BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5063

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626420.1|  PREDICTED: epoxide hydrolase 3 isoform X1          268   2e-84   
ref|XP_009775310.1|  PREDICTED: epoxide hydrolase 3 isoform X1          263   3e-82   Nicotiana sylvestris
ref|XP_004246996.1|  PREDICTED: epoxide hydrolase 3 isoform X2          257   3e-80   Solanum lycopersicum
ref|XP_006353829.1|  PREDICTED: uncharacterized protein LOC102586068    256   9e-80   Solanum tuberosum [potatoes]
ref|XP_010326244.1|  PREDICTED: epoxide hydrolase 3 isoform X1          256   1e-79   Solanum lycopersicum
ref|XP_012084566.1|  PREDICTED: epoxide hydrolase 3                     253   1e-78   
emb|CDP03986.1|  unnamed protein product                                251   8e-78   Coffea canephora [robusta coffee]
ref|XP_011080549.1|  PREDICTED: uncharacterized protein LOC105163785    251   1e-77   Sesamum indicum [beniseed]
ref|XP_010258609.1|  PREDICTED: uncharacterized protein LOC104598...    243   9e-76   Nelumbo nucifera [Indian lotus]
gb|EYU46070.1|  hypothetical protein MIMGU_mgv1a008062mg                244   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_010258608.1|  PREDICTED: epoxide hydrolase 3 isoform X1          244   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_008382540.1|  PREDICTED: uncharacterized hydrolase YNR064C       244   6e-75   
ref|XP_009342379.1|  PREDICTED: uncharacterized hydrolase YNR064C...    244   8e-75   Pyrus x bretschneideri [bai li]
ref|XP_009358940.1|  PREDICTED: uncharacterized hydrolase YNR064C...    243   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_002527279.1|  hydrolase, putative                                241   3e-74   Ricinus communis
ref|XP_007199912.1|  hypothetical protein PRUPE_ppa006807mg             239   3e-73   Prunus persica
gb|KHN30854.1|  Haloalkane dehalogenase                                 238   8e-73   Glycine soja [wild soybean]
ref|XP_008235874.1|  PREDICTED: uncharacterized hydrolase YNR064C       238   1e-72   Prunus mume [ume]
ref|XP_011009615.1|  PREDICTED: epoxide hydrolase 3 isoform X2          237   2e-72   Populus euphratica
ref|XP_002320563.2|  hypothetical protein POPTR_0014s17410g             238   2e-72   Populus trichocarpa [western balsam poplar]
emb|CAN81493.1|  hypothetical protein VITISV_019990                     235   2e-72   Vitis vinifera
ref|XP_010645317.1|  PREDICTED: uncharacterized protein LOC100244...    235   2e-72   
ref|XP_003521017.2|  PREDICTED: uncharacterized hydrolase YNR064C       238   3e-72   
ref|XP_011009616.1|  PREDICTED: uncharacterized protein LOC105114...    234   4e-72   Populus euphratica
ref|XP_011009614.1|  PREDICTED: epoxide hydrolase 3 isoform X1          235   1e-71   Populus euphratica
ref|XP_010095591.1|  hypothetical protein L484_007430                   235   2e-71   Morus notabilis
ref|XP_002271124.1|  PREDICTED: epoxide hydrolase 4 isoform X1          234   4e-71   Vitis vinifera
gb|KCW48732.1|  hypothetical protein EUGRSUZ_K02363                     230   6e-71   Eucalyptus grandis [rose gum]
ref|XP_007134311.1|  hypothetical protein PHAVU_010G036500g             233   7e-71   Phaseolus vulgaris [French bean]
emb|CBI23337.3|  unnamed protein product                                233   1e-70   Vitis vinifera
gb|KJB42614.1|  hypothetical protein B456_007G161100                    233   1e-70   Gossypium raimondii
ref|XP_010926737.1|  PREDICTED: epoxide hydrolase 3 isoform X2          230   8e-70   Elaeis guineensis
ref|XP_007049547.1|  Alpha/beta-Hydrolases superfamily protein is...    229   1e-69   
ref|XP_010532928.1|  PREDICTED: uncharacterized hydrolase YNR064C       230   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_010037094.1|  PREDICTED: uncharacterized hydrolase YNR064C       230   2e-69   Eucalyptus grandis [rose gum]
gb|KEH18034.1|  alpha/beta fold hydrolase                               229   2e-69   Medicago truncatula
ref|XP_007049548.1|  Alpha/beta-Hydrolases superfamily protein is...    228   3e-69   
gb|AFK49471.1|  unknown                                                 229   3e-69   Lotus japonicus
gb|KCW48730.1|  hypothetical protein EUGRSUZ_K02363                     229   6e-69   Eucalyptus grandis [rose gum]
ref|XP_007049546.1|  Alpha/beta-Hydrolases superfamily protein is...    228   6e-69   
ref|XP_010678992.1|  PREDICTED: uncharacterized protein LOC104894460    228   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008802246.1|  PREDICTED: epoxide hydrolase 3                     226   3e-68   Phoenix dactylifera
ref|XP_004510184.1|  PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-...    226   5e-68   
ref|XP_004510185.1|  PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-...    226   5e-68   Cicer arietinum [garbanzo]
ref|XP_010926738.1|  PREDICTED: uncharacterized protein LOC105048...    222   3e-67   Elaeis guineensis
ref|XP_009420326.1|  PREDICTED: uncharacterized protein LOC104000...    223   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS68183.1|  hypothetical protein M569_06589                         222   4e-67   Genlisea aurea
ref|XP_010435351.1|  PREDICTED: uncharacterized protein LOC104719184    220   4e-67   
ref|XP_009139658.1|  PREDICTED: uncharacterized hydrolase YNR064C       223   5e-67   Brassica rapa
gb|KEH18035.1|  alpha/beta fold hydrolase                               222   6e-67   Medicago truncatula
ref|XP_006848442.1|  PREDICTED: epoxide hydrolase 3 isoform X1          223   6e-67   Amborella trichopoda
ref|XP_002863288.1|  hydrolase, alpha/beta fold family protein          223   1e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_006414994.1|  hypothetical protein EUTSA_v10025411mg             222   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010926736.1|  PREDICTED: epoxide hydrolase 3 isoform X1          221   3e-66   Elaeis guineensis
emb|CDY60486.1|  BnaC04g55880D                                          220   7e-66   Brassica napus [oilseed rape]
ref|XP_010450251.1|  PREDICTED: uncharacterized hydrolase YNR064C...    220   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004292325.1|  PREDICTED: uncharacterized hydrolase YNR064C...    220   1e-65   Fragaria vesca subsp. vesca
ref|XP_006282646.1|  hypothetical protein CARUB_v10004987mg             220   1e-65   Capsella rubella
emb|CAB41000.1|  hydrolase-like protein                                 217   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420324.1|  PREDICTED: uncharacterized protein LOC104000...    218   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440628.1|  PREDICTED: uncharacterized hydrolase YNR064C...    218   4e-65   Camelina sativa [gold-of-pleasure]
ref|NP_567394.1|  hydrolase, alpha/beta fold family protein             218   9e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61500.1|  hydrolase-like protein                                  217   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|EEC72048.1|  hypothetical protein OsI_04954                          215   2e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_006646615.1|  PREDICTED: epoxide hydrolase 3-like                216   3e-64   
gb|KDO43505.1|  hypothetical protein CISIN_1g015903mg                   214   8e-64   Citrus sinensis [apfelsine]
ref|NP_001045213.1|  Os01g0919700                                       214   1e-63   
gb|KDO43504.1|  hypothetical protein CISIN_1g015903mg                   215   1e-63   Citrus sinensis [apfelsine]
gb|EEE55899.1|  hypothetical protein OsJ_04564                          214   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|KFK35301.1|  hypothetical protein AALP_AA5G266800                    213   3e-63   Arabis alpina [alpine rockcress]
ref|XP_006447950.1|  hypothetical protein CICLE_v10015502mg             213   5e-63   Citrus clementina [clementine]
ref|XP_011624946.1|  PREDICTED: epoxide hydrolase 3 isoform X2          212   7e-63   Amborella trichopoda
ref|XP_009626422.1|  PREDICTED: epoxide hydrolase 3 isoform X2          209   6e-62   Nicotiana tomentosiformis
ref|XP_006469341.1|  PREDICTED: uncharacterized hydrolase YNR064C...    210   7e-62   Citrus sinensis [apfelsine]
ref|XP_009775314.1|  PREDICTED: epoxide hydrolase 3 isoform X2          204   6e-60   Nicotiana sylvestris
ref|XP_011458132.1|  PREDICTED: uncharacterized hydrolase YNR064C...    204   2e-59   Fragaria vesca subsp. vesca
ref|XP_004971072.1|  PREDICTED: uncharacterized protein LOC101762...    201   4e-59   
gb|ACG27604.1|  hydrolase-like protein                                  201   1e-58   Zea mays [maize]
ref|XP_004971071.1|  PREDICTED: uncharacterized protein LOC101762...    200   4e-58   Setaria italica
gb|EMT05833.1|  hypothetical protein F775_06870                         200   1e-57   
ref|XP_003564939.1|  PREDICTED: epoxide hydrolase 3                     197   3e-57   Brachypodium distachyon [annual false brome]
emb|CDM85669.1|  unnamed protein product                                196   6e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EMS59018.1|  hypothetical protein TRIUR3_05973                       199   2e-56   Triticum urartu
ref|XP_001751246.1|  predicted protein                                  180   9e-51   
ref|NP_001132271.2|  uncharacterized protein LOC100193707               171   8e-48   Zea mays [maize]
tpg|DAA56123.1|  TPA: hydrolase-like protein                            170   1e-47   
gb|ACU20429.1|  unknown                                                 157   7e-45   Glycine max [soybeans]
ref|XP_008356682.1|  PREDICTED: uncharacterized protein LOC103420396    150   1e-40   
ref|XP_006414993.1|  hypothetical protein EUTSA_v10025411mg             144   1e-37   
gb|ABK94940.1|  unknown                                                 140   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002983979.1|  hypothetical protein SELMODRAFT_119529             138   4e-35   
ref|XP_002960156.1|  hypothetical protein SELMODRAFT_402209             139   6e-35   
ref|XP_011624947.1|  PREDICTED: uncharacterized protein LOC184381...    135   6e-34   
ref|NP_001054059.1|  Os04g0644600                                     92.4    2e-18   
emb|CAJ86155.1|  H0413E07.8                                           92.4    2e-18   Oryza sativa [red rice]
ref|XP_006652910.1|  PREDICTED: uncharacterized hydrolase YNR064C...  90.5    9e-18   Oryza brachyantha
ref|XP_004135862.2|  PREDICTED: uncharacterized protein LOC101210082  90.5    9e-18   Cucumis sativus [cucumbers]
ref|XP_007135767.1|  hypothetical protein PHAVU_010G157100g           89.7    2e-17   Phaseolus vulgaris [French bean]
ref|XP_007023283.1|  Alpha/beta-Hydrolases superfamily protein is...  89.0    3e-17   
ref|XP_010097191.1|  hypothetical protein L484_025738                 89.0    3e-17   
ref|XP_008461135.1|  PREDICTED: uncharacterized protein LOC103499813  89.0    4e-17   Cucumis melo [Oriental melon]
gb|KJB35128.1|  hypothetical protein B456_006G101700                  87.4    6e-17   Gossypium raimondii
gb|KJB35131.1|  hypothetical protein B456_006G101700                  87.0    8e-17   Gossypium raimondii
dbj|BAD42955.1|  unknown protein                                      85.5    9e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB35127.1|  hypothetical protein B456_006G101700                  87.4    1e-16   Gossypium raimondii
ref|XP_008807054.1|  PREDICTED: uncharacterized hydrolase YNR064C     87.4    1e-16   Phoenix dactylifera
ref|XP_010906730.1|  PREDICTED: uncharacterized hydrolase YNR064C     87.4    1e-16   Elaeis guineensis
gb|KCW53846.1|  hypothetical protein EUGRSUZ_J03079                   86.3    1e-16   Eucalyptus grandis [rose gum]
gb|KFK35798.1|  hypothetical protein AALP_AA4G037800                  86.3    1e-16   Arabis alpina [alpine rockcress]
gb|KHN01316.1|  Haloalkane dehalogenase                               85.9    2e-16   Glycine soja [wild soybean]
emb|CDO98174.1|  unnamed protein product                              87.0    2e-16   Coffea canephora [robusta coffee]
dbj|BAD44400.1|  unknown protein                                      87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KCW53845.1|  hypothetical protein EUGRSUZ_J03079                   85.9    2e-16   Eucalyptus grandis [rose gum]
ref|NP_001031176.1|  putative hydrolase                               85.9    2e-16   
ref|XP_009144839.1|  PREDICTED: uncharacterized protein LOC103868501  86.7    2e-16   Brassica rapa
emb|CDX87912.1|  BnaC06g09740D                                        86.7    2e-16   
gb|AAD55611.1|AC008016_21  Contains PF|00561 alpha/beta hydrolase...  86.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175660.2|  putative hydrolase                                  86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37999.1|  Haloalkane dehalogenase                               85.1    2e-16   Glycine soja [wild soybean]
ref|XP_003528305.1|  PREDICTED: uncharacterized hydrolase YNR064C...  86.3    3e-16   Glycine max [soybeans]
ref|XP_010250215.1|  PREDICTED: uncharacterized protein LOC104592505  86.3    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_003604363.1|  Haloalkane dehalogenase                          85.1    3e-16   
ref|XP_010033976.1|  PREDICTED: uncharacterized protein LOC104423192  86.3    3e-16   Eucalyptus grandis [rose gum]
ref|XP_003531724.1|  PREDICTED: uncharacterized hydrolase YNR064C...  85.5    4e-16   Glycine max [soybeans]
ref|XP_004506957.1|  PREDICTED: haloalkane dehalogenase-like isof...  85.1    4e-16   
gb|ACJ83315.1|  unknown                                               84.0    5e-16   Medicago truncatula
gb|AFK40709.1|  unknown                                               83.6    5e-16   Medicago truncatula
gb|AFK39749.1|  unknown                                               84.3    6e-16   Lotus japonicus
ref|XP_004506956.1|  PREDICTED: haloalkane dehalogenase-like isof...  85.1    7e-16   Cicer arietinum [garbanzo]
ref|XP_010500850.1|  PREDICTED: uncharacterized hydrolase YNR064C...  85.1    7e-16   Camelina sativa [gold-of-pleasure]
gb|AES86560.2|  alpha/beta fold hydrolase                             85.1    7e-16   Medicago truncatula
ref|XP_006392914.1|  hypothetical protein EUTSA_v10011571mg           85.1    8e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002894382.1|  hydrolase, alpha/beta fold family protein        84.7    9e-16   
ref|XP_010545744.1|  PREDICTED: uncharacterized protein LOC104818013  84.7    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_002448631.1|  hypothetical protein SORBIDRAFT_06g030510        83.6    1e-15   
ref|XP_002517672.1|  hydrolase, putative                              84.3    1e-15   Ricinus communis
ref|XP_010462087.1|  PREDICTED: uncharacterized protein LOC104742750  84.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004241692.1|  PREDICTED: uncharacterized protein LOC101262019  84.0    2e-15   Solanum lycopersicum
ref|XP_006356226.1|  PREDICTED: uncharacterized protein LOC102600388  84.0    2e-15   Solanum tuberosum [potatoes]
ref|XP_002299933.2|  hypothetical protein POPTR_0001s20870g           84.0    2e-15   Populus trichocarpa [western balsam poplar]
gb|EPS67727.1|  hypothetical protein M569_07047                       82.0    2e-15   Genlisea aurea
ref|XP_010479758.1|  PREDICTED: uncharacterized protein LOC104758569  84.0    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007215833.1|  hypothetical protein PRUPE_ppa010168mg           82.4    2e-15   
gb|ACN34535.1|  unknown                                               84.0    2e-15   Zea mays [maize]
ref|XP_011007692.1|  PREDICTED: uncharacterized protein LOC105113285  83.6    2e-15   Populus euphratica
ref|XP_012073134.1|  PREDICTED: uncharacterized hydrolase YNR064C...  83.6    2e-15   Jatropha curcas
ref|XP_011073395.1|  PREDICTED: uncharacterized protein LOC105158360  83.6    2e-15   Sesamum indicum [beniseed]
ref|XP_012073133.1|  PREDICTED: uncharacterized hydrolase YNR064C...  83.6    2e-15   Jatropha curcas
ref|XP_004977019.1|  PREDICTED: uncharacterized hydrolase YNR064C...  84.0    3e-15   Setaria italica
ref|XP_003580670.1|  PREDICTED: uncharacterized hydrolase YNR064C     83.2    4e-15   Brachypodium distachyon [annual false brome]
