 81.6 bits (200),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI +AA+YHLPSFQSMGVDLRMNLSLFLT+YVSSI FLLVFHV
Sbjct  99   YIAWILLAAIYHLPSFQSMGVDLRMNLSLFLTLYVSSILFLLVFHV  144



>ref|XP_006601298.1| PREDICTED: uncharacterized protein LOC100819940 isoform X4 [Glycine 
max]
Length=987

 Score =   184 bits (467),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS KQSAG+LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSSKQSAGILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CL GFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDKNVKWWSMYACLFGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYLSSILFLLVFHI  146



>gb|KHN12760.1| hypothetical protein glysoja_008723 [Glycine soja]
Length=1021

 Score =   184 bits (466),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS KQSAG+LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSSKQSAGILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CL GFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDKNVKWWSMYACLFGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYLSSILFLLVFHI  146



>ref|XP_003550348.1| PREDICTED: uncharacterized protein LOC100819940 isoform X1 [Glycine 
max]
 ref|XP_006601296.1| PREDICTED: uncharacterized protein LOC100819940 isoform X2 [Glycine 
max]
 ref|XP_006601297.1| PREDICTED: uncharacterized protein LOC100819940 isoform X3 [Glycine 
max]
Length=1021

 Score =   184 bits (466),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS KQSAG+LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSSKQSAGILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CL GFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDKNVKWWSMYACLFGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYLSSILFLLVFHI  146



>ref|XP_010268877.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
 ref|XP_010268883.1| PREDICTED: uncharacterized protein LOC104605707 [Nelumbo nucifera]
Length=1012

 Score =   180 bits (457),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS+KQS GLLD L M++VR ILT  YPYPHEHSRH  IAVVVGCLFFISSD+MH+LIQK
Sbjct  1    MGSNKQSLGLLDNLKMERVRMILTPAYPYPHEHSRHAIIAVVVGCLFFISSDSMHSLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 84.3 bits (207),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI FLLVFH+
Sbjct  101  YITWILVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSILFLLVFHI  146



>ref|XP_010062120.1| PREDICTED: uncharacterized protein LOC104449600 isoform X3 [Eucalyptus 
grandis]
Length=1044

 Score =   183 bits (464),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMHTL++K
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            L+ NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LEGNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLF TIYVSS+ FL VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGVDLRMNLSLFFTIYVSSVLFLFVFHI  146



>ref|XP_010062121.1| PREDICTED: uncharacterized protein LOC104449600 isoform X4 [Eucalyptus 
grandis]
Length=1011

 Score =   183 bits (464),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMHTL++K
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            L+ NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LEGNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLF TIYVSS+ FL VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGVDLRMNLSLFFTIYVSSVLFLFVFHI  146



>ref|XP_010062116.1| PREDICTED: uncharacterized protein LOC104449600 isoform X1 [Eucalyptus 
grandis]
Length=1109

 Score =   183 bits (464),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMHTL++K
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            L+ NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LEGNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLF TIYVSS+ FL VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGVDLRMNLSLFFTIYVSSVLFLFVFHI  146



>ref|XP_010062117.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010062119.1| PREDICTED: uncharacterized protein LOC104449600 isoform X2 [Eucalyptus 
grandis]
Length=1058

 Score =   183 bits (464),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ  GLLDTL M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMHTL++K
Sbjct  1    MGSDKQPLGLLDTLKMERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            L+ NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LEGNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 80.5 bits (197),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLF TIYVSS+ FL VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGVDLRMNLSLFFTIYVSSVLFLFVFHI  146



>ref|XP_009765845.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765846.1| PREDICTED: uncharacterized protein LOC104217330 isoform X1 [Nicotiana 
sylvestris]
Length=1019

 Score =   183 bits (464),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 92/100 (92%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD+QS+GLLDTLNM+ VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+H+LIQK
Sbjct  1    MGSDRQSSGLLDTLNMETVRTILTHSYPYPHEHSRHFVIAVVVGCLFFISSDNLHSLIQK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
             D  IKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   FD--IKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI +AA+YHLPSFQSMGVDLRMNLSLFLT+YVSSI FLLVFH+
Sbjct  99   YIAWILLAAIYHLPSFQSMGVDLRMNLSLFLTLYVSSILFLLVFHL  144



>ref|XP_010538790.1| PREDICTED: uncharacterized protein LOC104813013 [Tarenaya hassleriana]
Length=1007

 Score =   180 bits (456),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS K   GLLDTL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMHTL++K
Sbjct  1    MGSVKNHVGLLDTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFIGKTIRPSYSNFSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIGKTIRPSYSNFSRW  100


 Score = 82.4 bits (202),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_007160825.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
 gb|ESW32819.1| hypothetical protein PHAVU_001G019800g [Phaseolus vulgaris]
Length=1010

 Score =   181 bits (459),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS KQSA +LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MGSSKQSARILDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CL GFFYFFSSPFIGKT +PSYSNFSRW
Sbjct  61   LDNNVKWWSMYACLFGFFYFFSSPFIGKTFKPSYSNFSRW  100


 Score = 80.9 bits (198),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYLSSILFLLVFHI  146



>ref|XP_010540555.1| PREDICTED: uncharacterized protein LOC104814278 isoform X2 [Tarenaya 
hassleriana]
Length=991

 Score =   180 bits (456),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK    LLDT  M++VR ILTH YPYPHEHSRH  IAV++GCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHPVSLLDTFKMERVRIILTHTYPYPHEHSRHAVIAVILGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFIGKTIRPSYSNFSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIGKTIRPSYSNFSRW  100


 Score = 82.0 bits (201),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAIYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_010540547.1| PREDICTED: uncharacterized protein LOC104814278 isoform X1 [Tarenaya 
hassleriana]
Length=1012

 Score =   179 bits (455),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK    LLDT  M++VR ILTH YPYPHEHSRH  IAV++GCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHPVSLLDTFKMERVRIILTHTYPYPHEHSRHAVIAVILGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFIGKTIRPSYSNFSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIGKTIRPSYSNFSRW  100


 Score = 82.0 bits (201),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAAIYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_010044195.1| PREDICTED: uncharacterized protein LOC104433212 isoform X1 [Eucalyptus 
grandis]
Length=1012

 Score =   177 bits (449),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS++QS GLL TL M   RTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSERQSMGLLGTLRM---RTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNMHTLIEK  57

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  58   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  97


 Score = 82.8 bits (203),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI FL VFH+
Sbjct  98   YIAWILVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSIIFLTVFHI  143



>gb|KJB63807.1| hypothetical protein B456_010G017500 [Gossypium raimondii]
Length=1017

 Score =   179 bits (454),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 91/100 (91%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK+SAGLL    M++VRTILTH Y YPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKRSAGLLP--RMERVRTILTHKYRYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  58

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMYGCLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  59   LDNNIKWWSMYGCLLGFFYFFSSPFIGKTIKPSYSNFSRW  98


 Score = 79.7 bits (195),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFL+IY+SSI FLLVFH+
Sbjct  99   YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLSIYLSSILFLLVFHI  144



>ref|XP_004152730.2| PREDICTED: uncharacterized protein LOC101204257 [Cucumis sativus]
 gb|KGN62541.1| hypothetical protein Csa_2G360580 [Cucumis sativus]
Length=1025

 Score =   178 bits (452),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M S+  SAGLLDT  M++VRTI TH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MVSENISAGLLDTFKMKRVRTIFTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWS+Y CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDQNIKWWSIYSCLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.7 bits (195),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLS+F+TIY+SSI FL VFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDIRMNLSMFITIYISSILFLTVFHI  146



>ref|XP_006413590.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
 gb|ESQ55043.1| hypothetical protein EUTSA_v10024304mg [Eutrema salsugineum]
Length=1005

 Score =   173 bits (439),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA LL+ L M++VRTILT  YPYPHEHSRH  IAVV GC+FFISSDNMHTL++K
Sbjct  1    MGSDKHSARLLNNLKMERVRTILTQTYPYPHEHSRHAMIAVVFGCIFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFIGKTIRP+YS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIGKTIRPNYSIFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_008444644.1| PREDICTED: uncharacterized protein LOC103487913 [Cucumis melo]
Length=1025

 Score =   176 bits (445),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SD  S GLLD   M++VRTI TH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI K
Sbjct  1    MVSDNISVGLLDNFKMKRVRTIFTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIDK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWS+Y CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDQNIKWWSIYSCLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 79.7 bits (195),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLS+F+TIY+SSI FL VFH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDIRMNLSMFITIYISSILFLTVFHI  146



>gb|KFK28866.1| hypothetical protein AALP_AA7G058700 [Arabis alpina]
Length=1015

 Score =   174 bits (442),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK +A LL+ L M++VRTILTH YPYPHEHSRH  IAV+ GCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHAARLLNNLKMERVRTILTHTYPYPHEHSRHAMIAVISGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFIGKTIRPSYS FS W
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIGKTIRPSYSTFSWW  100


 Score = 80.9 bits (198),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL VFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSVVFLFVFHI  146



>ref|XP_009367394.1| PREDICTED: uncharacterized protein LOC103957048 [Pyrus x bretschneideri]
Length=1020