ref|XP_004303285.1|  PREDICTED: abhydrolase domain-containing pro...  82.8    5e-15   Fragaria vesca subsp. vesca
ref|XP_006856536.1|  PREDICTED: abhydrolase domain-containing pro...  82.4    6e-15   Amborella trichopoda
ref|XP_009592214.1|  PREDICTED: uncharacterized protein LOC104089100  82.4    7e-15   Nicotiana tomentosiformis
gb|EYU21671.1|  hypothetical protein MIMGU_mgv11b007012mg             82.0    8e-15   Erythranthe guttata [common monkey flower]
ref|XP_006305087.1|  hypothetical protein CARUB_v10009454mg           81.6    1e-14   Capsella rubella
ref|XP_001757240.1|  predicted protein                                81.6    1e-14   
ref|XP_009786840.1|  PREDICTED: uncharacterized protein LOC104234896  81.3    2e-14   Nicotiana sylvestris
ref|XP_010691107.1|  PREDICTED: uncharacterized protein LOC104904536  80.1    4e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008228721.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  80.1    5e-14   Prunus mume [ume]
gb|AFW59648.1|  hypothetical protein ZEAMMB73_032229                  76.6    1e-13   
dbj|BAJ92131.1|  predicted protein                                    79.0    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO41243.1|  hypothetical protein CISIN_1g022534mg                 76.6    3e-13   Citrus sinensis [apfelsine]
gb|EMT19510.1|  hypothetical protein F775_09244                       77.8    4e-13   
ref|XP_006492082.1|  PREDICTED: uncharacterized hydrolase YNR064C...  77.0    7e-13   Citrus sinensis [apfelsine]
gb|ACR34580.1|  unknown                                               74.7    7e-13   Zea mays [maize]
emb|CBI36362.3|  unnamed protein product                              75.1    3e-12   Vitis vinifera
ref|XP_002263706.2|  PREDICTED: uncharacterized protein LOC100250971  74.7    3e-12   Vitis vinifera
ref|XP_002989699.1|  hypothetical protein SELMODRAFT_235851           73.2    7e-12   
ref|XP_009336311.1|  PREDICTED: uncharacterized protein LOC103928918  73.6    9e-12   Pyrus x bretschneideri [bai li]
ref|WP_003929445.1|  alpha/beta hydrolase                             72.0    1e-11   Mycolicibacterium vaccae
ref|WP_026257239.1|  alpha/beta hydrolase                             71.6    2e-11   Actinopolymorpha alba
ref|WP_040513584.1|  alpha/beta hydrolase                             71.6    2e-11   
dbj|GAA69295.1|  alpha/beta hydrolase fold precursor                  71.2    3e-11   Pseudoalteromonas sp. BSi20429
dbj|GAC31027.1|  hypothetical protein GPLA_0106                       71.2    3e-11   Paraglaciecola polaris LMG 21857
ref|WP_010554489.1|  MULTISPECIES: alpha/beta hydrolase               71.2    4e-11   Pseudoalteromonas
ref|XP_002991782.1|  hypothetical protein SELMODRAFT_134090           70.9    4e-11   
ref|WP_036365440.1|  alpha/beta hydrolase                             70.1    5e-11   Mycobacterium asiaticum
ref|WP_024612816.1|  alpha/beta hydrolase                             70.5    7e-11   Pseudoalteromonas sp. TB64
ref|WP_019861488.1|  hydrolase                                        69.7    8e-11   
ref|WP_035641833.1|  hydrolase                                        69.3    9e-11   
ref|WP_024600260.1|  alpha/beta hydrolase                             70.1    1e-10   Pseudoalteromonas sp. TAE56
ref|WP_035356644.1|  alpha/beta hydrolase                             68.6    1e-10   Edaphobacter aggregans
ref|WP_024608243.1|  alpha/beta hydrolase                             69.3    2e-10   Pseudoalteromonas sp. TAB23
ref|WP_039988767.1|  alpha/beta hydrolase                             69.3    2e-10   
ref|WP_036786596.1|  hypothetical protein                             68.6    2e-10   Polaribacter sp. Hel1_33_49
dbj|GAC17888.1|  alpha/beta hydrolase fold protein                    69.3    2e-10   Paraglaciecola arctica BSs20135
gb|KGL61066.1|  alpha/beta hydrolase                                  68.6    2e-10   Polaribacter sp. Hel1_33_49
ref|WP_035160260.1|  alpha/beta hydrolase                             68.6    2e-10   
ref|WP_044007567.1|  hypothetical protein                             68.2    2e-10   
ref|WP_045227390.1|  alpha/beta hydrolase                             68.6    3e-10   
gb|ABD55542.1|  alpha/beta hydrolase                                  68.6    3e-10   Jannaschia sp. CCS1
ref|WP_002961150.1|  alpha/beta hydrolase                             68.6    3e-10   Pseudoalteromonas distincta
ref|WP_039489797.1|  MULTISPECIES: alpha/beta hydrolase               68.6    3e-10   Pseudoalteromonas distincta
ref|WP_019494557.1|  hydrolase                                        67.8    3e-10   Calothrix sp. PCC 7103
ref|WP_003891450.1|  alpha/beta hydrolase fold protein                67.8    4e-10   Mycolicibacterium smegmatis
ref|WP_030904260.1|  alpha/beta hydrolase                             67.8    4e-10   Streptomyces sp. NRRL F-5126
ref|WP_020536171.1|  hypothetical protein                             67.8    4e-10   Lewinella cohaerens
ref|WP_035153850.1|  hydrolase                                        67.8    4e-10   Calothrix sp. 336/3
ref|WP_034696482.1|  hydrolase                                        67.8    4e-10   Chryseobacterium sp. CF365
ref|WP_034751257.1|  hypothetical protein                             67.8    4e-10   
ref|WP_011142803.1|  hypothetical protein                             67.8    4e-10   Gloeobacter violaceus
emb|CDI12216.1|  fragment of putative alpha/beta-Hydrolases super...  64.3    5e-10   Rhizobium sp. IRBG74
ref|WP_023758537.1|  hydrolase                                        67.4    5e-10   Mesorhizobium sp. LNHC252B00
ref|WP_024592380.1|  alpha/beta hydrolase                             67.8    5e-10   Pseudoalteromonas sp. TB13
ref|WP_012783485.1|  alpha/beta hydrolase                             67.4    6e-10   Actinosynnema mirum
ref|WP_029464904.1|  hypothetical protein                             67.4    6e-10   
ref|WP_035351445.1|  alpha/beta hydrolase                             67.0    7e-10   Edaphobacter aggregans
ref|WP_015141568.1|  alpha/beta hydrolase                             67.0    7e-10   Nostoc sp. PCC 7524
gb|KFY10029.1|  hypothetical protein V491_07836                       66.6    9e-10   Pseudogymnoascus sp. VKM F-3775
ref|WP_030445674.1|  alpha/beta hydrolase                             66.6    1e-09   Actinocatenispora sera
ref|WP_008263890.1|  alpha/beta hydrolase fold protein                66.6    1e-09   Mycobacterium sp. H4Y
ref|WP_017309612.1|  MULTISPECIES: hydrolase                          66.2    1e-09   Hapalosiphonaceae
gb|KIW71668.1|  hypothetical protein PV04_03807                       66.2    1e-09   Phialophora americana
ref|WP_012921080.1|  hydrolase                                        66.2    1e-09   Kribbella flavida
ref|WP_033343119.1|  alpha/beta hydrolase                             66.2    1e-09   Catenuloplanes japonicus
ref|WP_020716171.1|  hypothetical protein                             66.2    1e-09   Acidobacteriaceae bacterium KBS 89
ref|WP_020563565.1|  hypothetical protein                             66.2    2e-09   Methylosarcina fibrata
ref|WP_040573189.1|  alpha/beta hydrolase                             66.2    2e-09   
ref|WP_007166357.1|  alpha/beta hydrolase                             65.9    2e-09   Mycobacterium
ref|WP_021592560.1|  hypothetical protein                             65.9    2e-09   Actinomadura madurae
ref|WP_034848205.1|  hydrolase                                        65.9    2e-09   
gb|KFY27996.1|  hypothetical protein V493_03163                       65.9    2e-09   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
emb|CKG84785.1|  alpha/beta hydrolase fold protein                    65.5    2e-09   Mycolicibacterium smegmatis
ref|WP_012250781.1|  hydrolase                                        65.5    2e-09   Bordetella petrii
ref|WP_011726677.1|  hydrolase                                        65.5    3e-09   Mycolicibacterium smegmatis
ref|WP_039851703.1|  hydrolase                                        65.5    3e-09   
ref|WP_042910654.1|  alpha/beta hydrolase                             65.5    3e-09   Mycobacterium avium complex (MAC)
ref|WP_034762421.1|  hydrolase                                        65.1    3e-09   
ref|WP_045055854.1|  hydrolase                                        65.1    3e-09   Aliterella atlantica
gb|EKJ95143.1|  alpha/beta hydrolase fold protein                     65.5    3e-09   Bradyrhizobium lupini HPC(L)
gb|EHO11930.1|  hypothetical protein HMPREF9712_00177                 65.5    3e-09   Myroides odoratimimus CCUG 10230
gb|KIW48116.1|  hypothetical protein PV06_00735                       65.1    4e-09   Exophiala oligosperma
ref|WP_035451424.1|  hydrolase                                        65.1    4e-09   Lactobacillus composti
ref|WP_009951924.1|  MULTISPECIES: alpha/beta hydrolase               65.1    4e-09   Mycobacterium
ref|WP_020821568.1|  alpha/beta hydrolase fold protein                64.7    4e-09   Mycobacterium avium complex (MAC)
ref|WP_024441819.1|  alpha/beta hydrolase                             64.7    4e-09   Mycobacterium
ref|WP_032789500.1|  alpha/beta hydrolase                             64.7    5e-09   Streptomyces
ref|WP_036396872.1|  alpha/beta hydrolase                             64.7    5e-09   Mycolicibacterium cosmeticum
ref|WP_035689835.1|  hydrolase                                        64.7    5e-09   
ref|WP_024450885.1|  alpha/beta hydrolase                             64.7    5e-09   Mycobacterium
ref|WP_029111689.1|  alpha/beta hydrolase                             64.7    5e-09   Mycobacterium sp. URHD0025
ref|WP_016863530.1|  hydrolase                                        64.7    5e-09   Fischerella muscicola
ref|WP_014379096.1|  alpha/beta hydrolase                             64.7    5e-09   Mycobacterium intracellulare
ref|WP_042936317.1|  hydrolase                                        64.7    5e-09   
ref|WP_039330420.1|  hydrolase                                        64.7    5e-09   Myroides
dbj|GAO01748.1|  putative hydrolase YNR064C                           64.7    5e-09   Anaeromyxobacter sp. PSR-1
ref|WP_036454597.1|  alpha/beta hydrolase                             64.7    5e-09   Mycobacterium
emb|CCD34864.1|  similar to alpha/beta hydrolase                      62.8    6e-09   Botrytis cinerea T4
ref|WP_026442337.1|  hypothetical protein                             64.7    6e-09   Acidobacterium ailaaui
ref|WP_020013448.1|  hypothetical protein                             64.7    6e-09   Promicromonospora sukumoe
ref|WP_036531370.1|  hydrolase                                        64.3    6e-09   Neosynechococcus sphagnicola
ref|WP_037505632.1|  hydrolase                                        64.3    6e-09   
ref|WP_020718960.1|  hypothetical protein                             64.7    6e-09   Acidobacteriaceae bacterium KBS 96
gb|AJA69353.1|  putative hydrolase or acyltransferase (alpha/beta...  64.7    6e-09   Myroides sp. A21
ref|WP_017300675.1|  hypothetical protein                             64.3    7e-09   Nodosilinea nodulosa
gb|EDM43982.1|  putative alpha/beta hydrolase protein                 64.7    7e-09   unidentified eubacterium SCB49
gb|KFY88372.1|  hypothetical protein V500_06371                       64.3    7e-09   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|WP_020509002.1|  alpha/beta hydrolase                             64.3    7e-09   Actinoplanes globisporus
ref|WP_036471628.1|  alpha/beta hydrolase                             64.3    7e-09   Mycobacterium triplex
gb|KIW56736.1|  hypothetical protein PV05_05372                       64.3    7e-09   Exophiala xenobiotica
ref|WP_036261810.1|  alpha/beta hydrolase                             64.7    7e-09   Methylocapsa aurea
ref|WP_045535304.1|  hydrolase                                        64.3    7e-09   
ref|WP_044514476.1|  alpha/beta hydrolase                             64.3    8e-09   Mycolicibacterium septicum
ref|WP_026940717.1|  alpha/beta hydrolase                             64.3    8e-09   
gb|KFZ23053.1|  hypothetical protein V502_02463                       63.9    8e-09   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|WP_030719891.1|  alpha/beta hydrolase                             63.9    9e-09   Streptomyces
ref|WP_008992220.1|  hydrolase                                        63.9    9e-09   Galbibacter marinus
ref|WP_041991874.1|  alpha/beta hydrolase                             63.9    9e-09   Streptomyces sp. AcH 505
ref|WP_006196536.1|  hydrolase                                        63.9    1e-08   Nodularia spumigena
gb|ESZ92522.1|  hypothetical protein SBOR_7094                        63.9    1e-08   Sclerotinia borealis F-4128
ref|WP_010636424.1|  alpha/beta hydrolase                             63.9    1e-08   
ref|WP_013807825.1|  hydrolase                                        63.9    1e-08   Hoyosella subflava
ref|WP_038331165.1|  hydrolase                                        63.5    1e-08   
ref|WP_012642615.1|  haloalkane dehalogenase 1                        63.9    1e-08   Thermomicrobium roseum
ref|WP_007535352.1|  alpha/beta hydrolase                             63.9    1e-08   Rhizobium mesoamericanum
ref|WP_032808130.1|  hydrolase                                        63.5    1e-08   Oenococcus oeni
gb|KIX94257.1|  hypothetical protein Z520_09967                       63.5    1e-08   Fonsecaea multimorphosa CBS 102226
ref|WP_032809742.1|  hydrolase                                        63.5    1e-08   Oenococcus oeni
gb|KFY81011.1|  hypothetical protein V499_00205                       63.5    1e-08   Pseudogymnoascus sp. VKM F-103
ref|XP_008727328.1|  hypothetical protein G647_04769                  63.5    1e-08   
ref|WP_002824499.1|  alpha/beta hydrolase                             63.5    1e-08   
ref|WP_036154673.1|  alpha/beta hydrolase                             63.9    1e-08   
ref|WP_026928179.1|  alpha/beta hydrolase                             63.5    1e-08   
ref|WP_016876323.1|  hydrolase                                        63.5    1e-08   
ref|WP_002825679.1|  alpha/beta hydrolase                             63.5    1e-08   
ref|WP_030125082.1|  alpha/beta hydrolase [                           63.5    1e-08   
ref|WP_015580160.1|  MULTISPECIES: putative hydrolase                 63.5    2e-08   
ref|WP_026734056.1|  hydrolase                                        63.2    2e-08   
ref|WP_014152326.1|  alpha/beta hydrolase                             63.2    2e-08   
ref|WP_006244765.1|  alpha/beta hydrolase                             63.2    2e-08   
ref|WP_030638565.1|  alpha/beta hydrolase                             63.2    2e-08   
ref|WP_035675121.1|  alpha/beta hydrolase                             63.5    2e-08   
ref|XP_007755814.1|  hypothetical protein A1O7_03605                  63.2    2e-08   
ref|WP_036006436.1|  hydrolase                                        63.2    2e-08   
ref|WP_041008396.1|  hydrolase                                        63.2    2e-08   
emb|CDX37006.1|  Alpha/beta hydrolase fold protein                    63.2    2e-08   
ref|WP_040986265.1|  hydrolase                                        63.2    2e-08   
ref|WP_041002132.1|  hydrolase                                        63.2    2e-08   
emb|CDX16719.1|  Alpha/beta hydrolase fold protein                    63.2    2e-08   
emb|CDX50599.1|  Alpha/beta hydrolase fold protein                    63.2    2e-08   
ref|WP_015115701.1|  alpha/beta fold family hydrolase                 63.2    2e-08   
ref|WP_007913794.1|  haloalkane dehalogenase                          63.2    2e-08   
ref|WP_013472612.1|  alpha/beta hydrolase                             63.2    2e-08   
ref|WP_011895681.1|  alpha/beta hydrolase                             63.2    2e-08   
ref|WP_026722226.1|  hydrolase                                        62.8    2e-08   
ref|WP_034795614.1|  hydrolase                                        63.2    2e-08   
ref|WP_019737664.1|  hypothetical protein                             62.8    2e-08   
ref|XP_001547307.1|  hypothetical protein BC1G_14080                  62.8    2e-08   
ref|WP_042562855.1|  hydrolase                                        62.8    2e-08   
ref|WP_007181460.1|  alpha/beta hydrolase                             63.5    2e-08   
ref|WP_037829309.1|  alpha/beta hydrolase                             62.8    2e-08   
ref|WP_033249741.1|  MULTISPECIES: alpha/beta hydrolase               62.8    2e-08   
ref|XP_007738899.1|  haloalkane dehalogenase                          62.8    2e-08   
ref|WP_007923091.1|  alpha/beta hydrolase                             62.8    2e-08   
ref|WP_044508493.1|  alpha/beta hydrolase                             62.8    3e-08   
ref|XP_004510274.1|  PREDICTED: uncharacterized protein LOC101500281  61.6    3e-08   
ref|WP_032749857.1|  alpha/beta hydrolase                             62.8    3e-08   
ref|WP_034499484.1|  hydrolase                                        62.4    3e-08   
ref|WP_032778507.1|  hypothetical protein                             62.8    3e-08   
ref|WP_035258987.1|  hydrolase                                        62.8    3e-08   
ref|WP_012411522.1|  hydrolase                                        62.4    3e-08   
ref|WP_032750531.1|  alpha/beta hydrolase                             62.4    3e-08   
ref|WP_032792167.1|  alpha/beta hydrolase                             62.4    3e-08   
ref|WP_032751753.1|  alpha/beta hydrolase                             62.4    3e-08   
ref|WP_011321688.1|  hydrolase                                        62.4    3e-08   
gb|KIX92775.1|  hypothetical protein Z520_11438                       62.8    3e-08   
ref|WP_029368830.1|  alpha/beta hydrolase                             62.4    3e-08   
ref|WP_045755486.1|  hydrolase                                        62.4    3e-08   
ref|WP_036432275.1|  alpha/beta hydrolase                             62.4    3e-08   
ref|WP_042197361.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_032748355.1|  MULTISPECIES: alpha/beta hydrolase               62.4    4e-08   
ref|WP_022723627.1|  alpha/beta hydrolase                             62.8    4e-08   
ref|WP_044579153.1|  alpha/beta hydrolase                             62.4    4e-08   
gb|KIJ23934.1|  hypothetical protein M422DRAFT_237603                 61.2    4e-08   
ref|WP_025659652.1|  alpha/beta hydrolase                             62.8    4e-08   
gb|KFZ06703.1|  hypothetical protein V501_07154                       62.4    4e-08   
ref|WP_039326780.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_016556313.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|XP_001751476.1|  predicted protein                                62.4    4e-08   
ref|WP_032391323.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_039144068.1|  hypothetical protein                             62.0    4e-08   
ref|WP_032364509.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_027494417.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_028580257.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_032369354.1|  alpha/beta hydrolase                             62.4    4e-08   
ref|WP_032770196.1|  MULTISPECIES: alpha/beta hydrolase               62.0    4e-08   
ref|WP_042499888.1|  hydrolase                                        62.0    4e-08   
ref|WP_046084618.1|  alpha/beta hydrolase                             62.0    4e-08   
ref|WP_037442436.1|  hydrolase                                        62.0    4e-08   
ref|XP_001589815.1|  hypothetical protein SS1G_09537                  62.0    4e-08   
ref|WP_013579115.1|  hydrolase                                        62.0    5e-08   
emb|CDS95387.1|  putative enzyme                                      62.4    5e-08   
ref|WP_030630341.1|  alpha/beta hydrolase                             62.0    5e-08   
ref|WP_014814487.1|  alpha/beta hydrolase                             62.0    5e-08   
ref|WP_028402289.1|  hydrolase                                        62.0    5e-08   
dbj|GAF56560.1|  LOW QUALITY PROTEIN: hydrolase protein               62.4    5e-08   
ref|WP_013058310.1|  hydrolase                                        62.0    5e-08   
gb|KIW75439.1|  hypothetical protein Z517_10180                       62.0    5e-08   
ref|WP_020726683.1|  putative hydrolase                               62.0    5e-08   
ref|WP_032746613.1|  MULTISPECIES: alpha/beta hydrolase               62.0    5e-08   
dbj|GAL81479.1|  alpha/beta hydrolase fold precursor                  62.4    5e-08   
gb|KEQ29365.1|  hydrolase                                             62.0    5e-08   
ref|WP_011089805.1|  MULTISPECIES: alpha/beta hydrolase               62.4    5e-08   
ref|WP_029323414.1|  hydrolase                                        62.0    5e-08   
ref|WP_015198753.1|  alpha/beta fold family hydrolase                 62.0    5e-08   
ref|XP_008554616.1|  PREDICTED: epoxide hydrolase 4-like isoform X2   62.4    5e-08   
ref|XP_008554615.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   62.4    5e-08   
gb|KEF61423.1|  hypothetical protein A1O9_02989                       62.0    5e-08   
ref|WP_028926222.1|  alpha/beta hydrolase                             62.0    5e-08   
gb|EMR90018.1|  putative hydrolase or acyltransferase of alpha be...  62.0    5e-08   
ref|WP_012137950.1|  mesoderm specific transcript isoform b isofo...  62.0    6e-08   
ref|WP_044487418.1|  alpha/beta hydrolase                             61.6    6e-08   
ref|WP_010995525.1|  hydrolase                                        61.6    6e-08   
ref|WP_036443840.1|  alpha/beta hydrolase                             61.6    6e-08   
ref|WP_037266551.1|  alpha/beta hydrolase                             61.6    6e-08   
ref|WP_006141809.1|  alpha/beta hydrolase                             61.6    6e-08   
gb|KEI42598.1|  hypothetical protein L969DRAFT_161111                 62.0    6e-08   
ref|WP_007772628.1|  alpha/beta hydrolase                             61.6    6e-08   
ref|WP_032386041.1|  alpha/beta hydrolase                             61.6    6e-08   
ref|WP_007370295.1|  hydrolase                                        61.6    6e-08   
ref|WP_041190103.1|  short-chain dehydrogenase                        62.4    7e-08   
ref|WP_043406282.1|  alpha/beta hydrolase                             61.6    7e-08   
gb|KIM78490.1|  hypothetical protein PILCRDRAFT_824394                61.6    7e-08   
ref|WP_026366003.1|  alpha/beta hydrolase                             61.6    7e-08   
ref|WP_015142537.1|  alpha/beta hydrolase                             61.2    7e-08   
gb|KIW98427.1|  hypothetical protein Z519_00087                       61.2    8e-08   
ref|WP_038767648.1|  short-chain dehydrogenase                        62.0    8e-08   
ref|WP_040993863.1|  hydrolase                                        61.2    8e-08   
ref|WP_031295112.1|  alpha/beta hydrolase                             61.6    8e-08   
ref|WP_035230392.1|  alpha/beta hydrolase                             61.2    9e-08   
ref|WP_032373833.1|  alpha/beta hydrolase                             61.2    9e-08   
ref|WP_022723625.1|  alpha/beta hydrolase                             61.2    9e-08   
ref|WP_013991620.1|  hydrolase                                        61.2    9e-08   
gb|KIJ47792.1|  hypothetical protein M422DRAFT_226138                 61.2    9e-08   
ref|WP_018455652.1|  hydrolase                                        61.2    9e-08   
ref|WP_044222698.1|  hypothetical protein                             61.2    9e-08   
ref|WP_028109424.1|  hypothetical protein                             61.2    9e-08   
ref|WP_030082495.1|  alpha/beta hydrolase                             61.2    9e-08   
ref|WP_023362683.1|  alpha/beta hydrolase fold protein                61.2    1e-07   
ref|WP_040850569.1|  alpha/beta hydrolase                             60.8    1e-07   
gb|KFY49475.1|  hypothetical protein V496_09991                       60.8    1e-07   
gb|EZP44078.1|  Haloalkane dehalogenase                               61.2    1e-07   
ref|WP_030106849.1|  alpha/beta hydrolase                             60.8    1e-07   
ref|WP_042505712.1|  hydrolase                                        61.2    1e-07   
ref|WP_029637501.1|  hydrolase [                                      60.8    1e-07   
ref|WP_002644061.1|  alpha/beta hydrolase                             61.2    1e-07   
ref|WP_018565759.1|  MULTISPECIES: alpha/beta hydrolase               60.8    1e-07   
gb|EPJ37818.1|  putative hydrolase                                    60.5    1e-07   
ref|WP_028040542.1|  alpha/beta hydrolase                             60.8    1e-07   
ref|WP_030742985.1|  alpha/beta hydrolase                             60.8    1e-07   
gb|KFY94554.1|  hypothetical protein V500_03151                       60.8    1e-07   
ref|WP_027817728.1|  alpha/beta hydrolase                             60.8    1e-07   
gb|KFY13590.1|  hypothetical protein V492_03152                       60.8    1e-07   
ref|WP_034844810.1|  hydrolase                                        60.8    1e-07   
gb|EJU05094.1|  hydrolase alpha/beta fold family                      60.8    1e-07   
dbj|GAF53517.1|  LOW QUALITY PROTEIN: hydrolase protein               60.8    1e-07   
ref|WP_027420542.1|  alpha/beta hydrolase                             60.8    1e-07   
ref|WP_030994939.1|  alpha/beta hydrolase                             60.8    1e-07   
ref|WP_020898222.1|  Alpha/beta hydrolase fold precursor              60.8    1e-07   
gb|ACB95709.1|  alpha/beta hydrolase fold                             60.8    1e-07   
ref|WP_041778707.1|  alpha/beta hydrolase                             60.5    1e-07   
gb|EHI10915.1|  hydrolase                                             60.8    1e-07   
ref|WP_041878178.1|  hypothetical protein                             60.5    1e-07   
ref|WP_026420432.1|  alpha/beta hydrolase                             60.5    1e-07   
ref|WP_041645750.1|  alpha/beta hydrolase                             60.8    1e-07   
ref|WP_043956702.1|  hydrolase                                        60.5    1e-07   
gb|KFY01797.1|  hypothetical protein O988_02522                       60.5    1e-07   
ref|WP_017652808.1|  hydrolase                                        60.5    1e-07   
ref|WP_031180388.1|  alpha/beta hydrolase                             60.5    1e-07   
ref|WP_008172759.1|  alpha/beta hydrolase                             60.8    2e-07   
ref|WP_008027195.1|  hydrolase                                        60.5    2e-07   
ref|WP_040019192.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_013734678.1|  hydrolase                                        60.5    2e-07   
ref|WP_040548164.1|  hypothetical protein                             60.5    2e-07   
ref|WP_040540021.1|  alpha/beta hydrolase                             60.5    2e-07   
gb|KIK55573.1|  hypothetical protein GYMLUDRAFT_175377                60.5    2e-07   
ref|WP_012757116.1|  alpha/beta hydrolase                             60.8    2e-07   
ref|WP_023174099.1|  alpha/beta hydrolase fold protein                60.5    2e-07   
ref|WP_011089316.1|  MULTISPECIES: hydrolase                          60.5    2e-07   
ref|WP_025722163.1|  hydrolase                                        60.5    2e-07   
gb|KIW20162.1|  hypothetical protein PV08_00737                       60.5    2e-07   
ref|WP_027581611.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_007432322.1|  hydrolase                                        60.5    2e-07   
ref|WP_035879205.1|  esterase                                         60.5    2e-07   
ref|WP_028311520.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_026079764.1|  hydrolase                                        60.5    2e-07   
ref|WP_008038993.1|  hydrolase                                        60.5    2e-07   
gb|ADY28816.1|  alpha/beta hydrolase fold protein                     60.5    2e-07   
gb|ADP99292.1|  mesoderm specific transcript isoform b isoform-li...  60.8    2e-07   
ref|WP_038507290.1|  hydrolase                                        60.5    2e-07   
ref|WP_028084529.1|  hydrolase                                        60.5    2e-07   
ref|WP_015122603.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_007569259.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_037220890.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|XP_010112655.1|  hypothetical protein L484_019107                 60.8    2e-07   
gb|EEB80284.1|  hydrolase, alpha/beta fold family, putative           60.5    2e-07   
ref|WP_019945299.1|  hypothetical protein                             60.5    2e-07   
ref|WP_034645976.1|  hydrolase                                        60.5    2e-07   
ref|WP_039275228.1|  hydrolase                                        60.5    2e-07   
gb|EWH13108.1|  alpha/beta hydrolase fold protein                     60.5    2e-07   
ref|XP_007727618.1|  hypothetical protein A1O1_08569                  60.5    2e-07   
ref|WP_036465982.1|  alpha/beta hydrolase                             60.5    2e-07   
gb|KIW26681.1|  hypothetical protein PV07_06495                       60.5    2e-07   
ref|WP_015217274.1|  Haloalkane dehalogenase                          60.1    2e-07   
ref|WP_041383799.1|  hypothetical protein                             57.4    2e-07   
ref|WP_032380089.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_024561555.1|  hydrolase                                        60.5    2e-07   
ref|WP_024556157.1|  hydrolase                                        60.1    2e-07   
ref|WP_042263905.1|  alpha/beta hydrolase                             60.8    2e-07   
ref|WP_027946876.1|  alpha/beta hydrolase                             60.1    2e-07   
ref|WP_026195910.1|  hydrolase                                        60.5    2e-07   
gb|KIK55572.1|  hypothetical protein GYMLUDRAFT_838936                60.1    2e-07   
ref|WP_002172654.1|  alpha/beta hydrolase                             60.1    2e-07   
ref|WP_025147698.1|  alpha/beta hydrolase                             60.1    2e-07   
gb|KIQ25528.1|  alpha/beta hydrolase                                  60.1    2e-07   
ref|WP_002175208.1|  alpha/beta hydrolase                             60.1    2e-07   
gb|ABQ35506.1|  Putative alpha/beta hydrolase                         60.5    2e-07   
gb|AHE57338.1|  hypothetical protein NX02_28815                       60.1    2e-07   
ref|WP_036113853.1|  MULTISPECIES: hypothetical protein               60.1    2e-07   
ref|XP_007542505.1|  PREDICTED: mesoderm-specific transcript homo...  58.2    2e-07   
ref|WP_042562846.1|  alpha/beta hydrolase                             60.1    2e-07   
ref|WP_034189734.1|  alpha/beta hydrolase                             60.5    2e-07   
ref|WP_016952131.1|  hydrolase                                        60.1    2e-07   
gb|KIV91137.1|  hypothetical protein PV10_05713                       60.1    2e-07   
ref|WP_012591554.1|  hydrolase                                        60.1    2e-07   
ref|WP_039998163.1|  alpha/beta hydrolase                             60.1    3e-07   
gb|EHK26770.1|  hypothetical protein TRIVIDRAFT_129821                59.7    3e-07   
ref|WP_013223238.1|  hydrolase                                        60.1    3e-07   
ref|WP_010200715.1|  haloalkane dehalogenase                          60.1    3e-07   
ref|WP_034229967.1|  hydrolase                                        59.7    3e-07   
ref|WP_036617143.1|  hydrolase                                        59.7    3e-07   
ref|WP_036040007.1|  hypothetical protein                             60.1    3e-07   
gb|AGP59979.1|  hypothetical protein M271_43025                       59.7    3e-07   
ref|WP_012377656.1|  alpha/beta hydrolase                             59.7    3e-07   
gb|EKQ68909.1|  putative hydrolase or acyltransferase of alpha/be...  59.7    3e-07   
ref|WP_040025025.1|  alpha/beta hydrolase                             59.7    3e-07   
ref|XP_005807474.1|  PREDICTED: mesoderm-specific transcript homo...  60.1    3e-07   
ref|XP_003445005.1|  PREDICTED: mesoderm-specific transcript homo...  60.1    3e-07   
ref|WP_044582694.1|  alpha/beta hydrolase                             59.7    3e-07   
ref|WP_042295692.1|  hydrolase                                        59.7    3e-07   