 Score =   184 bits (467),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN++TLI+K
Sbjct  1    MGSDVQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 70.5 bits (171),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI+WI VAA+YHLPSFQSMGVD+RMNLSL   ++V+S+ FLL FH+
Sbjct  101  YILWILVAAVYHLPSFQSMGVDMRMNLSLGFNVFVTSVLFLLFFHI  146



>ref|XP_008393832.1| PREDICTED: uncharacterized protein LOC103455994 isoform X1 [Malus 
domestica]
Length=1021

 Score =   184 bits (467),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN++TLI+K
Sbjct  1    MGSDVQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 70.5 bits (171),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI+WI VAA+YHLPSFQSMGVD+RMNLSL   ++V+S+ FLL FH+
Sbjct  101  YILWILVAAVYHLPSFQSMGVDMRMNLSLGFNVFVTSVLFLLFFHI  146



>ref|XP_010433955.1| PREDICTED: uncharacterized protein LOC104718003 isoform X2 [Camelina 
sativa]
Length=902

 Score =   171 bits (434),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV++GCLFFISS+NMH+L++K
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVILGCLFFISSENMHSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_010433954.1| PREDICTED: uncharacterized protein LOC104718003 isoform X1 [Camelina 
sativa]
Length=1013

 Score =   171 bits (434),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV++GCLFFISS+NMH+L++K
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVILGCLFFISSENMHSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_012071694.1| PREDICTED: uncharacterized protein LOC105633674 isoform X1 [Jatropha 
curcas]
Length=1016

 Score =   172 bits (436),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 4/100 (4%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD+    LLD+L M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMHTLI+K
Sbjct  1    MGSDR----LLDSLRMERVRTILTHTYPYPHEHSRHAIIAVAVGCLFFISSDNMHTLIEK  56

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CLLGFFYFFSSPF+ KTI+PSYSNFSRW
Sbjct  57   LDNNVKWWSMYACLLGFFYFFSSPFLEKTIKPSYSNFSRW  96


 Score = 82.0 bits (201),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSL+LTIY+SSI FLLVFH+
Sbjct  97   YIAWILVAALYHLPSFQSMGVDLRMNLSLYLTIYLSSILFLLVFHI  142



>ref|XP_008383912.1| PREDICTED: uncharacterized protein LOC103446557 [Malus domestica]
Length=1020

 Score =   182 bits (463),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN++TLI+K
Sbjct  1    MGSDMQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CL GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLFGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 71.6 bits (174),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YIVWI VAA+YHLPSFQSMGVD+RMNLSL   ++V+S+ FLL FH+
Sbjct  101  YIVWILVAAVYHLPSFQSMGVDMRMNLSLGFNVFVTSVLFLLFFHI  146



>ref|NP_194031.5| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
 gb|AEE84691.1| calcineurin-like metallo-phosphoesterase family protein [Arabidopsis 
thaliana]
Length=1015

 Score =   171 bits (433),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAVV+GC+FFISS+NMH+L++K
Sbjct  1    MGSDKNSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVVLGCMFFISSENMHSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_012071695.1| PREDICTED: uncharacterized protein LOC105633674 isoform X2 [Jatropha 
curcas]
Length=865

 Score =   172 bits (435),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 4/100 (4%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD+    LLD+L M++VRTILTH YPYPHEHSRH  IAV VGCLFFISSDNMHTLI+K
Sbjct  1    MGSDR----LLDSLRMERVRTILTHTYPYPHEHSRHAIIAVAVGCLFFISSDNMHTLIEK  56

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N+KWWSMY CLLGFFYFFSSPF+ KTI+PSYSNFSRW
Sbjct  57   LDNNVKWWSMYACLLGFFYFFSSPFLEKTIKPSYSNFSRW  96


 Score = 82.0 bits (201),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSL+LTIY+SSI FLLVFH+
Sbjct  97   YIAWILVAALYHLPSFQSMGVDLRMNLSLYLTIYLSSILFLLVFHI  142



>ref|XP_002869795.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46054.1| hypothetical protein ARALYDRAFT_914305 [Arabidopsis lyrata subsp. 
lyrata]
Length=1015

 Score =   171 bits (433),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAV++GCLFFISS+NMH+L++K
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVILGCLFFISSENMHSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIRKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>emb|CAB45564.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79255.1| hypothetical protein [Arabidopsis thaliana]
Length=932

 Score =   171 bits (433),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHEHSRH  IAVV+GC+FFISS+NMH+L++K
Sbjct  27   MGSDKNSARFLHNLKMERVRTILTHTYPYPHEHSRHAMIAVVLGCMFFISSENMHSLVEK  86

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  87   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  126


 Score = 82.8 bits (203),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  127  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  172



>ref|XP_009370173.1| PREDICTED: uncharacterized protein LOC103959542 [Pyrus x bretschneideri]
Length=1020

 Score =   182 bits (461),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSD QS G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+ TLI+K
Sbjct  1    MGSDMQSVGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNISTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CL GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLFGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 71.6 bits (174),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YIVWI VAA+YHLPSFQSMGVD+RMNLSL   ++V+S+ FLL FH+
Sbjct  101  YIVWILVAAVYHLPSFQSMGVDMRMNLSLGFNVFVTSVLFLLFFHI  146



>emb|CDY13280.1| BnaC09g23760D [Brassica napus]
Length=1014

 Score =   172 bits (435),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSARLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWW MYGCLLGFFYFFSSPFIGKTIRP+YSNFSRW
Sbjct  61   F--SVKWWLMYGCLLGFFYFFSSPFIGKTIRPNYSNFSRW  98


 Score = 80.9 bits (198),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSIVFLVVFHI  144



>ref|XP_006396852.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
 gb|ESQ38305.1| hypothetical protein EUTSA_v10028387mg [Eutrema salsugineum]
Length=1013

 Score =   171 bits (434),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA LL+TL M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMHTLI+K
Sbjct  1    MGSDKHSARLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFIGKTIRP+YSNFSRW
Sbjct  61   F--SVKWWSMYACLLGFFYFFSSPFIGKTIRPNYSNFSRW  98


 Score = 80.9 bits (198),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSIVFLVVFHI  144



>ref|XP_010448789.1| PREDICTED: uncharacterized protein LOC104731191 isoform X2 [Camelina 
sativa]
Length=901

 Score =   168 bits (426),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHE+SRH  IAV++GCLFFISS+NMH L++K
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEYSRHAMIAVILGCLFFISSENMHGLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_010448786.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
 ref|XP_010448787.1| PREDICTED: uncharacterized protein LOC104731191 isoform X1 [Camelina 
sativa]
Length=1012

 Score =   168 bits (425),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  L  L M++VRTILTH YPYPHE+SRH  IAV++GCLFFISS+NMH L++K
Sbjct  1    MGSDKHSARFLHNLKMERVRTILTHTYPYPHEYSRHAMIAVILGCLFFISSENMHGLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>ref|XP_006285736.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
 gb|EOA18634.1| hypothetical protein CARUB_v10007209mg [Capsella rubella]
Length=1015

 Score =   168 bits (425),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK S   L  L M++VRT+LTH YPYPHEHSRH  IAV++GCLFFISS+NMH+L++K
Sbjct  1    MGSDKHSPRFLHNLKMERVRTMLTHTYPYPHEHSRHAMIAVILGCLFFISSENMHSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPFI KTIRPSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFIKKTIRPSYSTFSRW  100


 Score = 82.8 bits (203),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMG+DLRMNLSLFLTIY+SSI FLLVFH+
Sbjct  101  YIAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYISSIVFLLVFHI  146



>emb|CDX98782.1| BnaA03g45670D [Brassica napus]
Length=1007

 Score =   172 bits (435),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SDK SA  L+ L M++VRT+LTH YPYPHEHSRH  IAV++GCLFFISSDNMHTL++K
Sbjct  1    MSSDKHSARFLNKLKMERVRTMLTHTYPYPHEHSRHAMIAVIMGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPF+GKTI+PSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFLGKTIQPSYSTFSRW  100


 Score = 77.8 bits (190),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            ++ WI VAALYHLPSFQSMG+DLRMNLSLFLTIY SS+ FL VFH+
Sbjct  101  HVAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYTSSVVFLFVFHI  146



>ref|XP_009137306.1| PREDICTED: uncharacterized protein LOC103861350 [Brassica rapa]
Length=1007

 Score =   172 bits (435),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SDK SA  L+ L M++VRT+LTH YPYPHEHSRH  IAV++GCLFFISSDNMHTL++K
Sbjct  1    MSSDKHSARFLNKLKMERVRTMLTHTYPYPHEHSRHAMIAVIMGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPF+GKTI+PSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFLGKTIQPSYSTFSRW  100


 Score = 77.8 bits (190),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            ++ WI VAALYHLPSFQSMG+DLRMNLSLFLTIY SS+ FL VFH+
Sbjct  101  HVAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYTSSVVFLFVFHI  146



>ref|XP_009102715.1| PREDICTED: uncharacterized protein LOC103828821 [Brassica rapa]
Length=1014