>ref|XP_009626420.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626421.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana tomentosiformis]
Length=397

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 165/204 (81%), Gaps = 4/204 (2%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIAS----QFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDA  268
             ++LH  C  +   +       P HQFSL +        KL RF CRSSSD N++Y LDA
Sbjct  1    MATLHCHCFRMLPSSPPDRINLPLHQFSLPKYHGAQGRKKLLRFRCRSSSDNNDEYLLDA  60

Query  269  PvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSS  448
            PVSVGDGFSFSGGKYSDEPSPADEWFK+G+ VKAH V+G+GEKAKDP+FGLTMG GSQ+S
Sbjct  61   PVSVGDGFSFSGGKYSDEPSPADEWFKKGKFVKAHPVSGTGEKAKDPLFGLTMGGGSQAS  120

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            +DLFRWFCVE+G+  +S IVL+HG PSQAYSYRK+LPIL K++H IAFDWLGFGFSDKPQ
Sbjct  121  TDLFRWFCVESGSTDNSTIVLVHGLPSQAYSYRKILPILEKNYHAIAFDWLGFGFSDKPQ  180

Query  629  PKYGFDYTLDEYVSSLESVINTLT  700
            P+YGFDYTLDEYV+SLES++N LT
Sbjct  181  PRYGFDYTLDEYVASLESILNALT  204



>ref|XP_009775310.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
 ref|XP_009775311.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
 ref|XP_009775312.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
 ref|XP_009775313.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nicotiana sylvestris]
Length=397

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 162/204 (79%), Gaps = 4/204 (2%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIAS----QFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDA  268
             ++LH  C  +   +       P HQFS  +        KL +F  RSSSD NE+Y LDA
Sbjct  1    MATLHCHCFRMLPSSPPDRINLPLHQFSFPKYHGAQGRKKLLQFHFRSSSDNNEEYLLDA  60

Query  269  PvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSS  448
            PVSVGDGFSFSGGKYSDEP+PADEWFK+G+ VKAH V+G+GEKAKDP+FGLTMG GSQ+S
Sbjct  61   PVSVGDGFSFSGGKYSDEPTPADEWFKKGKFVKAHPVSGTGEKAKDPLFGLTMGGGSQAS  120

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            SDLFRWFCVE G+  +S IVL+HG PSQAYSYRKVLPIL K++H IAFDWLGFGFSDKPQ
Sbjct  121  SDLFRWFCVENGSTDNSTIVLVHGLPSQAYSYRKVLPILEKNYHAIAFDWLGFGFSDKPQ  180

Query  629  PKYGFDYTLDEYVSSLESVINTLT  700
            P+YGFDYTLDEYV+SLES+IN LT
Sbjct  181  PRYGFDYTLDEYVASLESIINALT  204



>ref|XP_004246996.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Solanum lycopersicum]
Length=384

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 163/208 (78%), Gaps = 17/208 (8%)
 Frame = +2

Query  80   MAAIHT-SFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDY  256
            MA +H+ SFSSLHS           FP       RT       ++ RF CRSSSD  EDY
Sbjct  1    MATLHSCSFSSLHS-----------FPSVTLKYSRTQP-----RILRFNCRSSSDDKEDY  44

Query  257  FLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAG  436
             LDAPVSVGDGFSFSGGKYSDEPSPADEWF +G+ VKA+ V+G+GEKAKDPIFGLTMG  
Sbjct  45   LLDAPVSVGDGFSFSGGKYSDEPSPADEWFDRGKFVKAYPVSGTGEKAKDPIFGLTMGES  104

Query  437  SQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFS  616
            SQ+SSDLFRWFCVE+G++ +S I+LIHG PSQAYSYRKVLP+L  ++H IA DWLGFGFS
Sbjct  105  SQASSDLFRWFCVESGSSNNSPILLIHGLPSQAYSYRKVLPMLENNYHAIALDWLGFGFS  164

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTLT  700
            DKPQPKYGFDYTLDEYV+SLESVIN LT
Sbjct  165  DKPQPKYGFDYTLDEYVASLESVINALT  192



>ref|XP_006353829.1| PREDICTED: uncharacterized protein LOC102586068 [Solanum tuberosum]
Length=384

 Score =   256 bits (653),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 164/208 (79%), Gaps = 17/208 (8%)
 Frame = +2

Query  80   MAAIHT-SFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDY  256
            MA +H+ SFSSLHS   SL    S+  P               ++ RF CRSSSD  EDY
Sbjct  1    MATLHSCSFSSLHS-LPSLTVKYSRAQP---------------RILRFNCRSSSDDKEDY  44

Query  257  FLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAG  436
             LDAPVS+GDGFSFSGGKYSDEPSPADEWF +G+ VKA+ V+G+GEKAKDPIFGLTMG  
Sbjct  45   LLDAPVSIGDGFSFSGGKYSDEPSPADEWFNKGKFVKAYPVSGTGEKAKDPIFGLTMGGS  104

Query  437  SQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFS  616
            SQ+SSDLFRWFCVE+G++ +S I+LIHG PSQAYSYRKVLPIL  ++H IA DWLGFGFS
Sbjct  105  SQASSDLFRWFCVESGSSNNSPILLIHGLPSQAYSYRKVLPILENNYHAIALDWLGFGFS  164

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTLT  700
            DKPQPKYGFDYTLDEYV+SLESVIN LT
Sbjct  165  DKPQPKYGFDYTLDEYVASLESVINALT  192



>ref|XP_010326244.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Solanum lycopersicum]
Length=389

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 163/208 (78%), Gaps = 17/208 (8%)
 Frame = +2

Query  80   MAAIHT-SFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDY  256
            MA +H+ SFSSLHS           FP       RT       ++ RF CRSSSD  EDY
Sbjct  1    MATLHSCSFSSLHS-----------FPSVTLKYSRTQP-----RILRFNCRSSSDDKEDY  44

Query  257  FLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAG  436
             LDAPVSVGDGFSFSGGKYSDEPSPADEWF +G+ VKA+ V+G+GEKAKDPIFGLTMG  
Sbjct  45   LLDAPVSVGDGFSFSGGKYSDEPSPADEWFDRGKFVKAYPVSGTGEKAKDPIFGLTMGES  104

Query  437  SQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFS  616
            SQ+SSDLFRWFCVE+G++ +S I+LIHG PSQAYSYRKVLP+L  ++H IA DWLGFGFS
Sbjct  105  SQASSDLFRWFCVESGSSNNSPILLIHGLPSQAYSYRKVLPMLENNYHAIALDWLGFGFS  164

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTLT  700
            DKPQPKYGFDYTLDEYV+SLESVIN LT
Sbjct  165  DKPQPKYGFDYTLDEYVASLESVINALT  192



>ref|XP_012084566.1| PREDICTED: epoxide hydrolase 3 [Jatropha curcas]
 gb|KDP45211.1| hypothetical protein JCGZ_15076 [Jatropha curcas]
Length=392

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 161/207 (78%), Gaps = 4/207 (2%)
 Frame = +2

Query  80   MAAIHTSFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYF  259
            MA    + SSLHS        +   PP    L+  +RN+    L R  CRS++D  ++Y 
Sbjct  1    MAVQAKTLSSLHSHHFQFPFRSLNTPPSSI-LRTRARNFPRKSL-RLTCRSNAD--DEYL  56

Query  260  LDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGS  439
            +DAPVS GDGFSFSGGKYSDEPSPADEWFKQG+IVKAH V GSG KAKDPIFGL MGAGS
Sbjct  57   IDAPVSAGDGFSFSGGKYSDEPSPADEWFKQGKIVKAHPVMGSGGKAKDPIFGLKMGAGS  116

Query  440  QSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSD  619
            Q+S D+FRWFCVE+G A +  +VL+HGFPSQAYSYRKVLPILSK++H IAFDWLGFGFSD
Sbjct  117  QASDDVFRWFCVESGNANNPTVVLVHGFPSQAYSYRKVLPILSKNYHAIAFDWLGFGFSD  176

Query  620  KPQPKYGFDYTLDEYVSSLESVINTLT  700
            KPQP YGFDYTLDEYVSSL+S+IN + 
Sbjct  177  KPQPGYGFDYTLDEYVSSLDSLINEIA  203



>emb|CDP03986.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSD-GNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVN  382
            K S   CRSS+D  NEDY+LDAPVSVGDGFSFSGGKYSDEPSPADEWF+QG+IVKAH V 
Sbjct  50   KHSLLFCRSSNDESNEDYYLDAPVSVGDGFSFSGGKYSDEPSPADEWFEQGKIVKAHPVG  109

Query  383  GSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPI  562
            G+G+KAKDPIFGL MG GSQ+SSDLFRWFCV++G+A +  IVLIHGFPSQAYSYRKVLPI
Sbjct  110  GTGDKAKDPIFGLAMGGGSQTSSDLFRWFCVDSGSADNHPIVLIHGFPSQAYSYRKVLPI  169

Query  563  LSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            LSK +H IAFDWLGFGFSDKPQP+YGFDYTLDEY +SLES+I+  T
Sbjct  170  LSKKYHAIAFDWLGFGFSDKPQPRYGFDYTLDEYTTSLESIIDETT  215



>ref|XP_011080549.1| PREDICTED: uncharacterized protein LOC105163785 [Sesamum indicum]
Length=386

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  224  CRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            CRSSS+ NEDYFLDAPVSVGDGFSFSGGKYSDEPSPADEWFKQG+IVKAH V G+GEKAK
Sbjct  36   CRSSSEPNEDYFLDAPVSVGDGFSFSGGKYSDEPSPADEWFKQGKIVKAHPVGGTGEKAK  95

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DPIFGL M   SQ+S+DLFRWFCVE+G++ +  +VLIHGFPSQAYSYRKVLPILSK++H 
Sbjct  96   DPIFGLAMAGSSQASTDLFRWFCVESGSSANPPVVLIHGFPSQAYSYRKVLPILSKNNHA  155

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            IAFDWLGFGFSDKPQPKYGFDYTL EYV SLESVI+  +
Sbjct  156  IAFDWLGFGFSDKPQPKYGFDYTLKEYVESLESVISEFS  194



>ref|XP_010258609.1| PREDICTED: uncharacterized protein LOC104598304 isoform X2 [Nelumbo 
nucifera]
Length=315

 Score =   243 bits (621),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 160/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  89   IHTSFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDA  268
            +  + SSL S    L + +S  P  +  L  ++   +  KL RF CRSS +   +Y LDA
Sbjct  3    VQANISSLQSSPFVLNSPSSH-PSLRQLLNFSAGKAERRKL-RFSCRSSREQEGEYLLDA  60

Query  269  PvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSS  448
            PVSVGDGFSFSGGKYSDEPSP+DEWFK+G++VKAH VNG G+KAKDPIFGLTMGAGSQ+S
Sbjct  61   PVSVGDGFSFSGGKYSDEPSPSDEWFKKGKMVKAHPVNGIGKKAKDPIFGLTMGAGSQAS  120

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            SD+FRWFCVE+G A +  ++LIHGFPSQAYSYRK LP+LSK +H IAFDWLGFGFSDKPQ
Sbjct  121  SDVFRWFCVESGNADNPSVILIHGFPSQAYSYRKALPVLSKEYHAIAFDWLGFGFSDKPQ  180

Query  629  PKYGFDYTLDEYVSSLESVINTLT  700
            P YGFDYTLDEYV +LES+I  L 
Sbjct  181  PGYGFDYTLDEYVLALESLIGQLV  204



>gb|EYU46070.1| hypothetical protein MIMGU_mgv1a008062mg [Erythranthe guttata]
Length=386

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 153/197 (78%), Gaps = 7/197 (4%)
 Frame = +2