 Score =   169 bits (427),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS+K SA LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMHTLI+K
Sbjct  1    MGSEKHSARLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWW MY CLLGFFYFFSSPFIGKTIRP+YSNFSRW
Sbjct  61   F--SVKWWLMYACLLGFFYFFSSPFIGKTIRPNYSNFSRW  98


 Score = 80.9 bits (198),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSIVFLVVFHI  144



>ref|XP_008220172.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103320287 
[Prunus mume]
Length=1020

 Score =   177 bits (449),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS   S G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+++L++K
Sbjct  1    MGSTTPSVGFLDTLRMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 72.0 bits (175),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSL   +YV+S+ FLL FH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLGFNVYVTSVLFLLFFHI  146



>ref|XP_007227027.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
 gb|EMJ28226.1| hypothetical protein PRUPE_ppa000724mg [Prunus persica]
Length=1021

 Score =   177 bits (448),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS   S G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+++L++K
Sbjct  1    MGSTTPSVGFLDTLRMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINSLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 72.0 bits (175),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSL   +YV+S+ FLL FH+
Sbjct  101  YIAWILVAAVYHLPSFQSMGVDMRMNLSLGFNVYVTSVLFLLFFHI  146



>emb|CDY52938.1| BnaCnng23820D [Brassica napus]
Length=1013

 Score =   168 bits (426),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG DK S  LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMHTLI+K
Sbjct  1    MGPDKHSTRLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFIGKTIRP+YSNFSRW
Sbjct  61   F--SLKWWSMYACLLGFFYFFSSPFIGKTIRPNYSNFSRW  98


 Score = 80.9 bits (198),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSIVFLVVFHI  144



>ref|XP_011458950.1| PREDICTED: uncharacterized protein LOC101313275 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1027

 Score =   182 bits (462),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG  KQS+G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN++TL++K
Sbjct  1    MGPSKQSSGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 65.1 bits (157),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIFVAA+YHLP  +SMGVD+RM+LSL   ++V+S+ FLL FH+
Sbjct  101  YITWIFVAAVYHLPKLKSMGVDIRMSLSLGFNVFVTSVLFLLFFHI  146



>ref|XP_011458951.1| PREDICTED: uncharacterized protein LOC101313275 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1024

 Score =   182 bits (461),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG  KQS+G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN++TL++K
Sbjct  1    MGPSKQSSGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 65.1 bits (157),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIFVAA+YHLP  +SMGVD+RM+LSL   ++V+S+ FLL FH+
Sbjct  101  YITWIFVAAVYHLPKLKSMGVDIRMSLSLGFNVFVTSVLFLLFFHI  146



>ref|XP_004291134.1| PREDICTED: uncharacterized protein LOC101313275 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=1022

 Score =   182 bits (461),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG  KQS+G LDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN++TL++K
Sbjct  1    MGPSKQSSGFLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNINTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  100


 Score = 65.1 bits (157),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIFVAA+YHLP  +SMGVD+RM+LSL   ++V+S+ FLL FH+
Sbjct  101  YITWIFVAAVYHLPKLKSMGVDIRMSLSLGFNVFVTSVLFLLFFHI  146



>ref|XP_002510264.1| hydrolase, putative [Ricinus communis]
 gb|EEF52451.1| hydrolase, putative [Ricinus communis]
Length=1006

 Score =   163 bits (412),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTL++KLD N+KWWSMY CLL
Sbjct  1    MERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLVEKLDNNVKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPF+ KTI+PSYSNFSRW
Sbjct  61   GFFYFFSSPFLEKTIKPSYSNFSRW  85


 Score = 84.0 bits (206),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI +AALYHLPSFQSMG+DLRMNLSLFLTIYVSSI FLLVFH+
Sbjct  86   YIAWILIAALYHLPSFQSMGLDLRMNLSLFLTIYVSSILFLLVFHI  131



>ref|XP_004252774.1| PREDICTED: uncharacterized protein LOC101266203 [Solanum lycopersicum]
Length=1020

 Score =   163 bits (412),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG DKQ +G+LDTL M+ VRTI    Y YPHEHSRH  IAVVVGCLFFISSDNMH+LIQK
Sbjct  1    MGIDKQPSGILDTLKMETVRTIFP-SYRYPHEHSRHFVIAVVVGCLFFISSDNMHSLIQK  59

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
             D  IKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  60   FD--IKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  97


 Score = 84.0 bits (206),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLFLT+YVSSI FLLVFHV
Sbjct  98   YIAWILVAALYHLPSFQSMGVDLRMNLSLFLTLYVSSILFLLVFHV  143



>ref|XP_006342611.1| PREDICTED: uncharacterized protein LOC102601564 [Solanum tuberosum]
Length=1020

 Score =   163 bits (412),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG DKQ +G+LDTL M+ VRTI    Y YPHEHSRH  IAVVVGCLFFISSDNMH+LIQK
Sbjct  1    MGIDKQPSGILDTLKMETVRTIFP-SYRYPHEHSRHFVIAVVVGCLFFISSDNMHSLIQK  59

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
             D  IKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  60   FD--IKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  97


 Score = 83.6 bits (205),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLFLT+YVSSI FLLVFHV
Sbjct  98   YIAWILVAALYHLPSFQSMGVDLRMNLSLFLTLYVSSILFLLVFHV  143



>emb|CBI19565.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   168 bits (425),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLIQKLD NIKWWSMY CLL
Sbjct  1    MERVRTILTHRYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIQKLDNNIKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTIKPSYSNFSRW  85


 Score = 78.2 bits (191),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WI VAA+YHLPSF SMGVD+RMNLSLFLTIYVSSI FLLVFH+
Sbjct  86   YVAWILVAAIYHLPSFLSMGVDMRMNLSLFLTIYVSSILFLLVFHI  131



>ref|XP_010275607.1| PREDICTED: uncharacterized protein LOC104610601 [Nelumbo nucifera]
Length=1000

 Score =   162 bits (409),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VR ILT  YPYPHEHSRH  IAVVVGCLFFISSDNMHTLIQKLD NIKWWSMY CLL
Sbjct  1    MERVRMILTPAYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIQKLDNNIKWWSMYTCLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTIKPSYSNFSRW  85


 Score = 84.3 bits (207),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YIVWI +AALYHLPSFQSMGVD+RMNLSLFLTIYVSSI FLLVFH+
Sbjct  86   YIVWILIAALYHLPSFQSMGVDMRMNLSLFLTIYVSSILFLLVFHI  131



>ref|XP_010664588.1| PREDICTED: uncharacterized protein LOC100267859 isoform X1 [Vitis 
vinifera]
Length=1004

 Score =   168 bits (425),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLIQKLD NIKWWSMY CLL
Sbjct  1    MERVRTILTHRYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIQKLDNNIKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTIKPSYSNFSRW  85


 Score = 78.2 bits (191),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WI VAA+YHLPSF SMGVD+RMNLSLFLTIYVSSI FLLVFH+
Sbjct  86   YVAWILVAAIYHLPSFLSMGVDMRMNLSLFLTIYVSSILFLLVFHI  131



>gb|EPS68439.1| hypothetical protein M569_06328, partial [Genlisea aurea]
Length=1008

 Score =   170 bits (431),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  373  SDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLD  552
            SD +  G LD L M  VRTILT  YPYPHEHSRH  IAV +GCLFFISSDNMHTLIQKLD
Sbjct  1    SDDRPNGFLDRLKMGTVRTILTPTYPYPHEHSRHAVIAVFIGCLFFISSDNMHTLIQKLD  60

Query  553  TNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            +N+KWWSMY CLLGFFYFFSSPF+GKTI+PSYSNFSRW
Sbjct  61   SNVKWWSMYACLLGFFYFFSSPFVGKTIKPSYSNFSRW  98


 Score = 75.1 bits (183),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSF SMGVDL+MNLSLF++IY SS+ FLLVFHV
Sbjct  99   YISWILVAALYHLPSFLSMGVDLKMNLSLFISIYASSVLFLLVFHV  144



>emb|CDX94143.1| BnaC07g37770D [Brassica napus]
Length=1007

 Score =   176 bits (446),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDK SA  LD L M++VRT+LTH YPYPHEHSRH  IAV++GCLFFISSDNMHTL++K
Sbjct  1    MGSDKHSARFLDKLKMERVRTMLTHTYPYPHEHSRHAMIAVIMGCLFFISSDNMHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD N KWWSMY CLLGFFYFFSSPF+GKTI+PSYS FSRW
Sbjct  61   LDNNFKWWSMYACLLGFFYFFSSPFLGKTIQPSYSTFSRW  100


 Score = 67.8 bits (164),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSS  868
            ++ WI VAALYHLPSFQSMG+DLRMNLSLFLTIY SS
Sbjct  101  HVAWILVAALYHLPSFQSMGLDLRMNLSLFLTIYTSS  137



>ref|NP_001058702.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAC81181.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31941.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20616.1| Os07g0106000 [Oryza sativa Japonica Group]
 dbj|BAG93283.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81383.1| hypothetical protein OsI_24595 [Oryza sativa Indica Group]
 gb|EEE66435.1| hypothetical protein OsJ_22800 [Oryza sativa Japonica Group]
Length=1016