Query  110  LHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdg  289
            L S   SL    S   P QF L  T +N      S   C+S++D NEDY LDAPVSVGDG
Sbjct  5    LSSASFSLPKHHSLISPSQFLL-FTKKN------SLLTCKSTNDSNEDYLLDAPVSVGDG  57

Query  290  fsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWF  469
            FSFSGGKYSDEPSPADEWFKQG+ VKAH V G+GEKAKDPIFGL M   SQSS+DLFRWF
Sbjct  58   FSFSGGKYSDEPSPADEWFKQGKYVKAHPVGGTGEKAKDPIFGLVMAGSSQSSTDLFRWF  117

Query  470  CVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDY  649
            CVE+G+  +  ++LIHGFPSQAYSYRKVLP+LSK +H IAFDWLGFGFSDKPQPKYGFDY
Sbjct  118  CVESGSTANPPVILIHGFPSQAYSYRKVLPMLSKKNHAIAFDWLGFGFSDKPQPKYGFDY  177

Query  650  TLDEYVSSLESVINTLT  700
            TL EYV SLESV++  +
Sbjct  178  TLKEYVDSLESVVDKFS  194



>ref|XP_010258608.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Nelumbo nucifera]
Length=393

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 160/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  89   IHTSFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDA  268
            +  + SSL S    L + +S  P  +  L  ++   +  KL RF CRSS +   +Y LDA
Sbjct  3    VQANISSLQSSPFVLNSPSSH-PSLRQLLNFSAGKAERRKL-RFSCRSSREQEGEYLLDA  60

Query  269  PvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSS  448
            PVSVGDGFSFSGGKYSDEPSP+DEWFK+G++VKAH VNG G+KAKDPIFGLTMGAGSQ+S
Sbjct  61   PVSVGDGFSFSGGKYSDEPSPSDEWFKKGKMVKAHPVNGIGKKAKDPIFGLTMGAGSQAS  120

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            SD+FRWFCVE+G A +  ++LIHGFPSQAYSYRK LP+LSK +H IAFDWLGFGFSDKPQ
Sbjct  121  SDVFRWFCVESGNADNPSVILIHGFPSQAYSYRKALPVLSKEYHAIAFDWLGFGFSDKPQ  180

Query  629  PKYGFDYTLDEYVSSLESVINTLT  700
            P YGFDYTLDEYV +LES+I  L 
Sbjct  181  PGYGFDYTLDEYVLALESLIGQLV  204



>ref|XP_008382540.1| PREDICTED: uncharacterized hydrolase YNR064C [Malus domestica]
Length=396

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 160/205 (78%), Gaps = 7/205 (3%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIASQFPPH--QFSLKRTSRNYQS---LKLSRFLCRSSSDGNEDYFLD  265
             ++  ++  SLC  A Q   H    SL     N +S    K  +F CRSS  G +DY++D
Sbjct  1    MAATQAKTPSLCYYARQLHNHIPASSLSLVGNNLKSNHHKKPLKFTCRSS--GQDDYYID  58

Query  266  APvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQS  445
            APV VGDGFSFSGGKYSD PSP+DEWFKQG+IVKA+   GSGEKAKDPIFGL MGA SQ+
Sbjct  59   APVEVGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAYAAFGSGEKAKDPIFGLAMGADSQA  118

Query  446  SSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKP  625
            S+D+FRWFCVE+G+A +  ++LIHGFPSQAYSYRKVLPILSK +H IAFDWLGFGFSDKP
Sbjct  119  STDVFRWFCVESGSADNPSVILIHGFPSQAYSYRKVLPILSKDYHAIAFDWLGFGFSDKP  178

Query  626  QPKYGFDYTLDEYVSSLESVINTLT  700
            QPKYGFDYT++E+V+SLES IN +T
Sbjct  179  QPKYGFDYTMNEFVASLESFINEVT  203



>ref|XP_009342379.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Pyrus x bretschneideri]
Length=396

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 160/205 (78%), Gaps = 7/205 (3%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIASQFPPH--QFSLKRTSRNYQS---LKLSRFLCRSSSDGNEDYFLD  265
             ++  ++  SLC  A Q   H    SL     N +S    K  +F CRSS  G +DY++D
Sbjct  1    MAATQAKTPSLCYYARQLHNHIPASSLSLVGNNLKSNHHKKPLKFTCRSS--GQDDYYID  58

Query  266  APvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQS  445
            AP+ +GDGFSFSGGKYSD PSP+DEWFKQG+IVKA+   GSGEKAKDPIFGL MGA SQ+
Sbjct  59   APIEIGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAYAAFGSGEKAKDPIFGLAMGADSQA  118

Query  446  SSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKP  625
            S+D+FRWFCVE+G+A +  ++LIHGFPSQAYSYRKVLPILSK +H IAFDWLGFGFSDKP
Sbjct  119  STDVFRWFCVESGSADNPSVILIHGFPSQAYSYRKVLPILSKDYHTIAFDWLGFGFSDKP  178

Query  626  QPKYGFDYTLDEYVSSLESVINTLT  700
            QPKYGFDYT++E+V+SLES IN +T
Sbjct  179  QPKYGFDYTMNEFVASLESFINEVT  203



>ref|XP_009358940.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Pyrus x bretschneideri]
Length=394

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 162/203 (80%), Gaps = 5/203 (2%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIASQFPPHQ--FSLKRTSRNYQSLKLS-RFLCRSSSDGNEDYFLDAP  271
             ++  ++  SLC  + Q   H    SL     N +S K + +F CRS  +G +DY++DAP
Sbjct  1    MAATQAKTPSLCYYSHQLHNHNPASSLSLVGNNLKSHKKTLKFTCRS--NGQDDYYIDAP  58

Query  272  vsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSS  451
            V VGDGFSFSGGKYSD PSP+DEWFKQG+IVKA+   GSGEKAKDPIFGL MGA SQ+S+
Sbjct  59   VEVGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAYAAFGSGEKAKDPIFGLAMGADSQAST  118

Query  452  DLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP  631
            D+FRWFCVE+G+A +  ++LIHGFPSQ+YSYRKVLPILSK +HVIAFDWLGFGFSDKPQP
Sbjct  119  DVFRWFCVESGSADNPSVILIHGFPSQSYSYRKVLPILSKDYHVIAFDWLGFGFSDKPQP  178

Query  632  KYGFDYTLDEYVSSLESVINTLT  700
            KYGFDYT++E+V+SLES IN ++
Sbjct  179  KYGFDYTMNEFVASLESFINEVS  201



>ref|XP_002527279.1| hydrolase, putative [Ricinus communis]
 gb|EEF35123.1| hydrolase, putative [Ricinus communis]
Length=386

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 157/186 (84%), Gaps = 8/186 (4%)
 Frame = +2

Query  149  QFPPHQFSLKRTSRN--YQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDE  322
              PP +  L+  +++   +SLKL   +C+SS  G +DY +DAPVS GDGFSFSGGKYSDE
Sbjct  17   HLPPLRTPLRSPAKSSPRKSLKL---ICKSS--GEDDYLIDAPVSAGDGFSFSGGKYSDE  71

Query  323  PSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSC  502
            PSPADEWFK+G+IVKAHLV GSGEKAKDPIFGL MG+GSQ+S DLFRWFCVE+G + +  
Sbjct  72   PSPADEWFKEGKIVKAHLV-GSGEKAKDPIFGLKMGSGSQASDDLFRWFCVESGNSNNPM  130

Query  503  IVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLES  682
            +VLIHGFPSQAYSYRKVLP+LSK++  IAFDWLGFGFSD+PQP YGFDYTL+EYVSSLES
Sbjct  131  VVLIHGFPSQAYSYRKVLPVLSKNYRAIAFDWLGFGFSDRPQPGYGFDYTLNEYVSSLES  190

Query  683  VINTLT  700
            +IN ++
Sbjct  191  LINEIS  196



>ref|XP_007199912.1| hypothetical protein PRUPE_ppa006807mg [Prunus persica]
 gb|EMJ01111.1| hypothetical protein PRUPE_ppa006807mg [Prunus persica]
Length=394

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  RFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGE  394
            +F CRS  +GN+DY++DAP+ VGDGFSFSGGKYSD PSP+DEWFKQG+IVKA+   GSGE
Sbjct  42   KFSCRS--NGNDDYYIDAPIEVGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAYAAFGSGE  99

Query  395  KAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKS  574
            KAKDPIFGL MGA SQ+S+D+FRWFCVE+G+A +  ++LIHGFPSQAYSYRKVLP+LSK 
Sbjct  100  KAKDPIFGLAMGADSQASTDIFRWFCVESGSADNPSVILIHGFPSQAYSYRKVLPMLSKD  159

Query  575  HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            +H IAFDWLGFGFSDKPQPKYGFDYTL+E+VSSLES IN + 
Sbjct  160  YHAIAFDWLGFGFSDKPQPKYGFDYTLNEFVSSLESFINEVA  201



>gb|KHN30854.1| Haloalkane dehalogenase [Glycine soja]
Length=401

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 6/212 (3%)
 Frame = +2

Query  74   ISMAAIHTSFSSLHSQCHSLCTIASQFPPHQFSLKRTS--RNYQSLKLSRFLCRSS-SDG  244
            +++ A H S     S      +  +  PP   S +  S     +SLKL+   C SS ++G
Sbjct  1    MTLQAFHGSACCFRSHLLHFSSSTASSPPFLASRRFQSCPSTRKSLKLN---CSSSGNNG  57

Query  245  NEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLT  424
            ++DY LDAPVSVGDGFSFSGGKYSD PSP+DEWFKQG+ VKA+ + G+GEKAKDPIFGL 
Sbjct  58   DQDYLLDAPVSVGDGFSFSGGKYSDGPSPSDEWFKQGKKVKAYSIPGTGEKAKDPIFGLA  117

Query  425  MGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLG  604
            MG+GSQ++ D FRWFCVE+G+A +  ++LIHGFPSQAYSYRKVLP+LSK +HVIAFDWLG
Sbjct  118  MGSGSQATGDRFRWFCVESGSADNPSVILIHGFPSQAYSYRKVLPVLSKDYHVIAFDWLG  177

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSDKPQP+YGFDYTLDEYVSSLES+I+ L 
Sbjct  178  FGFSDKPQPRYGFDYTLDEYVSSLESLIDELA  209



>ref|XP_008235874.1| PREDICTED: uncharacterized hydrolase YNR064C [Prunus mume]
Length=394

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = +2

Query  158  PHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPAD  337
            P   SL    + ++  K  +F CRS  +GN+DY++DAPV VGDGFSFSGGKYSD PSP+D
Sbjct  25   PASLSLVGNGKAHK--KAPKFSCRS--NGNDDYYIDAPVEVGDGFSFSGGKYSDGPSPSD  80

Query  338  EWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIH  517
            EWFKQG+IVKA+   GSGEKAKDPIFGL MGA SQ+S+D+FRWFCVE+G+A +  ++LIH
Sbjct  81   EWFKQGKIVKAYAAFGSGEKAKDPIFGLAMGADSQASTDIFRWFCVESGSADNPSVILIH  140

Query  518  GFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            GFPSQAYSYRKVLP+LSK +H IAFDWLGFGFSDKPQPKYGFDYTL+E+VSSLES I  +
Sbjct  141  GFPSQAYSYRKVLPMLSKDYHAIAFDWLGFGFSDKPQPKYGFDYTLNEFVSSLESFIKEV  200

Query  698  T  700
             
Sbjct  201  A  201



>ref|XP_011009615.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Populus euphratica]
Length=391

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  233  SSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPI  412
            SS G +DY +DAPVS GDGFSFSGGKYSD PSP+DEWFKQG+IVKAH V+GSG+KAKDPI
Sbjct  46   SSKGQDDYLIDAPVSAGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAHPVSGSGDKAKDPI  105

Query  413  FGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAF  592
            FGL MGA SQ+S+DLFRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP LSK++H IAF
Sbjct  106  FGLKMGAASQASNDLFRWFCVESGNADNPTVILIHGFPSQAYSYRKVLPTLSKNYHAIAF  165

Query  593  DWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            DWLGFGFSDKPQP+YGFDYT+DE+V+SLES+IN + 
Sbjct  166  DWLGFGFSDKPQPRYGFDYTMDEFVASLESLINEIA  201



>ref|XP_002320563.2| hypothetical protein POPTR_0014s17410g [Populus trichocarpa]
 gb|EEE98878.2| hypothetical protein POPTR_0014s17410g [Populus trichocarpa]
Length=393

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  233  SSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPI  412
            SS G +DY +DAPVS GDGFSFSGGKYSD PSP+DEWFKQG+IVKAH V+GSG+KAKDPI
Sbjct  46   SSKGQDDYLIDAPVSAGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAHPVSGSGDKAKDPI  105

Query  413  FGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAF  592
            FGL MGA SQ+S+DLFRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP LSK++H IAF
Sbjct  106  FGLKMGAASQASNDLFRWFCVESGNADNPTVILIHGFPSQAYSYRKVLPTLSKNYHAIAF  165

Query  593  DWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            DWLGFGFSDKPQP+YGFDYT+DE+V+SLES+IN + 
Sbjct  166  DWLGFGFSDKPQPRYGFDYTMDEFVASLESLINEIA  201



>emb|CAN81493.1| hypothetical protein VITISV_019990 [Vitis vinifera]
Length=315

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  179  RTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGR  358
            R++   +  K  R   RSSSD  +DY++DAPVSVGDGFSF GGKYS+EPSP+DEWF++G 
Sbjct  29   RSTAPIRRTKSLRLRIRSSSD--DDYYIDAPVSVGDGFSFGGGKYSEEPSPSDEWFEKGN  86

Query  359  IVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
            IVKAH V GSG+KA DPIFGL MGAGSQ+S DLFRWFC+E+G+  +  ++LIHGFPSQAY
Sbjct  87   IVKAHPVLGSGKKASDPIFGLKMGAGSQASDDLFRWFCIESGSPDNXSVILIHGFPSQAY  146

Query  539  SYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SYRKVLP+LSK +H IAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  S+IN L 
Sbjct  147  SYRKVLPVLSKKYHAIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSFGSLINELV  200



>ref|XP_010645317.1| PREDICTED: uncharacterized protein LOC100244633 isoform X3 [Vitis 
vinifera]
Length=320

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  179  RTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGR  358
            R++   +  K  R   RSSSD  +DY++DAPVSVGDGFSF GGKYS+EPSP+DEWF++G 
Sbjct  29   RSTAPIRRTKSLRLRIRSSSD--DDYYIDAPVSVGDGFSFGGGKYSEEPSPSDEWFEKGN  86

Query  359  IVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
            IVKAH V GSG+KA DPIFGL MGAGSQ+S DLFRWFC+E+G+  +  ++LIHGFPSQAY
Sbjct  87   IVKAHPVLGSGKKASDPIFGLKMGAGSQASDDLFRWFCIESGSPDNHSVILIHGFPSQAY  146

Query  539  SYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SYRKVLP+LSK +H IAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  S+IN L 
Sbjct  147  SYRKVLPVLSKKYHAIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSFGSLINELV  200



>ref|XP_003521017.2| PREDICTED: uncharacterized hydrolase YNR064C [Glycine max]
Length=443

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 165/214 (77%), Gaps = 6/214 (3%)
 Frame = +2

Query  68   LFISMAAIHTSFSSLHSQCHSLCTIASQFPPHQFSLKRTS--RNYQSLKLSRFLCRSS-S  238
            + +++ A H S     S      +  +  PP   S +  S     +SLKL+   C SS +
Sbjct  41   IAMTLQAFHGSACCFRSHLLHFSSSTASSPPFLASRRFQSCPSTRKSLKLN---CSSSGN  97

Query  239  DGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFG  418
            +G++DY LDAPVSVGDGFSFSGGKYSD PSP+DEWFKQG+ VKA+ + G+GEKAKDPIFG
Sbjct  98   NGDQDYLLDAPVSVGDGFSFSGGKYSDGPSPSDEWFKQGKKVKAYSIPGTGEKAKDPIFG  157

Query  419  LTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDW  598
            L MG+GSQ++ D FRWFCVE+G+A +  ++LIHGFPSQAYSYRKVLP+LSK +HVIAFDW
Sbjct  158  LAMGSGSQATGDRFRWFCVESGSADNPSVILIHGFPSQAYSYRKVLPVLSKDYHVIAFDW  217

Query  599  LGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            LGFGFSDKPQP+YGFDYTLDEYVSSLES+I+ L 
Sbjct  218  LGFGFSDKPQPRYGFDYTLDEYVSSLESLIDELA  251



>ref|XP_011009616.1| PREDICTED: uncharacterized protein LOC105114684 isoform X3 [Populus 
euphratica]
Length=314

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  221  LCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKA  400
            L  SS   ++DY +DAPVS GDGFSFSGGKYSD PSP+DEWFKQG+IVKAH V+GSG+KA
Sbjct  43   LTCSSKGQDQDYLIDAPVSAGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAHPVSGSGDKA  102

Query  401  KDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHH  580
            KDPIFGL MGA SQ+S+DLFRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP LSK++H
Sbjct  103  KDPIFGLKMGAASQASNDLFRWFCVESGNADNPTVILIHGFPSQAYSYRKVLPTLSKNYH  162

Query  581  VIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
             IAFDWLGFGFSDKPQP+YGFDYT+DE+V+SLES+IN + 
Sbjct  163  AIAFDWLGFGFSDKPQPRYGFDYTMDEFVASLESLINEIA  202



>ref|XP_011009614.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Populus euphratica]
Length=392

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  221  LCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKA  400
            L  SS   ++DY +DAPVS GDGFSFSGGKYSD PSP+DEWFKQG+IVKAH V+GSG+KA
Sbjct  43   LTCSSKGQDQDYLIDAPVSAGDGFSFSGGKYSDGPSPSDEWFKQGKIVKAHPVSGSGDKA  102

Query  401  KDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHH  580
            KDPIFGL MGA SQ+S+DLFRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP LSK++H
Sbjct  103  KDPIFGLKMGAASQASNDLFRWFCVESGNADNPTVILIHGFPSQAYSYRKVLPTLSKNYH  162

Query  581  VIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
             IAFDWLGFGFSDKPQP+YGFDYT+DE+V+SLES+IN + 
Sbjct  163  AIAFDWLGFGFSDKPQPRYGFDYTMDEFVASLESLINEIA  202



>ref|XP_010095591.1| hypothetical protein L484_007430 [Morus notabilis]
 gb|EXB61164.1| hypothetical protein L484_007430 [Morus notabilis]
Length=387

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  182  TSRNYQSLKLSRFLCRSSS--DGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQG  355
            T+RN     LS F CR+S+  D   DY +DAPVS GDGFSFSGGKYSD PSP+DEWFKQG
Sbjct  22   TARNSTKKPLS-FSCRASNNDDPQGDYLIDAPVSAGDGFSFSGGKYSDGPSPSDEWFKQG  80

Query  356  RIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQA  535
            +IVKAH V GSG KAKDPIFGLTMGA SQ+  D FRWFCVE+G+A +  +VL+HGFPSQA
Sbjct  81   KIVKAHPVGGSGGKAKDPIFGLTMGAASQAPPDFFRWFCVESGSADNPSVVLVHGFPSQA  140

Query  536  YSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            YSYRKVLP+LSK+   IAFDWLGFGFSDKPQP YGFDYTLDEYVSS ES+IN +T
Sbjct  141  YSYRKVLPVLSKNFRAIAFDWLGFGFSDKPQPGYGFDYTLDEYVSSFESLINDVT  195



>ref|XP_002271124.1| PREDICTED: epoxide hydrolase 4 isoform X1 [Vitis vinifera]
 ref|XP_010645316.1| PREDICTED: epoxide hydrolase 4 isoform X2 [Vitis vinifera]
Length=392

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  179  RTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGR  358
            R++   +  K  R   RSSSD  +DY++DAPVSVGDGFSF GGKYS+EPSP+DEWF++G 
Sbjct  29   RSTAPIRRTKSLRLRIRSSSD--DDYYIDAPVSVGDGFSFGGGKYSEEPSPSDEWFEKGN  86

Query  359  IVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
            IVKAH V GSG+KA DPIFGL MGAGSQ+S DLFRWFC+E+G+  +  ++LIHGFPSQAY
Sbjct  87   IVKAHPVLGSGKKASDPIFGLKMGAGSQASDDLFRWFCIESGSPDNHSVILIHGFPSQAY  146

Query  539  SYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SYRKVLP+LSK +H IAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  S+IN L 
Sbjct  147  SYRKVLPVLSKKYHAIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSFGSLINELV  200



>gb|KCW48732.1| hypothetical protein EUGRSUZ_K02363 [Eucalyptus grandis]
Length=290

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  212  SRFLCRSS-SDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGS  388
            ++  C++S  D +EDY +DAPVS GDGFSFSGGKYSD PS +DEWFKQG +VKA  V GS
Sbjct  50   NKLACKASVDDSDEDYLIDAPVSAGDGFSFSGGKYSDGPSQSDEWFKQGNMVKAFPVLGS  109

Query  389  GEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILS  568
            GEKAKDPIFGLTMG+GSQS +D+FRWFCVE+G A +  ++L+HGFPSQAYSYRK+LPILS
Sbjct  110  GEKAKDPIFGLTMGSGSQSPADVFRWFCVESGIADNPPVLLVHGFPSQAYSYRKILPILS  169

Query  569  KSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            K +H IAFDW+GFGFSDKPQP YGF+YTL+EYVSSLES+IN+L
Sbjct  170  KDYHAIAFDWIGFGFSDKPQPGYGFNYTLNEYVSSLESLINSL  212



>ref|XP_007134311.1| hypothetical protein PHAVU_010G036500g [Phaseolus vulgaris]
 gb|ESW06305.1| hypothetical protein PHAVU_010G036500g [Phaseolus vulgaris]
Length=400

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 4/169 (2%)
 Frame = +2

Query  197  QSLKLSRFLCRSSSDGN-EDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAH  373
            +SLKL+   C SS + + +DY LDAPVSVGDGFSFSGGKYS+ PSP+DEWFKQG++VKA+
Sbjct  43   KSLKLN---CSSSGNNDGQDYLLDAPVSVGDGFSFSGGKYSEGPSPSDEWFKQGKMVKAY  99

Query  374  LVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKV  553
             + G+GEKAKDPIFGL MGAGSQ++ D FRWFCVE+G+A +  +VLIHGFPSQAYSYRKV
Sbjct  100  SIPGTGEKAKDPIFGLAMGAGSQATGDRFRWFCVESGSADNPPVVLIHGFPSQAYSYRKV  159

Query  554  LPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            LP+LSK +H IAFDWLGFGFSDKPQP+YGFDYTLDEYVSSLES+I+ L 
Sbjct  160  LPVLSKDYHAIAFDWLGFGFSDKPQPRYGFDYTLDEYVSSLESLIDELA  208



>emb|CBI23337.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  179  RTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGR  358
            R++   +  K  R   RSSSD  +DY++DAPVSVGDGFSF GGKYS+EPSP+DEWF++G 
Sbjct  29   RSTAPIRRTKSLRLRIRSSSD--DDYYIDAPVSVGDGFSFGGGKYSEEPSPSDEWFEKGN  86

Query  359  IVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
            IVKAH V GSG+KA DPIFGL MGAGSQ+S DLFRWFC+E+G+  +  ++LIHGFPSQAY
Sbjct  87   IVKAHPVLGSGKKASDPIFGLKMGAGSQASDDLFRWFCIESGSPDNHSVILIHGFPSQAY  146

Query  539  SYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SYRKVLP+LSK +H IAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  S+IN L 
Sbjct  147  SYRKVLPVLSKKYHAIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSFGSLINELV  200



>gb|KJB42614.1| hypothetical protein B456_007G161100 [Gossypium raimondii]
Length=401

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = +2

Query  179  RTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGR  358
            +  R   +L+LSR    +++D  +DY +DAPVS GDGFSFSGGKYSD P+P+DEWFKQG+
Sbjct  37   KAQRKPLTLRLSRS-TPNANDPQDDYLIDAPVSAGDGFSFSGGKYSDGPNPSDEWFKQGK  95

Query  359  IVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
             VKA+ V G+GEKAKDPIFGLTMGAGSQ+S D+FRWF VE+G A +  ++LIHGFPSQAY
Sbjct  96   FVKAYPVGGTGEKAKDPIFGLTMGAGSQASGDVFRWFSVESGNADNPTVILIHGFPSQAY  155

Query  539  SYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SYRKVLP+LSK++H IAFDWLGFGFSDKPQP+YGFDYTL EYVS+LES +N + 
Sbjct  156  SYRKVLPVLSKNYHAIAFDWLGFGFSDKPQPRYGFDYTLSEYVSALESFVNEVA  209



>ref|XP_010926737.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Elaeis guineensis]
Length=379

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  215  RFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGE  394
            RF C SS  G E+Y +DAPVS+GDGFSFSGGKYSD PS +DEWF QG+++KAH V G   
Sbjct  28   RFRCMSSPSGEEEYLVDAPVSIGDGFSFSGGKYSDGPSRSDEWFAQGKMIKAHPVYGGKG  87

Query  395  KAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKS  574
            KAKDPIFGLTMGAGSQS +D+FRWFC+E G++ +  ++LIHGFPSQAYSYRKVLP+LS+ 
Sbjct  88   KAKDPIFGLTMGAGSQSPADVFRWFCIEKGSSANPLVILIHGFPSQAYSYRKVLPVLSED  147

Query  575  HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            +H +AFDWLGFGFSDKPQPKYGFDYTLD+Y SSLES++N + 
Sbjct  148  YHAVAFDWLGFGFSDKPQPKYGFDYTLDDYASSLESLVNEMA  189



>ref|XP_007049547.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX93704.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=367

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 143/173 (83%), Gaps = 10/173 (6%)
 Frame = +2

Query  212  SRFLCR-------SSSDGNE---DYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRI  361
            ++ LCR       S S+ NE   DY +DAPVS GDGFSFSGGKYSDE +P+DEWFK+G+ 
Sbjct  38   AQHLCRKPLRLSCSRSNANEPQDDYLIDAPVSAGDGFSFSGGKYSDEANPSDEWFKRGKY  97

Query  362  VKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYS  541
            VKAH V G+GEKAKDPIFGLTMGAGSQ+S D+FRWFCVE+G A +  ++LIHGFPSQAYS
Sbjct  98   VKAHPVGGTGEKAKDPIFGLTMGAGSQASGDVFRWFCVESGNADNHTVILIHGFPSQAYS  157

Query  542  YRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            YRKVLP+LSK++  IAFDWLGFGFSDKPQP+YGFDY+L EYVS+LES +N + 
Sbjct  158  YRKVLPVLSKNYRAIAFDWLGFGFSDKPQPRYGFDYSLGEYVSALESFVNEVA  210



>ref|XP_010532928.1| PREDICTED: uncharacterized hydrolase YNR064C [Tarenaya hassleriana]
Length=395

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 138/162 (85%), Gaps = 2/162 (1%)
 Frame = +2

Query  215  RFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGE  394
            RF+C+S+S   +DY +DAPVS GDGFSF GGKYSDEPSPAD WF+QG+++KAH V GSGE
Sbjct  44   RFVCKSNS--QDDYLIDAPVSAGDGFSFGGGKYSDEPSPADIWFEQGKMIKAHRVGGSGE  101

Query  395  KAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKS  574
            KAKDPIFGL MGAG+Q+S DLFRWFCVETG      ++LIHG PSQA+SYRKVLP+LSK+
Sbjct  102  KAKDPIFGLAMGAGAQASDDLFRWFCVETGNQDSFPVILIHGLPSQAFSYRKVLPVLSKN  161

Query  575  HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            +  IAFDWLGFGFSDKPQP YGFDYTL EYVSSLES I+ ++
Sbjct  162  YRAIAFDWLGFGFSDKPQPGYGFDYTLSEYVSSLESFIDEVS  203



>ref|XP_010037094.1| PREDICTED: uncharacterized hydrolase YNR064C [Eucalyptus grandis]
 gb|KCW48731.1| hypothetical protein EUGRSUZ_K02363 [Eucalyptus grandis]
Length=405

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  212  SRFLCRSS-SDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGS  388
            ++  C++S  D +EDY +DAPVS GDGFSFSGGKYSD PS +DEWFKQG +VKA  V GS
Sbjct  50   NKLACKASVDDSDEDYLIDAPVSAGDGFSFSGGKYSDGPSQSDEWFKQGNMVKAFPVLGS  109

Query  389  GEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILS  568
            GEKAKDPIFGLTMG+GSQS +D+FRWFCVE+G A +  ++L+HGFPSQAYSYRK+LPILS
Sbjct  110  GEKAKDPIFGLTMGSGSQSPADVFRWFCVESGIADNPPVLLVHGFPSQAYSYRKILPILS  169

Query  569  KSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            K +H IAFDW+GFGFSDKPQP YGF+YTL+EYVSSLES+IN+L
Sbjct  170  KDYHAIAFDWIGFGFSDKPQPGYGFNYTLNEYVSSLESLINSL  212



>gb|KEH18034.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=384

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  182  TSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRI  361
            +++ + S K  +  C +S+   +DY LDAP+SVGDGFSFSGGKYSD P+P+DEWFKQG++
Sbjct  22   STKRFPSRKTLKLNCSTSNGDKDDYLLDAPISVGDGFSFSGGKYSDGPNPSDEWFKQGKM  81

Query  362  VKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYS  541
            VKA+ + G+GEKAKDPIFGLTMG  SQ++ D FRWFCVE G+  +  ++LIHGFPSQAYS
Sbjct  82   VKAYSIPGTGEKAKDPIFGLTMGTSSQATGDRFRWFCVERGSVDNPSVILIHGFPSQAYS  141

Query  542  YRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            YRKVLP+LSK +  + FDWLGFGFSDKPQPKYGFDYTLDEYVSSLES+I+ L
Sbjct  142  YRKVLPVLSKDYRAVTFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESLIDEL  193



>ref|XP_007049548.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX93705.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
Length=350

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 143/173 (83%), Gaps = 10/173 (6%)
 Frame = +2