 Score =   170 bits (430),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MGSDKQS   LL TL M+ VRTILTH YPYPHEHSRH+  AV++ CLFFISSDNMHTLI 
Sbjct  1    MGSDKQSGSPLLGTLKMKSVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMHTLIH  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            KLD NIKWWSMY CL+GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  61   KLDNNIKWWSMYVCLIGFFYFFSSPFLGRTIQPSYSNFNRW  101


 Score = 73.6 bits (179),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+ F++ FH+
Sbjct  102  YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSVLFIIAFHI  147



>ref|XP_006434822.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
 gb|ESR48062.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
Length=1004

 Score =   163 bits (413),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH +PYPHEHSRH  IAV+VGCLFFISSDNMHTLI+KLD NIKWWSMY CLL
Sbjct  1    MERVRTILTHTHPYPHEHSRHAIIAVIVGCLFFISSDNMHTLIEKLDNNIKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTITPSYSNFSRW  85


 Score = 78.6 bits (192),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVDLRMNLSLFLTI+++S+ FLLVFH+
Sbjct  86   YIAWILVAAVYHLPSFQSMGVDLRMNLSLFLTIFLASVLFLLVFHI  131



>ref|XP_006434821.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
 gb|ESR48061.1| hypothetical protein CICLE_v10000140mg [Citrus clementina]
Length=829

 Score =   163 bits (412),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH +PYPHEHSRH  IAV+VGCLFFISSDNMHTLI+KLD NIKWWSMY CLL
Sbjct  1    MERVRTILTHTHPYPHEHSRHAIIAVIVGCLFFISSDNMHTLIEKLDNNIKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTITPSYSNFSRW  85


 Score = 78.2 bits (191),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVDLRMNLSLFLTI+++S+ FLLVFH+
Sbjct  86   YIAWILVAAVYHLPSFQSMGVDLRMNLSLFLTIFLASVLFLLVFHI  131



>gb|KCW69186.1| hypothetical protein EUGRSUZ_F02708 [Eucalyptus grandis]
Length=996

 Score =   160 bits (404),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M+++RTILTH YPYPH+HSRH  IAV VGCLFFISSDNMHTL++KL+ NIKWWSMY CLL
Sbjct  1    MERMRTILTHRYPYPHQHSRHAVIAVAVGCLFFISSDNMHTLVEKLEGNIKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTIKPSYSNFSRW  85


 Score = 80.5 bits (197),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLPSFQSMGVDLRMNLSLF TIYVSS+ FL VFH+
Sbjct  86   YIAWILVAALYHLPSFQSMGVDLRMNLSLFFTIYVSSVLFLFVFHI  131



>ref|XP_003557697.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
 ref|XP_010228472.1| PREDICTED: uncharacterized protein LOC100823404 [Brachypodium 
distachyon]
Length=1016

 Score =   165 bits (418),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQ-KVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLI  540
            MGSDKQS   LL TL +  +VRTILTH YPYPHEHSRH+  AV++GCLFFISSDNMHTLI
Sbjct  1    MGSDKQSGSPLLGTLKVGGRVRTILTHTYPYPHEHSRHIMTAVIIGCLFFISSDNMHTLI  60

Query  541  QKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
             KLD NIKWWSMY CL+GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  61   HKLDNNIKWWSMYVCLIGFFYFFSSPFLGRTIQPSYSNFNRW  102


 Score = 74.3 bits (181),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+ F+L FH+
Sbjct  103  YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSVLFILAFHI  148



>ref|XP_010455595.1| PREDICTED: uncharacterized protein LOC104737182 [Camelina sativa]
Length=1013

 Score =   159 bits (402),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SD+ SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMHTLI+K
Sbjct  1    MVSDRHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  61   F--SLKWWSMYACLLGFFYFFSSPFIQKTIRPNYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  144



>ref|XP_010434128.1| PREDICTED: uncharacterized protein LOC104718144 [Camelina sativa]
Length=1013

 Score =   159 bits (402),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SD+ SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMHTLI+K
Sbjct  1    MVSDRHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  61   F--SLKWWSMYACLLGFFYFFSSPFIQKTIRPNYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  144



>ref|XP_010422134.1| PREDICTED: uncharacterized protein LOC104707474 [Camelina sativa]
Length=1013

 Score =   159 bits (402),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SD+ SA L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMHTLI+K
Sbjct  1    MVSDRHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  61   F--SLKWWSMYACLLGFFYFFSSPFIQKTIRPNYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  144



>ref|XP_009128650.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
 ref|XP_009128652.1| PREDICTED: uncharacterized protein LOC103853501 [Brassica rapa]
Length=1013

 Score =   162 bits (409),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MG DK S  LL+TL M++VRTILTH YPYPHEHSRH  IAV +GCLFFISSDNMHTLI+K
Sbjct  1    MGPDKHSTRLLNTLKMERVRTILTHTYPYPHEHSRHAIIAVFLGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KW SMY CLLG FYFFSSPFIGKTIRP+YSNFSRW
Sbjct  61   F--SLKWCSMYACLLGLFYFFSSPFIGKTIRPNYSNFSRW  98


 Score = 77.0 bits (188),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+F SMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFLSMGLDLRMNLSLFLTIYISSIVFLVVFHI  144



>ref|XP_006286984.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
 gb|EOA19882.1| hypothetical protein CARUB_v10000128mg [Capsella rubella]
Length=1013

 Score =   158 bits (399),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SD+ S  L ++L M++VRTILTH YPYPHEHSRH  IAV  GCLFFISSDNMHTLI+K
Sbjct  1    MVSDRHSTRLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVFFGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  61   F--SVKWWSMYACLLGFFYFFSSPFIQKTIRPNYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  144



>ref|XP_002874725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1027

 Score =   157 bits (396),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SD  SA L ++L M++VRTILTH YPYPHEHSRH  IAV+ GCLFFISSDNM TLI+K
Sbjct  1    MVSDGHSARLYNSLPMERVRTILTHTYPYPHEHSRHAIIAVLFGCLFFISSDNMQTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  61   F--SVKWWSMYACLLGFFYFFSSPFIQKTIRPNYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  144



>ref|XP_011074457.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
 ref|XP_011074458.1| PREDICTED: uncharacterized protein LOC105159184 [Sesamum indicum]
Length=1007

 Score =   157 bits (397),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M+ VRTI TH YPYPHEHSRH  IAV++GC+FFISSDNMHTL+ KLD+N+KWWSMY CLL
Sbjct  1    METVRTIFTHTYPYPHEHSRHAVIAVILGCVFFISSDNMHTLVLKLDSNVKWWSMYACLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFIGKTI PSYSNFSRW
Sbjct  61   GFFYFFSSPFIGKTITPSYSNFSRW  85


 Score = 79.7 bits (195),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFH  892
            Y+ WI VAALYHLPSFQSMGVD+RMNLSLFLTI+VSS+ FLLVFH
Sbjct  86   YVAWILVAALYHLPSFQSMGVDMRMNLSLFLTIFVSSVLFLLVFH  130



>ref|XP_008651923.1| PREDICTED: uncharacterized protein LOC103631870 isoform X2 [Zea 
mays]
 ref|XP_008651924.1| PREDICTED: uncharacterized protein LOC103631870 isoform X3 [Zea 
mays]
Length=978

 Score =   168 bits (425),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTL  537
            MGSDKQ      LL+TL M +VRTILTH YPYPHEHSRH+  AV++ CLFFISSDNMHTL
Sbjct  1    MGSDKQIGSPRQLLETLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMHTL  60

Query  538  IQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            I KLD NIKWWSMY CL+GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  61   IHKLDNNIKWWSMYVCLIGFFYFFSSPFLGRTIQPSYSNFNRW  103


 Score = 66.2 bits (160),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI  871
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+
Sbjct  104  YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSV  141



>ref|XP_008651921.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 ref|XP_008651922.1| PREDICTED: uncharacterized protein LOC103631870 isoform X1 [Zea 
mays]
 tpg|DAA59346.1| TPA: hypothetical protein ZEAMMB73_449975 [Zea mays]
Length=1018

 Score =   168 bits (425),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 88/103 (85%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTL  537
            MGSDKQ      LL+TL M +VRTILTH YPYPHEHSRH+  AV++ CLFFISSDNMHTL
Sbjct  1    MGSDKQIGSPRQLLETLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMHTL  60

Query  538  IQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            I KLD NIKWWSMY CL+GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  61   IHKLDNNIKWWSMYVCLIGFFYFFSSPFLGRTIQPSYSNFNRW  103


 Score = 66.2 bits (160),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI  871
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+
Sbjct  104  YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSV  141



>ref|NP_192917.3| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83050.1| calcineurin-like phosphoesterase domain-containing protein [Arabidopsis 
thaliana]
Length=1013

 Score =   153 bits (387),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M S++ SA L ++L M+  RTILTH YPYPHEHSRH  IAV+ GCLFFISSDNM TLI+K
Sbjct  1    MVSERHSARLYNSLPMESFRTILTHTYPYPHEHSRHAIIAVLFGCLFFISSDNMQTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
               ++KWWSMY CLLGFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  61   F--SVKWWSMYACLLGFFYFFSSPFIQKTIRPNYSNFSRW  98


 Score = 80.1 bits (196),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  99   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  144



>ref|XP_002461307.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
 gb|EER97828.1| hypothetical protein SORBIDRAFT_02g000620 [Sorghum bicolor]
Length=1018

 Score =   166 bits (421),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 87/103 (84%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTL  537
            MGSDKQ      LL TL M +VRTILTH YPYPHEHSRH+  AV++ CLFFISSDNMHTL
Sbjct  1    MGSDKQIGSPRPLLGTLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMHTL  60

Query  538  IQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            I KLD NIKWWSMY CL+GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  61   IHKLDNNIKWWSMYVCLIGFFYFFSSPFLGRTIQPSYSNFNRW  103


 Score = 66.2 bits (160),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI  871
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+
Sbjct  104  YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSV  141



>ref|XP_004987257.1| PREDICTED: uncharacterized protein LOC101786352 isoform X1 [Setaria 
italica]
Length=1018

 Score =   166 bits (419),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 86/103 (83%), Gaps = 3/103 (3%)
 Frame = +1

Query  367  MGSDKQSAG---LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTL  537
            MGSDKQ      LL  L M +VRTILTH YPYPHEHSRH+  AV++ CLFFISSDNMHTL
Sbjct  1    MGSDKQGGSPRPLLGNLKMGRVRTILTHTYPYPHEHSRHIMTAVIIACLFFISSDNMHTL  60

Query  538  IQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            I KLD NIKWWSMY CL+GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  61   IHKLDNNIKWWSMYVCLIGFFYFFSSPFLGRTIQPSYSNFNRW  103


 Score = 66.2 bits (160),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSI  871
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+
Sbjct  104  YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSV  141



>ref|XP_006374985.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 ref|XP_006374986.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52782.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
 gb|ERP52783.1| hypothetical protein POPTR_0014s03370g [Populus trichocarpa]
Length=1021

 Score =   189 bits (480),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ+ GLL+TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKQTTGLLETLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            LD NIKWWSMY CLLGFFYFFSSPF+GKTI+PSYSNFSRW +      T    PS  + G
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFLGKTIKPSYSNFSRWYIAWILVATLYHLPSFQSMG  120


 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VA LYHLPSFQSMGVD+RMNLSLFLTI VSSI FLLVFH+
Sbjct  101  YIAWILVATLYHLPSFQSMGVDMRMNLSLFLTISVSSILFLLVFHI  146



>ref|XP_011030451.1| PREDICTED: uncharacterized protein LOC105129897 [Populus euphratica]
Length=1021

 Score =   189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGSDKQ+ GLL+TL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSDKQTTGLLETLRMERVRTILTHTYPYPHEHSRHAIIAVVVGCLFFISSDNMHTLIEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            LD NIKWWSMY CLLGFFYFFSSPF+GKTI+PSYSNFSRW +      T    PS  + G
Sbjct  61   LDNNIKWWSMYACLLGFFYFFSSPFLGKTIKPSYSNFSRWYIAWILVATLYHLPSFQSMG  120


 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VA LYHLPSFQSMGVD+RMNLSLFLTI VSSI FLLVFH+
Sbjct  101  YIAWILVATLYHLPSFQSMGVDMRMNLSLFLTISVSSILFLLVFHI  146



>ref|XP_010684140.1| PREDICTED: uncharacterized protein LOC104898734 [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   145 bits (366),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS+K + GLLDT+ M+  RTIL H YPYPHEHSRH  IAVV+GCLFFIS DNM+T IQ 
Sbjct  1    MGSNKAAVGLLDTIKMESFRTILPHNYPYPHEHSRHAIIAVVLGCLFFISFDNMNTFIQG  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMY CL GFFYFFSSPFIGKTI+PSYSNFS+W
Sbjct  61   LDNNIKWWSMYFCLFGFFYFFSSPFIGKTIKPSYSNFSKW  100


 Score = 79.0 bits (193),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVDLRMNLSLF+TIY+SSI FL VFHV
Sbjct  101  YIGWILVAAVYHLPSFQSMGVDLRMNLSLFITIYMSSILFLFVFHV  146



>gb|EMS47321.1| hypothetical protein TRIUR3_13192 [Triticum urartu]
Length=725

 Score =   152 bits (383),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 1/85 (1%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH  PYPHEHSRH+  AV++GCLFFISSDNMHTLI KLD+NIKWWSMY CL+
Sbjct  1    MERVRTILTHT-PYPHEHSRHIMTAVIIGCLFFISSDNMHTLIHKLDSNIKWWSMYVCLI  59

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPF+G+TI+PSYSNF+RW
Sbjct  60   GFFYFFSSPFLGRTIQPSYSNFNRW  84


 Score = 72.8 bits (177),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+ F+  FH+
Sbjct  85   YVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSVLFITAFHI  130



>emb|CAB44318.1| putative protein [Arabidopsis thaliana]
 emb|CAB78223.1| putative protein [Arabidopsis thaliana]
Length=1012

 Score =   144 bits (362),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 73/85 (86%), Gaps = 2/85 (2%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M+  RTILTH YPYPHEHSRH  IAV+ GCLFFISSDNM TLI+K   ++KWWSMY CLL
Sbjct  1    MESFRTILTHTYPYPHEHSRHAIIAVLFGCLFFISSDNMQTLIEKF--SVKWWSMYACLL  58

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPFI KTIRP+YSNFSRW
Sbjct  59   GFFYFFSSPFIQKTIRPNYSNFSRW  83


 Score = 80.1 bits (196),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  84   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSILFLVVFHI  129



>gb|KEH40050.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=954

 Score =   183 bits (464),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SDKQ AGLLDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MVSDKQPAGLLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMYGCL GFFYFFSSPF+ KTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYGCLFGFFYFFSSPFLVKTIKPSYSNFSRW  100


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = +2

Query  710  LMELMEIAIA*FSFYRYIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVF  889
            L++ ++ + + FS + YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVF
Sbjct  86   LVKTIKPSYSNFSRW-YIGWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYISSIVFLLVF  144

Query  890  HV  895
            H+
Sbjct  145  HI  146



>gb|KEH40051.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1020

 Score =   182 bits (463),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SDKQ AGLLDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  1    MVSDKQPAGLLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  60

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMYGCL GFFYFFSSPF+ KTI+PSYSNFSRW
Sbjct  61   LDNNIKWWSMYGCLFGFFYFFSSPFLVKTIKPSYSNFSRW  100


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = +2

Query  710  LMELMEIAIA*FSFYRYIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVF  889
            L++ ++ + + FS + YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVF
Sbjct  86   LVKTIKPSYSNFSRW-YIGWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYISSIVFLLVF  144

Query  890  HV  895
            H+
Sbjct  145  HI  146



>gb|KEH40052.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=1067

 Score =   182 bits (463),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            M SDKQ AGLLDTL M++VRTILTH YPYPHEHSRH  IAVVVGCLFFISSDN+HTL++K
Sbjct  48   MVSDKQPAGLLDTLKMERVRTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNIHTLVEK  107

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LD NIKWWSMYGCL GFFYFFSSPF+ KTI+PSYSNFSRW
Sbjct  108  LDNNIKWWSMYGCLFGFFYFFSSPFLVKTIKPSYSNFSRW  147


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = +2

Query  710  LMELMEIAIA*FSFYRYIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVF  889
            L++ ++ + + FS + YI WI VAA+YHLPSFQSMGVD+RMNLSLFLTIY+SSI FLLVF
Sbjct  133  LVKTIKPSYSNFSRW-YIGWILVAAVYHLPSFQSMGVDMRMNLSLFLTIYISSIVFLLVF  191

Query  890  HV  895
            H+
Sbjct  192  HI  193



>ref|XP_010936846.1| PREDICTED: uncharacterized protein LOC105056370 [Elaeis guineensis]
Length=1032

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  352  FRAAKMGSDKQSA-GLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNM  528
             +   MG+D+QS+  LLDTL M++V TILTH YPYPHEHSRH+  AVVVGCLFFISSDN+
Sbjct  10   LKGCSMGTDRQSSIPLLDTLKMERVTTILTHTYPYPHEHSRHIMTAVVVGCLFFISSDNI  69

Query  529  HTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFP  708
            HTLIQKLD NIKWWSMY CL+GFFYFFSSPFIGKT +PSYSNF+RW V   F       P
Sbjct  70   HTLIQKLDNNIKWWSMYICLIGFFYFFSSPFIGKTFKPSYSNFNRWYVAWIFVAALYHLP  129

Query  709  SNGTHG  726
            S  + G
Sbjct  130  SFQSMG  135


 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WIFVAALYHLPSFQSMGVD+RMNLSLFLTI+VSS+ FL+VFH+
Sbjct  116  YVAWIFVAALYHLPSFQSMGVDMRMNLSLFLTIFVSSVLFLIVFHI  161



>ref|XP_008799898.1| PREDICTED: uncharacterized protein LOC103714434 isoform X2 [Phoenix 
dactylifera]
Length=984