Query  212  SRFLCR-------SSSDGNE---DYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRI  361
            ++ LCR       S S+ NE   DY +DAPVS GDGFSFSGGKYSDE +P+DEWFK+G+ 
Sbjct  38   AQHLCRKPLRLSCSRSNANEPQDDYLIDAPVSAGDGFSFSGGKYSDEANPSDEWFKRGKY  97

Query  362  VKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYS  541
            VKAH V G+GEKAKDPIFGLTMGAGSQ+S D+FRWFCVE+G A +  ++LIHGFPSQAYS
Sbjct  98   VKAHPVGGTGEKAKDPIFGLTMGAGSQASGDVFRWFCVESGNADNHTVILIHGFPSQAYS  157

Query  542  YRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            YRKVLP+LSK++  IAFDWLGFGFSDKPQP+YGFDY+L EYVS+LES +N + 
Sbjct  158  YRKVLPVLSKNYRAIAFDWLGFGFSDKPQPRYGFDYSLGEYVSALESFVNEVA  210



>gb|AFK49471.1| unknown [Lotus japonicus]
Length=397

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 1/175 (1%)
 Frame = +2

Query  179  RTSRNYQSLKLSRFLCRSSSD-GNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQG  355
            R  R+Y S K  +  C S+ + G++DY LDAP SVGDGFSFSGGKYSD PSP+D+WFKQG
Sbjct  33   RWFRSYPSKKSLKLNCSSNGNSGDQDYLLDAPESVGDGFSFSGGKYSDGPSPSDDWFKQG  92

Query  356  RIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQA  535
            ++++A+   G+ EKAKDPIFGLTMGA SQSS + FRWFCVE G+A +  ++LIHGFPSQA
Sbjct  93   KMIRAYSNAGTSEKAKDPIFGLTMGASSQSSGNSFRWFCVERGSADNPSVILIHGFPSQA  152

Query  536  YSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            YSYRKVLP+LSK +H IAFDWLGFGFSDK QPKYGFDYTLDEYVSSLES+I+ L 
Sbjct  153  YSYRKVLPVLSKDYHAIAFDWLGFGFSDKSQPKYGFDYTLDEYVSSLESLIDELV  207



>gb|KCW48730.1| hypothetical protein EUGRSUZ_K02363 [Eucalyptus grandis]
Length=416

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  212  SRFLCRSS-SDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGS  388
            ++  C++S  D +EDY +DAPVS GDGFSFSGGKYSD PS +DEWFKQG +VKA  V GS
Sbjct  50   NKLACKASVDDSDEDYLIDAPVSAGDGFSFSGGKYSDGPSQSDEWFKQGNMVKAFPVLGS  109

Query  389  GEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILS  568
            GEKAKDPIFGLTMG+GSQS +D+FRWFCVE+G A +  ++L+HGFPSQAYSYRK+LPILS
Sbjct  110  GEKAKDPIFGLTMGSGSQSPADVFRWFCVESGIADNPPVLLVHGFPSQAYSYRKILPILS  169

Query  569  KSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            K +H IAFDW+GFGFSDKPQP YGF+YTL+EYVSSLES+IN+L
Sbjct  170  KDYHAIAFDWIGFGFSDKPQPGYGFNYTLNEYVSSLESLINSL  212



>ref|XP_007049546.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX93703.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=402

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 143/173 (83%), Gaps = 10/173 (6%)
 Frame = +2

Query  212  SRFLCR-------SSSDGNE---DYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRI  361
            ++ LCR       S S+ NE   DY +DAPVS GDGFSFSGGKYSDE +P+DEWFK+G+ 
Sbjct  38   AQHLCRKPLRLSCSRSNANEPQDDYLIDAPVSAGDGFSFSGGKYSDEANPSDEWFKRGKY  97

Query  362  VKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYS  541
            VKAH V G+GEKAKDPIFGLTMGAGSQ+S D+FRWFCVE+G A +  ++LIHGFPSQAYS
Sbjct  98   VKAHPVGGTGEKAKDPIFGLTMGAGSQASGDVFRWFCVESGNADNHTVILIHGFPSQAYS  157

Query  542  YRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            YRKVLP+LSK++  IAFDWLGFGFSDKPQP+YGFDY+L EYVS+LES +N + 
Sbjct  158  YRKVLPVLSKNYRAIAFDWLGFGFSDKPQPRYGFDYSLGEYVSALESFVNEVA  210



>ref|XP_010678992.1| PREDICTED: uncharacterized protein LOC104894460 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 143/171 (84%), Gaps = 6/171 (4%)
 Frame = +2

Query  188  RNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVK  367
            R  +SLKL+   C    D    Y LDAPVS GDGFSFSGGKYSD  SPADEWFKQG++VK
Sbjct  40   RRKKSLKLN---CSQEEDF---YLLDAPVSAGDGFSFSGGKYSDGSSPADEWFKQGKMVK  93

Query  368  AHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYR  547
            A++V GSGEKAKDPIFGL MG+ SQSS D+FRWFCVE+G   +  ++LIHGFPSQAYSYR
Sbjct  94   AYVVGGSGEKAKDPIFGLAMGSSSQSSDDIFRWFCVESGNPDNPSVMLIHGFPSQAYSYR  153

Query  548  KVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            KV+PILSK++HVIAFDWLGFGFS+KPQPKYGFDYT++EYV+SL+++IN L 
Sbjct  154  KVIPILSKNYHVIAFDWLGFGFSEKPQPKYGFDYTMEEYVASLKTLINDLV  204



>ref|XP_008802246.1| PREDICTED: epoxide hydrolase 3 [Phoenix dactylifera]
Length=379

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  215  RFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGE  394
            RF C SS  G E+Y +DAPVS+GDGFSFSGGKYSD PS +DEWF QG+++KAH V G   
Sbjct  28   RFRCMSSPSGEEEYLVDAPVSIGDGFSFSGGKYSDGPSRSDEWFAQGKMIKAHPVYGGKG  87

Query  395  KAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKS  574
            KAKDPIFGLTMGAGSQS +D+FRWFC+E G++ +  ++LIHGFPSQAYSYRKVL +LS+ 
Sbjct  88   KAKDPIFGLTMGAGSQSPADVFRWFCIEKGSSANPLVILIHGFPSQAYSYRKVLTVLSED  147

Query  575  HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            +H IAFDWLGFGFSDKPQPK+GFDYTLD+Y SSLES++N + 
Sbjct  148  YHAIAFDWLGFGFSDKPQPKFGFDYTLDDYASSLESLVNEMA  189



>ref|XP_004510184.1| PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate 
hydrolase-like isoform X1 [Cicer arietinum]
Length=388

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 8/190 (4%)
 Frame = +2

Query  128  SLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsgg  307
            S C   SQF   +F  ++ S  Y  LK S      +S+  +DY LDAPVSVGDGFSFSGG
Sbjct  10   SYCYFHSQFSKKRFPSRKKS--YLKLKCS------TSNEEQDYLLDAPVSVGDGFSFSGG  61

Query  308  KYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT  487
            KYSD P+P+DEWFKQG++VKA+ +  +GEKAKDPIFGLTMG  SQS+ D FRWFCVE+G+
Sbjct  62   KYSDGPNPSDEWFKQGKMVKAYSIPRTGEKAKDPIFGLTMGTSSQSTGDRFRWFCVESGS  121

Query  488  AYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYV  667
              +  ++LIHGFPSQAYSYRKVLP+LSK +  I FDWLGFGFSDKPQP+YGFDYTLDEYV
Sbjct  122  VDNPTVILIHGFPSQAYSYRKVLPVLSKDYRAITFDWLGFGFSDKPQPRYGFDYTLDEYV  181

Query  668  SSLESVINTL  697
             SLES+I+ L
Sbjct  182  LSLESLIDEL  191



>ref|XP_004510185.1| PREDICTED: 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate 
hydrolase-like isoform X2 [Cicer arietinum]
Length=382

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 8/190 (4%)
 Frame = +2

Query  128  SLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsgg  307
            S C   SQF   +F  ++ S  Y  LK S      +S+  +DY LDAPVSVGDGFSFSGG
Sbjct  10   SYCYFHSQFSKKRFPSRKKS--YLKLKCS------TSNEEQDYLLDAPVSVGDGFSFSGG  61

Query  308  KYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT  487
            KYSD P+P+DEWFKQG++VKA+ +  +GEKAKDPIFGLTMG  SQS+ D FRWFCVE+G+
Sbjct  62   KYSDGPNPSDEWFKQGKMVKAYSIPRTGEKAKDPIFGLTMGTSSQSTGDRFRWFCVESGS  121

Query  488  AYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYV  667
              +  ++LIHGFPSQAYSYRKVLP+LSK +  I FDWLGFGFSDKPQP+YGFDYTLDEYV
Sbjct  122  VDNPTVILIHGFPSQAYSYRKVLPVLSKDYRAITFDWLGFGFSDKPQPRYGFDYTLDEYV  181

Query  668  SSLESVINTL  697
             SLES+I+ L
Sbjct  182  LSLESLIDEL  191



>ref|XP_010926738.1| PREDICTED: uncharacterized protein LOC105048934 isoform X3 [Elaeis 
guineensis]
Length=336

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 8/170 (5%)
 Frame = +2

Query  215  RFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGE  394
            RF C SS  G E+Y +DAPVS+GDGFSFSGGKYSD PS +DEWF QG+++KAH V G   
Sbjct  28   RFRCMSSPSGEEEYLVDAPVSIGDGFSFSGGKYSDGPSRSDEWFAQGKMIKAHPVYGGKG  87

Query  395  KAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKS  574
            KAKDPIFGLTMGAGSQS +D+FRWFC+E G++ +  ++LIHGFPSQAYSYRKVLP+LS+ 
Sbjct  88   KAKDPIFGLTMGAGSQSPADVFRWFCIEKGSSANPLVILIHGFPSQAYSYRKVLPVLSED  147

Query  575  HHVIAFDWLGFGFSDKPQPKYGFDYTLDE--------YVSSLESVINTLT  700
            +H +AFDWLGFGFSDKPQPKYGFDYTLD         Y SSLES++N + 
Sbjct  148  YHAVAFDWLGFGFSDKPQPKYGFDYTLDGRHYKPQLYYASSLESLVNEMA  197



>ref|XP_009420326.1| PREDICTED: uncharacterized protein LOC104000104 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            + S F C S    NEDY++D P S GDGF FSGGKYSD PS +DEWF QG++VKA+ V G
Sbjct  25   RRSGFRCGSIFGDNEDYYVDEPESAGDGFFFSGGKYSDGPSRSDEWFAQGKMVKAYPVYG  84

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
               KAKDP+FGLT+GAGSQS +DLFRWFCVE G++ +  ++L+HGFPSQAYSYRKVLP+L
Sbjct  85   GKGKAKDPVFGLTLGAGSQSEADLFRWFCVEAGSSLNPKVILVHGFPSQAYSYRKVLPVL  144

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            S+ HH IAFDWLGFGFSDKPQP+YGFDYTLDEYVS+L S+++ L 
Sbjct  145  SEDHHAIAFDWLGFGFSDKPQPRYGFDYTLDEYVSALGSLVDVLV  189



>gb|EPS68183.1| hypothetical protein M569_06589, partial [Genlisea aurea]
Length=335

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  248  EDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTM  427
            +DY +DA  S+GDGFSF+GGKYS+EPSPAD WF+QG+IVKAH V+G+GEKAKDPIFGL M
Sbjct  1    QDYLIDASASIGDGFSFTGGKYSNEPSPADIWFEQGKIVKAHAVDGTGEKAKDPIFGLAM  60

Query  428  GAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGF  607
               SQSSSD FRWFCVE+G+  +  IVLIHGFPSQAYSYR  LPILSK +HVIAFDWLGF
Sbjct  61   AGSSQSSSDEFRWFCVESGSPENPTIVLIHGFPSQAYSYRNALPILSKDYHVIAFDWLGF  120

Query  608  GFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            GFSDKPQP YGF+YTL EYV SLES+IN L 
Sbjct  121  GFSDKPQPGYGFNYTLKEYVESLESLINKLA  151



>ref|XP_010435351.1| PREDICTED: uncharacterized protein LOC104719184 [Camelina sativa]
Length=278

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +2

Query  218  FLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEK  397
            F+C+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V GSG +
Sbjct  44   FICKS--NDKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGGSGVE  101

Query  398  AKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSH  577
            AKDPIFGLTMGA SQ+S DLFRWFCVE+G+     ++LIHGFPSQAYSYRK LP+LSK++
Sbjct  102  AKDPIFGLTMGASSQASKDLFRWFCVESGSVDSPPVILIHGFPSQAYSYRKTLPVLSKNY  161

Query  578  HVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
              IAFDWLGFGFSDKPQ  YGF+YT+DE+VSSLES I+ +T
Sbjct  162  RAIAFDWLGFGFSDKPQAGYGFNYTMDEFVSSLESFIDEVT  202



>ref|XP_009139658.1| PREDICTED: uncharacterized hydrolase YNR064C [Brassica rapa]
 emb|CDY39712.1| BnaA04g07230D [Brassica napus]
Length=393

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +2

Query  194  YQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAH  373
            Y   K   F+C+S  +  +DY +DAPVS GDGFSFSGGKYSD+PSP+DEW KQG+ VKAH
Sbjct  35   YSPAKHPGFICKS--NNKDDYLIDAPVSAGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAH  92

Query  374  LVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKV  553
             V GSGE+AKDPIFGLTMG+ SQ+S D+FRWFCVE+G      ++LIHGFPSQAYSYRK 
Sbjct  93   RVGGSGEEAKDPIFGLTMGSSSQASKDVFRWFCVESGKVDSPPVILIHGFPSQAYSYRKA  152

Query  554  LPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            LP+LSK++  IAFDWLGFGFSDKPQ  YGF+YTLDEYVSSLES I+ +T
Sbjct  153  LPVLSKNYRAIAFDWLGFGFSDKPQAGYGFNYTLDEYVSSLESFIDEVT  201



>gb|KEH18035.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=344

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  245  NEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLT  424
             +DY LDAP+SVGDGFSFSGGKYSD P+P+DEWFKQG++VKA+ + G+GEKAKDPIFGLT
Sbjct  3    QDDYLLDAPISVGDGFSFSGGKYSDGPNPSDEWFKQGKMVKAYSIPGTGEKAKDPIFGLT  62

Query  425  MGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLG  604
            MG  SQ++ D FRWFCVE G+  +  ++LIHGFPSQAYSYRKVLP+LSK +  + FDWLG
Sbjct  63   MGTSSQATGDRFRWFCVERGSVDNPSVILIHGFPSQAYSYRKVLPVLSKDYRAVTFDWLG  122

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSDKPQPKYGFDYTLDEYVSSLES+I+ L 
Sbjct  123  FGFSDKPQPKYGFDYTLDEYVSSLESLIDELA  154



>ref|XP_006848442.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Amborella trichopoda]
 gb|ERN10023.1| hypothetical protein AMTR_s00013p00241300 [Amborella trichopoda]
Length=395

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K   F  R++ + +E Y +DAPVSVGDGFSFSGGKYSD PS +DEWFKQG+IVKAH V G
Sbjct  40   KRCNFNTRATGEEDEGYLIDAPVSVGDGFSFSGGKYSDAPSLSDEWFKQGKIVKAHPVLG  99