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG+DKQS+  LLDTL M++V TILTH YPYPHEHSRH+ +AVV GCLFFISSDN+HTLIQ
Sbjct  1    MGTDKQSSSPLLDTLKMERVTTILTHTYPYPHEHSRHIMMAVVAGCLFFISSDNIHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD NIKWWSMY CL+GFFYFFSSPFIGKT +PSYSNF+RW V   F       PS  + 
Sbjct  61   KLDNNIKWWSMYICLIGFFYFFSSPFIGKTFKPSYSNFNRWYVAWIFVAALYHLPSFQSM  120

Query  724  G  726
            G
Sbjct  121  G  121


 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WIFVAALYHLPSFQSMGVD+RMNLSLFLTIYVSS+ FL+VFH+
Sbjct  102  YVAWIFVAALYHLPSFQSMGVDMRMNLSLFLTIYVSSVLFLIVFHI  147



>ref|XP_008799897.1| PREDICTED: uncharacterized protein LOC103714434 isoform X1 [Phoenix 
dactylifera]
Length=1018

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG+DKQS+  LLDTL M++V TILTH YPYPHEHSRH+ +AVV GCLFFISSDN+HTLIQ
Sbjct  1    MGTDKQSSSPLLDTLKMERVTTILTHTYPYPHEHSRHIMMAVVAGCLFFISSDNIHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD NIKWWSMY CL+GFFYFFSSPFIGKT +PSYSNF+RW V   F       PS  + 
Sbjct  61   KLDNNIKWWSMYICLIGFFYFFSSPFIGKTFKPSYSNFNRWYVAWIFVAALYHLPSFQSM  120

Query  724  G  726
            G
Sbjct  121  G  121


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WIFVAALYHLPSFQSMGVD+RMNLSLFLTIYVSS+ FL+VFH+
Sbjct  102  YVAWIFVAALYHLPSFQSMGVDMRMNLSLFLTIYVSSVLFLIVFHI  147



>ref|XP_010044196.1| PREDICTED: uncharacterized protein LOC104433212 isoform X2 [Eucalyptus 
grandis]
Length=926

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 88/99 (89%), Gaps = 3/99 (3%)
 Frame = +1

Query  367  MGSDKQSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQK  546
            MGS++QS GLL TL M   RTILTH YPYPHEHSRH  IAVVVGCLFFISSDNMHTLI+K
Sbjct  1    MGSERQSMGLLGTLRM---RTILTHTYPYPHEHSRHAVIAVVVGCLFFISSDNMHTLIEK  57

Query  547  LDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSR  663
            LD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSR
Sbjct  58   LDKNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSR  96



>ref|XP_008811243.1| PREDICTED: uncharacterized protein LOC103722455 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score =   174 bits (441),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 93/116 (80%), Gaps = 1/116 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            M ++KQS G   DTL M++VRTILTH YPYPHEHSRH   AV+VGCLFFISSDNMHTLIQ
Sbjct  1    MSTNKQSVGPFFDTLKMERVRTILTHTYPYPHEHSRHAMTAVIVGCLFFISSDNMHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPS  711
            KLD NIKWWSMY CL+GFFYFFSSPFI KTI+PSYSNFSRW V   F   +   PS
Sbjct  61   KLDKNIKWWSMYICLIGFFYFFSSPFIRKTIKPSYSNFSRWYVAWIFVAASYHLPS  116


 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WIFVAA YHLPSF SMGVDLRMNLSLF+TIY+SS+ FL VFHV
Sbjct  102  YVAWIFVAASYHLPSFLSMGVDLRMNLSLFITIYISSVLFLTVFHV  147



>ref|XP_010932753.1| PREDICTED: uncharacterized protein LOC105053349 isoform X2 [Elaeis 
guineensis]
Length=904

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG+ KQS G   DTL M++VRTILTH YPYPH+HSRH   AV+VGCLFFISSDNMHTLIQ
Sbjct  1    MGTYKQSVGPFFDTLKMERVRTILTHTYPYPHQHSRHAMTAVIVGCLFFISSDNMHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD NIKWWSMY CL+GFFYFFSSPFI KTI+PSYSNFSRW V   F       PS  + 
Sbjct  61   KLDKNIKWWSMYICLIGFFYFFSSPFIRKTIKPSYSNFSRWYVAWIFVAALYHLPSFQSM  120

Query  724  G  726
            G
Sbjct  121  G  121


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WIFVAALYHLPSFQSMGVDLRMNLSLF+TIY+SS+ FL VFHV
Sbjct  102  YVAWIFVAALYHLPSFQSMGVDLRMNLSLFITIYISSVLFLTVFHV  147



>ref|XP_009392959.1| PREDICTED: uncharacterized protein LOC103978755 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQS-AGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG++KQS + LLDTL M++V TIL   YPYPHEHSRH  +AVVVGCLFFISSDNMHTLIQ
Sbjct  15   MGNNKQSMSPLLDTLKMERVSTILNPAYPYPHEHSRHTIMAVVVGCLFFISSDNMHTLIQ  74

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD+N+KWWSMY CL+GFFYFFSSPFIGKTI+PSYSNFSRW V   F       PS  + 
Sbjct  75   KLDSNVKWWSMYLCLIGFFYFFSSPFIGKTIKPSYSNFSRWYVVWTFVAALYHLPSFQSM  134

Query  724  G  726
            G
Sbjct  135  G  135


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+VW FVAALYHLPSFQSMGVDLRMNLSLFLTIYVSS+ FL  FH+
Sbjct  116  YVVWTFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSVVFLTAFHI  161



>ref|XP_009392951.1| PREDICTED: uncharacterized protein LOC103978755 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1031

 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQS-AGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG++KQS + LLDTL M++V TIL   YPYPHEHSRH  +AVVVGCLFFISSDNMHTLIQ
Sbjct  15   MGNNKQSMSPLLDTLKMERVSTILNPAYPYPHEHSRHTIMAVVVGCLFFISSDNMHTLIQ  74

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD+N+KWWSMY CL+GFFYFFSSPFIGKTI+PSYSNFSRW V   F       PS  + 
Sbjct  75   KLDSNVKWWSMYLCLIGFFYFFSSPFIGKTIKPSYSNFSRWYVVWTFVAALYHLPSFQSM  134

Query  724  G  726
            G
Sbjct  135  G  135


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+VW FVAALYHLPSFQSMGVDLRMNLSLFLTIYVSS+ FL  FH+
Sbjct  116  YVVWTFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSVVFLTAFHI  161



>ref|XP_010932752.1| PREDICTED: uncharacterized protein LOC105053349 isoform X1 [Elaeis 
guineensis]
Length=1015

 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG+ KQS G   DTL M++VRTILTH YPYPH+HSRH   AV+VGCLFFISSDNMHTLIQ
Sbjct  1    MGTYKQSVGPFFDTLKMERVRTILTHTYPYPHQHSRHAMTAVIVGCLFFISSDNMHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD NIKWWSMY CL+GFFYFFSSPFI KTI+PSYSNFSRW V   F       PS  + 
Sbjct  61   KLDKNIKWWSMYICLIGFFYFFSSPFIRKTIKPSYSNFSRWYVAWIFVAALYHLPSFQSM  120

Query  724  G  726
            G
Sbjct  121  G  121


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ WIFVAALYHLPSFQSMGVDLRMNLSLF+TIY+SS+ FL VFHV
Sbjct  102  YVAWIFVAALYHLPSFQSMGVDLRMNLSLFITIYISSVLFLTVFHV  147



>ref|XP_009393277.1| PREDICTED: uncharacterized protein LOC103979011 [Musa acuminata 
subsp. malaccensis]
Length=1017

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            MG +KQS G L DTL M++VRTILTH YPYPHEHSRH   AV+VGCLFFISSDNMHTLIQ
Sbjct  1    MGKNKQSIGPLFDTLRMERVRTILTHTYPYPHEHSRHAMTAVMVGCLFFISSDNMHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD N KWWSMY CL+GFFYFFSSPF+ KTI+PSYSNFSRW +   F       PS  + 
Sbjct  61   KLDKNFKWWSMYFCLIGFFYFFSSPFVRKTIKPSYSNFSRWYIAWIFVAALYHLPSFQSM  120

Query  724  G  726
            G
Sbjct  121  G  121


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIFVAALYHLPSFQSMGVDLRMNLSLFLTIY+SS+ FL+VFH+
Sbjct  102  YIAWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYISSVFFLIVFHI  147



>gb|ERN18128.1| hypothetical protein AMTR_s00054p00046250 [Amborella trichopoda]
Length=1067

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  358  AAKMGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHT  534
              KM + K S G LL+ L M++VRTILT+ YPYPHEHSRH   AV+V CLFFISSDN+HT
Sbjct  46   GGKMLTRKNSRGPLLENLGMERVRTILTYKYPYPHEHSRHAMTAVIVACLFFISSDNLHT  105

Query  535  LIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSN  714
            LIQKLD+N+KWWSMY  L+GFFYFFSSPFI KTI+PSYSNFSRW +   F       PS 
Sbjct  106  LIQKLDSNVKWWSMYIGLVGFFYFFSSPFIRKTIKPSYSNFSRWYIAWIFIAALYHLPSF  165

Query  715  GTHG  726
             + G
Sbjct  166  QSMG  169


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMGVD+RMNLSLFLT+Y+SS+ FL+VFHV
Sbjct  150  YIAWIFIAALYHLPSFQSMGVDMRMNLSLFLTLYLSSVLFLIVFHV  195



>ref|XP_011627911.1| PREDICTED: uncharacterized protein LOC18446479 [Amborella trichopoda]
Length=1019

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 1/121 (1%)
 Frame = +1

Query  367  MGSDKQSAG-LLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQ  543
            M + K S G LL+ L M++VRTILT+ YPYPHEHSRH   AV+V CLFFISSDN+HTLIQ
Sbjct  1    MLTRKNSRGPLLENLGMERVRTILTYKYPYPHEHSRHAMTAVIVACLFFISSDNLHTLIQ  60

Query  544  KLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTH  723
            KLD+N+KWWSMY  L+GFFYFFSSPFI KTI+PSYSNFSRW +   F       PS  + 
Sbjct  61   KLDSNVKWWSMYIGLVGFFYFFSSPFIRKTIKPSYSNFSRWYIAWIFIAALYHLPSFQSM  120

Query  724  G  726
            G
Sbjct  121  G  121


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMGVD+RMNLSLFLT+Y+SS+ FL+VFHV
Sbjct  102  YIAWIFIAALYHLPSFQSMGVDMRMNLSLFLTLYLSSVLFLIVFHV  147



>gb|KHG27254.1| aat [Gossypium arboreum]
Length=1004

 Score =   108 bits (269),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  502  LFFISSDNMHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            L F+SSDNMHTLI+KLD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  13   LSFLSSDNMHTLIEKLDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  67


 Score = 79.3 bits (194),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFL+IY+SSI FLLVFH+
Sbjct  68   YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLSIYLSSILFLLVFHI  113



>gb|KHG27255.1| aat [Gossypium arboreum]
Length=986

 Score =   108 bits (269),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  502  LFFISSDNMHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            L F+SSDNMHTLI+KLD NIKWWSMY CLLGFFYFFSSPFIGKTI+PSYSNFSRW
Sbjct  13   LSFLSSDNMHTLIEKLDNNIKWWSMYACLLGFFYFFSSPFIGKTIKPSYSNFSRW  67


 Score = 79.7 bits (195),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAA+YHLPSFQSMGVD+RMNLSLFL+IY+SSI FLLVFH+
Sbjct  68   YIAWILVAAVYHLPSFQSMGVDMRMNLSLFLSIYLSSILFLLVFHI  113



>ref|XP_006657430.1| PREDICTED: uncharacterized protein LOC102702861 [Oryza brachyantha]
Length=1021

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +1

Query  367  MGSDK----QSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHT  534
            MG +K    +S  L+++L M++VRTILTH YPYPHEHSRHL IAV    LFF+SSDN+ T
Sbjct  1    MGREKLRKQRSGRLIESLKMERVRTILTHRYPYPHEHSRHLMIAVFAIWLFFVSSDNLQT  60

Query  535  LIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSN  714
            LI KLD N KWWSMY CL+GFFYFFSSPFI KTI+PSYSNFSRW +   F       PS 
Sbjct  61   LIMKLDKNFKWWSMYACLIGFFYFFSSPFIRKTIKPSYSNFSRWYIAWIFLAALYHLPSF  120

Query  715  GTHG  726
             + G
Sbjct  121  QSMG  124


 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL+VFHV
Sbjct  105  YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIYISSLIFLIVFHV  150



>ref|XP_001772190.1| predicted protein [Physcomitrella patens]
 gb|EDQ63003.1| predicted protein, partial [Physcomitrella patens]
Length=945

 Score =   120 bits (302),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            + ++ T +T    YPHEHSRH  +AV+   +FFIS+DNMH ++ KLD N KWWS+Y  LL
Sbjct  1    LDRIATAMTDESLYPHEHSRHAMLAVLATTMFFISTDNMHIVLNKLDANSKWWSIYAILL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW  666
            GFFYFFSSPF+G TI+PSYSNFSRW
Sbjct  61   GFFYFFSSPFLGNTIQPSYSNFSRW  85


 Score = 64.7 bits (156),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+VW+ VAA+YHLP+ +SMGVD+RMNLSLFL ++++S+  LL+FHV
Sbjct  86   YVVWLLVAAMYHLPTIRSMGVDVRMNLSLFLILFLASMMTLLLFHV  131



>ref|XP_001765009.1| predicted protein [Physcomitrella patens]
 gb|EDQ70225.1| predicted protein [Physcomitrella patens]
Length=1105

 Score =   113 bits (283),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  409  NMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCL  588
             +++VRT+L H YPYPHEHS+H  IAVV   LFFI SDN+H ++ KLDTNIKWWS+YG L
Sbjct  8    TVRRVRTMLQHEYPYPHEHSQHALIAVVAVALFFIFSDNLHIVLHKLDTNIKWWSIYGFL  67

Query  589  LGFFYFFSSPFIGKTIRPSYSNFSRW  666
            LGFFYFFSSPF+G TI+PSYSNFSRW
Sbjct  68   LGFFYFFSSPFLGSTIQPSYSNFSRW  93


 Score = 71.6 bits (174),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            Y+ W+ +AA+YHLPSFQSMGVD+RMNLSLFLT++V+S+  L++FHV
Sbjct  94   YVGWLLIAAVYHLPSFQSMGVDIRMNLSLFLTLFVASVLVLVLFHV  139



>ref|XP_004956163.1| PREDICTED: uncharacterized protein LOC101776542 [Setaria italica]
Length=1021

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = +1

Query  367  MGSDK----QSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHT  534
            MG +K     S  L+++L M+++R ILTH YPYPHEHSRH  IAV    LFFISSDN+  
Sbjct  1    MGKEKLRKQPSGRLIESLKMERMRNILTHRYPYPHEHSRHFMIAVFACWLFFISSDNLQN  60

Query  535  LIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSN  714
            LI KLD N KWWSMY CL+GFFYFFSSPFI KTI+P+YSNF+RW +   F       PS 
Sbjct  61   LIMKLDKNFKWWSMYACLIGFFYFFSSPFIRKTIKPNYSNFNRWYIAWIFLAALYHLPSF  120

Query  715  GTHG  726
             + G
Sbjct  121  QSMG  124


 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL+VFH+
Sbjct  105  YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIYISSLIFLMVFHI  150



>ref|XP_010238512.1| PREDICTED: uncharacterized protein LOC100842069 isoform X1 [Brachypodium 
distachyon]
Length=1003

 Score =   146 bits (368),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH YPYPHEHSRH  IAV+ G LF ISSDN+  LI KLD N KWWSMY CL+
Sbjct  1    MERVRTILTHRYPYPHEHSRHFMIAVIAGWLFLISSDNLQNLIMKLDKNFKWWSMYACLI  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            GFFYFFSSPFI KTI+P+YSNFSRW +   F       PS  + G
Sbjct  61   GFFYFFSSPFIRKTIKPNYSNFSRWYIAWIFLAALYHLPSFQSMG  105


 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL+VFHV
Sbjct  86   YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIYISSLIFLIVFHV  131



>ref|XP_010238513.1| PREDICTED: uncharacterized protein LOC100842069 isoform X2 [Brachypodium 
distachyon]
Length=1003

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M++VRTILTH YPYPHEHSRH  IAV+ G LF ISSDN+  LI KLD N KWWSMY CL+
Sbjct  1    MERVRTILTHRYPYPHEHSRHFMIAVIAGWLFLISSDNLQNLIMKLDKNFKWWSMYACLI  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            GFFYFFSSPFI KTI+P+YSNFSRW +   F       PS  + G
Sbjct  61   GFFYFFSSPFIRKTIKPNYSNFSRWYIAWIFLAALYHLPSFQSMG  105


 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL+VFHV
Sbjct  86   YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIYISSLIFLIVFHV  131



>ref|XP_008670049.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 ref|XP_008670050.1| PREDICTED: uncharacterized protein LOC103647275 [Zea mays]
 tpg|DAA39653.1| TPA: hypothetical protein ZEAMMB73_888857 [Zea mays]
Length=1041

 Score =   145 bits (366),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = +1

Query  367  MGSDK----QSAGLLDTLNMQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHT  534
            MG +K     S  L+++L M+++R ILTH YPYPHEHSRH  IAV    LFFISSDN+  
Sbjct  1    MGKEKLHKQPSGRLIESLKMERMRNILTHRYPYPHEHSRHFIIAVFACWLFFISSDNLQN  60

Query  535  LIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSN  714
            LI KLD N KWWSMY CL+GFFYFFSSPFI KTI+P+YSNF+RW +   F       PS 
Sbjct  61   LIMKLDKNFKWWSMYACLIGFFYFFSSPFIRKTIKPNYSNFNRWYIAWIFLAALYHLPSF  120

Query  715  GTHG  726
             + G
Sbjct  121  QSMG  124


 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL+VFH+
Sbjct  105  YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIYISSLIFLMVFHI  150



>ref|XP_002461963.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
 gb|EER98484.1| hypothetical protein SORBIDRAFT_02g011280 [Sorghum bicolor]
Length=936

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M+++R ILTH YPYPHEHSRH  IAV    LFFISSDN+  LI KLD N KWWSMY CL+
Sbjct  1    MERMRNILTHRYPYPHEHSRHFIIAVFACWLFFISSDNLQNLIMKLDKNFKWWSMYACLI  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            GFFYFFSSPFI KTI+P+YSNF+RW +   F       PS  + G
Sbjct  61   GFFYFFSSPFIRKTIKPNYSNFNRWYIAWIFLAALYHLPSFQSMG  105


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTI++SS+ FL+VFH+
Sbjct  86   YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIFISSLIFLMVFHI  131



>emb|CDY47423.1| BnaA02g21590D [Brassica napus]
Length=960

 Score = 85.9 bits (211),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 2/47 (4%)
 Frame = +1

Query  526  MHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            MHTLI+K   ++KWWSMY CLLGFFYFFSSPFIGKTIRP+YSNFSRW
Sbjct  1    MHTLIEKF--SLKWWSMYACLLGFFYFFSSPFIGKTIRPNYSNFSRW  45


 Score = 80.9 bits (198),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  46   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSIVFLVVFHI  91



>ref|XP_002963358.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
 gb|EFJ35229.1| hypothetical protein SELMODRAFT_80477 [Selaginella moellendorffii]
Length=999

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M +V+ ILTH Y YPHEHSRH  +AV+ GCLFFIS+DN HTLI + D NIKWWS+Y  LL
Sbjct  1    MDRVKEILTHQYSYPHEHSRHAMLAVLAGCLFFISTDNFHTLIHRFDNNIKWWSIYAFLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            GFFYFFSSPF+ +TI PSYSNF+RW V           PS  + G
Sbjct  61   GFFYFFSSPFLVRTIEPSYSNFNRWYVLWLLVAAVYHLPSFQSMG  105


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  710  LMELMEIAIA*FSFYRYIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVF  889
            L+  +E + + F+ + Y++W+ VAA+YHLPSFQSMGVD+RMNLSLFLT++++S+  L++F
Sbjct  71   LVRTIEPSYSNFNRW-YVLWLLVAAVYHLPSFQSMGVDIRMNLSLFLTLFMASVLILVLF  129

Query  890  HV  895
            H+
Sbjct  130  HI  131



>ref|XP_002974647.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
 gb|EFJ24167.1| hypothetical protein SELMODRAFT_102099 [Selaginella moellendorffii]
Length=999

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +1

Query  412  MQKVRTILTHPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLL  591
            M +V+ ILTH Y YPHEHSRH  +AV+ GCLFFIS+DN HTLI + D NIKWWS+Y  LL
Sbjct  1    MDRVKEILTHQYSYPHEHSRHAMLAVLAGCLFFISTDNFHTLIHRFDNNIKWWSIYAFLL  60

Query  592  GFFYFFSSPFIGKTIRPSYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            GFFYFFSSPF+ +TI PSYSNF+RW V           PS  + G
Sbjct  61   GFFYFFSSPFLVRTIEPSYSNFNRWYVLWLLVAAVYHLPSFQSMG  105


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  710  LMELMEIAIA*FSFYRYIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVF  889
            L+  +E + + F+ + Y++W+ VAA+YHLPSFQSMGVD+RMNLSLFLT++++S+  L++F
Sbjct  71   LVRTIEPSYSNFNRW-YVLWLLVAAVYHLPSFQSMGVDIRMNLSLFLTLFMASVLILVLF  129

Query  890  HV  895
            H+
Sbjct  130  HI  131



>emb|CDX86745.1| BnaA09g21350D [Brassica napus]
Length=960

 Score = 84.0 bits (206),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 2/47 (4%)
 Frame = +1

Query  526  MHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            MHTLI+K   ++KWW MY CLLGFFYFFSSPFIGKTIRP+YSNFSRW
Sbjct  1    MHTLIEKF--SVKWWLMYACLLGFFYFFSSPFIGKTIRPNYSNFSRW  45


 Score = 80.9 bits (198),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI VAALYHLP+FQSMG+DLRMNLSLFLTIY+SSI FL+VFH+
Sbjct  46   YIAWILVAALYHLPNFQSMGLDLRMNLSLFLTIYISSIVFLVVFHI  91



>ref|XP_010044199.1| PREDICTED: uncharacterized protein LOC104433215 [Eucalyptus grandis]
Length=1193

 Score = 76.3 bits (186),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 53/91 (58%), Gaps = 10/91 (11%)
 Frame = +1

Query  397  LDTLNMQKVRTILT-HPYPYPHEHSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWS  573
            +D L + ++ TIL  HP          L + VVVG L  IS D  HTLI+KL   I  WS
Sbjct  1    MDLLRIWRMTTILRRHPM---------LVVIVVVGYLILISPDYGHTLIEKLGKKIDRWS  51

Query  574  MYGCLLGFFYFFSSPFIGKTIRPSYSNFSRW  666
            M  C + F Y+FSSPF G TI PSY NF+RW
Sbjct  52   MQICSVCFLYYFSSPFHGNTIEPSYVNFNRW  82


 Score = 60.5 bits (145),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WI  AALYH P+F+ +  DLRMNL L+L I VSSI  L VFH+
Sbjct  83   YIAWILGAALYHFPTFEPIRADLRMNLFLYLIISVSSILLLTVFHI  128



>ref|XP_010040937.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104429834 
[Eucalyptus grandis]
Length=1187

 Score = 62.4 bits (150),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +1

Query  475  LFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSN  654
            L I  VVGCL  I  DN HT  QKL   I  WSM  C + F Y+F   F G TI P+Y+N
Sbjct  12   LVIIAVVGCLILIFPDNGHT--QKLIEKIDRWSMQACTVYFLYYFLYAFTGNTIGPNYAN  69

Query  655  FSRW  666
            F +W
Sbjct  70   FYKW  73


 Score = 53.1 bits (126),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +2

Query  746  SFYR-YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            +FY+ YI  I  A L+H PSF+ +  DLRM   LF+TI+V SI F+ VFH+
Sbjct  69   NFYKWYIAGILGAGLFHFPSFEPIRADLRMYFFLFMTIFVFSILFVTVFHI  119



>gb|KCW86241.1| hypothetical protein EUGRSUZ_B02927 [Eucalyptus grandis]
Length=1051

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query  463  HSRHLFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRP  642
            HS +  IA VVG L FI  D+MHTL+  L+ +I WWSM+ CLLG F+FFSSP +   I+P
Sbjct  3    HSTYAIIAAVVGSLSFIYWDDMHTLV--LNKSIDWWSMWACLLGIFFFFSSPLVENPIKP  60

Query  643  SYSNFSRW*VFSFFYGTNSVFPSNGTHG  726
            SY NFSRW +      T   FP + + G
Sbjct  61   SYLNFSRWHIAWISVATLYHFPISQSIG  88


 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            +I WI VA LYH P  QS+G DLRMNLSL+LTIY SSI FL  FH+
Sbjct  69   HIAWISVATLYHFPISQSIGADLRMNLSLYLTIYSSSILFLAAFHI  114



>gb|EEC81473.1| hypothetical protein OsI_24798 [Oryza sativa Indica Group]
Length=935

 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  758  YIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            YI WIF+AALYHLPSFQSMG+DLRMNLSLFLTIY+SS+ FL+VFHV
Sbjct  20   YIAWIFLAALYHLPSFQSMGLDLRMNLSLFLTIYISSLIFLIVFHV  65



>gb|EMT21375.1| hypothetical protein F775_01280 [Aegilops tauschii]
Length=661

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  755  RYIVWIFVAALYHLPSFQSMGVDLRMNLSLFLTIYVSSISFLLVFHV  895
             Y+ WI  A+LYHLPSFQSMGVD+RMNLSLFLTIY SS+ F+  FH+
Sbjct  72   EYVAWICFASLYHLPSFQSMGVDMRMNLSLFLTIYFSSVLFITAFHI  118



>gb|KCW44766.1| hypothetical protein EUGRSUZ_L01671 [Eucalyptus grandis]
Length=229

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 37/64 (58%), Gaps = 2/64 (3%)
 Frame = +1

Query  475  LFIAVVVGCLFFISSDNMHTLIQKLDTNIKWWSMYGCLLGFFYFFSSPFIGKTIRPSYSN  654
            L I  VVGCL  I  DN HT  QKL   I  WSM  C + F Y+F   F G TI P+Y+N
Sbjct  12   LVIIAVVGCLILIFPDNGHT--QKLIEKIDRWSMQACTVYFLYYFLYAFTGNTIGPNYAN  69

Query  655  FSRW  666
            F +W
Sbjct  70   FYKW  73



>ref|XP_010664589.1| PREDICTED: uncharacterized protein LOC100267859 isoform X2 [Vitis 
vinifera]
Length=901

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +2

Query  812  MGVDLRMNLSLFLTIYVSSISFLLVFHV  895
            MGVD+RMNLSLFLTIYVSSI FLLVFH+
Sbjct  1    MGVDMRMNLSLFLTIYVSSILFLLVFHI  28



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2059730854950