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            +GEKAKDPIFGLTMG GSQ+SSD+FRWF VE+G      ++LIHGFPSQAYSYRKV+PIL
Sbjct  100  TGEKAKDPIFGLTMGVGSQASSDVFRWFSVESGRTGKHLVILIHGFPSQAYSYRKVIPIL  159

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVIN  691
            +  +HV+AFDWLGFGFSDKPQPKYGFDYTL+EYV SL+S+++
Sbjct  160  AVDYHVVAFDWLGFGFSDKPQPKYGFDYTLNEYVDSLDSLLS  201



>ref|XP_002863288.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39547.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=393

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = +2

Query  155  PPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPA  334
            PP  +   R S +    K   F+C+SS    +DY +DAPVSVGDGFSFSGGKYSD+PSP+
Sbjct  26   PPSSYLFHRHSAS----KYHSFICKSSD--KDDYLIDAPVSVGDGFSFSGGKYSDQPSPS  79

Query  335  DEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLI  514
            DEW KQG+ VKAH V GSG +AKDPIFGLTMGA SQ+S DLFRWFCVE+G+     ++LI
Sbjct  80   DEWLKQGKWVKAHRVGGSGVEAKDPIFGLTMGASSQASKDLFRWFCVESGSVDSPPVILI  139

Query  515  HGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINT  694
            HGFPSQAYSYRK+LP+LSK++  IAFDWLGFGFSDKPQ  YGF+YT+DE+V+SLES I+ 
Sbjct  140  HGFPSQAYSYRKILPVLSKNYRAIAFDWLGFGFSDKPQAGYGFNYTMDEFVASLESFIDE  199

Query  695  LT  700
            +T
Sbjct  200  VT  201



>ref|XP_006414994.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
 gb|ESQ56447.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
Length=393

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K  RF+C+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V G
Sbjct  39   KYPRFICKS--NNQDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGG  96

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SG +AKDPIFGLTMGA SQ+S D+FRWFCVE+G      ++LIHGFPSQAYSYRK LP+L
Sbjct  97   SGVEAKDPIFGLTMGASSQASKDVFRWFCVESGNLDSPPVILIHGFPSQAYSYRKALPVL  156

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++  IAFDWLGFGFSDKPQ  YGF+YTLDE+VSSLES I+ +T
Sbjct  157  SKNYRAIAFDWLGFGFSDKPQAGYGFNYTLDEFVSSLESFIDEVT  201



>ref|XP_010926736.1| PREDICTED: epoxide hydrolase 3 isoform X1 [Elaeis guineensis]
Length=387

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 8/170 (5%)
 Frame = +2

Query  215  RFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGE  394
            RF C SS  G E+Y +DAPVS+GDGFSFSGGKYSD PS +DEWF QG+++KAH V G   
Sbjct  28   RFRCMSSPSGEEEYLVDAPVSIGDGFSFSGGKYSDGPSRSDEWFAQGKMIKAHPVYGGKG  87

Query  395  KAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKS  574
            KAKDPIFGLTMGAGSQS +D+FRWFC+E G++ +  ++LIHGFPSQAYSYRKVLP+LS+ 
Sbjct  88   KAKDPIFGLTMGAGSQSPADVFRWFCIEKGSSANPLVILIHGFPSQAYSYRKVLPVLSED  147

Query  575  HHVIAFDWLGFGFSDKPQPKYGFDYTLDE--------YVSSLESVINTLT  700
            +H +AFDWLGFGFSDKPQPKYGFDYTLD         Y SSLES++N + 
Sbjct  148  YHAVAFDWLGFGFSDKPQPKYGFDYTLDGRHYKPQLYYASSLESLVNEMA  197



>emb|CDY60486.1| BnaC04g55880D [Brassica napus]
Length=393

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +2

Query  191  NYQSLKLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKA  370
             Y   K   F+C+S  +  +DY +DAPVS GDGFSFSGGKYSD+PSP+DEW KQG+ VKA
Sbjct  34   RYSPAKHPGFICKS--NNKDDYLIDAPVSAGDGFSFSGGKYSDQPSPSDEWLKQGKWVKA  91

Query  371  HLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRK  550
            H V GSGE+AKDPIFGLTMG+ SQ+S D+FRWFCVE+G      ++LIHGFPSQ+YSYRK
Sbjct  92   HRVGGSGEEAKDPIFGLTMGSSSQASKDVFRWFCVESGKVDSPPVILIHGFPSQSYSYRK  151

Query  551  VLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
             LP LSK++  IAFDWLGFGFSDKPQ  YGF+YTLDEYVSSLES I+ +T
Sbjct  152  ALPALSKNYRAIAFDWLGFGFSDKPQAGYGFNYTLDEYVSSLESFIDEVT  201



>ref|XP_010450251.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Camelina sativa]
Length=394

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +2

Query  218  FLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEK  397
            F+C+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V GSG +
Sbjct  44   FICKS--NDKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGGSGVE  101

Query  398  AKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSH  577
            AKDPIFGLTMGA SQ+S DLFRWFCVE+G+     +VLIHGFPSQAYSYRK LP+LSK++
Sbjct  102  AKDPIFGLTMGASSQASKDLFRWFCVESGSVDSPPVVLIHGFPSQAYSYRKTLPVLSKNY  161

Query  578  HVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
              IAFDWLGFGFSDKPQ  YGF+YT+DE+VSSLES I+ +T
Sbjct  162  RAIAFDWLGFGFSDKPQAGYGFNYTMDEFVSSLESFIDEVT  202



>ref|XP_004292325.1| PREDICTED: uncharacterized hydrolase YNR064C-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=394

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  308  KYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT  487
            KYS EPSP+DEWFKQG+IVKA+   GSGEKAKDPIFGL MGA SQ+++D+FRWFCVE+G+
Sbjct  71   KYSGEPSPSDEWFKQGKIVKAYTSLGSGEKAKDPIFGLAMGADSQAAADVFRWFCVESGS  130

Query  488  AYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYV  667
            A +  ++LIHG PSQAYSYRKVLPILSK++H IAFDWLGFGFSDKPQPKYGFDYTL+EYV
Sbjct  131  ADNPSVILIHGLPSQAYSYRKVLPILSKAYHAIAFDWLGFGFSDKPQPKYGFDYTLNEYV  190

Query  668  SSLESVINTLT  700
            +SLES IN + 
Sbjct  191  TSLESFINEVA  201



>ref|XP_006282646.1| hypothetical protein CARUB_v10004987mg [Capsella rubella]
 gb|EOA15544.1| hypothetical protein CARUB_v10004987mg [Capsella rubella]
Length=395

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +2

Query  218  FLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEK  397
            F+C+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V GSG +
Sbjct  45   FICKS--NDKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGGSGVE  102

Query  398  AKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSH  577
            AKDPIFGLTMGA SQ+S DLFRWFCVE+G+     ++LIHGFPSQAYSYRK LP+LSK++
Sbjct  103  AKDPIFGLTMGASSQASKDLFRWFCVESGSVDSPPVILIHGFPSQAYSYRKTLPVLSKNY  162

Query  578  HVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
              IAFDWLGFGFSDKPQ  YGF+YT+DE+VSSLES I+ +T
Sbjct  163  RAIAFDWLGFGFSDKPQSGYGFNYTMDEFVSSLESFIDEVT  203



>emb|CAB41000.1| hydrolase-like protein [Arabidopsis thaliana]
 emb|CAB78325.1| hydrolase-like protein [Arabidopsis thaliana]
Length=319

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K   FLC+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V G
Sbjct  39   KYPSFLCKS--NNKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGG  96

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SG +AKDPIFGLTMGA SQ+S DLFRWF VE+G+     ++LIHGFPSQAYSYRK +P+L
Sbjct  97   SGVEAKDPIFGLTMGASSQASKDLFRWFSVESGSVDSPPVILIHGFPSQAYSYRKTIPVL  156

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++  IAFDWLGFGFSDKPQ  YGF+YT+DE+VSSLES I+ +T
Sbjct  157  SKNYRAIAFDWLGFGFSDKPQAGYGFNYTMDEFVSSLESFIDEVT  201



>ref|XP_009420324.1| PREDICTED: uncharacterized protein LOC104000104 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=381

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            + S F C S    NEDY++D P S GDGF FSGGKYSD PS +DEWF QG++VKA+ V G
Sbjct  25   RRSGFRCGSIFGDNEDYYVDEPESAGDGFFFSGGKYSDGPSRSDEWFAQGKMVKAYPVYG  84

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
               KAKDP+FGLT+GAGSQS +DLFRWFCVE G++ +  ++L+HGFPSQAYSYRKVLP+L
Sbjct  85   GKGKAKDPVFGLTLGAGSQSEADLFRWFCVEAGSSLNPKVILVHGFPSQAYSYRKVLPVL  144

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLD--EYVSSLESVINTLT  700
            S+ HH IAFDWLGFGFSDKPQP+YGFDYTLD  EYVS+L S+++ L 
Sbjct  145  SEDHHAIAFDWLGFGFSDKPQPRYGFDYTLDAAEYVSALGSLVDVLV  191



>ref|XP_010440628.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Camelina sativa]
Length=394

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +2

Query  218  FLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEK  397
            F+C+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V GSG +
Sbjct  44   FICKS--NDKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGGSGVE  101

Query  398  AKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSH  577
            AKDPIFGLTMGA SQ+S DLFRWFCVE+G+     ++LIHGFPSQAYSYRK LP+LSK++
Sbjct  102  AKDPIFGLTMGASSQASKDLFRWFCVESGSVDSPPVILIHGFPSQAYSYRKTLPVLSKNY  161

Query  578  HVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
              IAFDWLGFGFSDKPQ  YGF+Y++DE+VSSLES I+ +T
Sbjct  162  RAIAFDWLGFGFSDKPQAGYGFNYSMDEFVSSLESFIDEVT  202



>ref|NP_567394.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gb|AAL08293.1| AT4g12830/T20K18_180 [Arabidopsis thaliana]
 gb|AAL90986.1| AT4g12830/T20K18_180 [Arabidopsis thaliana]
 gb|AEE83190.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
Length=393

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K   FLC+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW KQG+ VKAH V G
Sbjct  39   KYPSFLCKS--NNKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLKQGKWVKAHRVGG  96

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SG +AKDPIFGLTMGA SQ+S DLFRWF VE+G+     ++LIHGFPSQAYSYRK +P+L
Sbjct  97   SGVEAKDPIFGLTMGASSQASKDLFRWFSVESGSVDSPPVILIHGFPSQAYSYRKTIPVL  156

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++  IAFDWLGFGFSDKPQ  YGF+YT+DE+VSSLES I+ +T
Sbjct  157  SKNYRAIAFDWLGFGFSDKPQAGYGFNYTMDEFVSSLESFIDEVT  201



>gb|AAM61500.1| hydrolase-like protein [Arabidopsis thaliana]
Length=393

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K   FLC+S  +  +DY +DAPVSVGDGFSFSGGKYSD+PSP+DEW  QG+ VKAH V G
Sbjct  39   KYPSFLCKS--NNKDDYLIDAPVSVGDGFSFSGGKYSDQPSPSDEWLNQGKWVKAHRVGG  96

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SG +AKDPIFGLTMGA SQ+S DLFRWF VE+G+     I+LIHGFPSQAYSYRK LP+L
Sbjct  97   SGVEAKDPIFGLTMGASSQASKDLFRWFSVESGSVDSPPIILIHGFPSQAYSYRKTLPVL  156

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++  IAFDWLGFGFSDKPQ  YGF+YT+DE+VSSLES I+ +T
Sbjct  157  SKNYRAIAFDWLGFGFSDKPQAGYGFNYTMDEFVSSLESFIDEVT  201



>gb|EEC72048.1| hypothetical protein OsI_04954 [Oryza sativa Indica Group]
Length=347

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DAP S+GDGFSFSGGKY+D PS +DEWF QGR+VKAH V G+  KAK
Sbjct  33   RAARPNDEDYYLIDAPESIGDGFSFSGGKYTDGPSKSDEWFAQGRMVKAHPVYGNKGKAK  92

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DPIFGLTMGA SQSS+D+FRWFCVE G++ +  ++ IHGFPSQAYSYR VLP++S ++H 
Sbjct  93   DPIFGLTMGAESQSSNDVFRWFCVEAGSSSNPPVLFIHGFPSQAYSYRNVLPVVSDNYHA  152

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            IAFDWLGFGFSDKPQP YGFDYTLDEY SSLES+IN + 
Sbjct  153  IAFDWLGFGFSDKPQPDYGFDYTLDEYTSSLESLINAVA  191



>ref|XP_006646615.1| PREDICTED: epoxide hydrolase 3-like [Oryza brachyantha]
Length=372

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DAP S+GDGFSFSGGKY+D PS +DEWF QGR+VKAH V G+  KAK
Sbjct  27   RAARPNDEDYYLIDAPESIGDGFSFSGGKYADGPSKSDEWFAQGRMVKAHPVYGNKGKAK  86

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DPIFGLTMGA SQSS D+FRWFCVE G++ +  ++ IHGFPSQAYSYR VLPI+S  +H 
Sbjct  87   DPIFGLTMGAKSQSSDDVFRWFCVEVGSSSNPYVLFIHGFPSQAYSYRNVLPIVSDKYHA  146

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            IAFDWLGFGFSDKPQP YGFDYTLDEY SSLES+IN + 
Sbjct  147  IAFDWLGFGFSDKPQPNYGFDYTLDEYTSSLESLINVIA  185



>gb|KDO43505.1| hypothetical protein CISIN_1g015903mg [Citrus sinensis]
Length=380

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K  R   R S    +DY +DAPVS GDGFSF GGKYSD  SPADEWFKQG+IVKA  V+G
Sbjct  42   KNRRKCLRISCTYEDDYLIDAPVSEGDGFSFFGGKYSDGSSPADEWFKQGKIVKAVTVSG  101

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SGE AKDPIFGL +G+ SQ+  ++FRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP+L
Sbjct  102  SGETAKDPIFGLDLGSASQAD-EIFRWFCVESGNADNHTVLLIHGFPSQAYSYRKVLPVL  160

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++H IAFDWLGFGFS+KPQP YGFDYTLDEYV+SLES +N + 
Sbjct  161  SKNYHAIAFDWLGFGFSEKPQPGYGFDYTLDEYVASLESFVNEIA  205



>ref|NP_001045213.1| Os01g0919700 [Oryza sativa Japonica Group]
 dbj|BAD87632.1| hydrolase-like [Oryza sativa Japonica Group]
 dbj|BAF07127.1| Os01g0919700 [Oryza sativa Japonica Group]
 dbj|BAG86873.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DAP S+GDGFSFSGGKY+D PS +DEWF QGR+VKAH V G+  KAK
Sbjct  33   RAARPNDEDYYLIDAPESIGDGFSFSGGKYTDGPSKSDEWFAQGRMVKAHPVYGNKGKAK  92

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DPIFGLTMGA SQSS+D+FRWFCVE G++ +  ++ IHGFPSQAYSYR VLP++S ++H 
Sbjct  93   DPIFGLTMGAESQSSNDVFRWFCVEAGSSSNPPVLFIHGFPSQAYSYRNVLPVVSDNYHA  152

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            IAFDWLGFGFSDKPQP YGFDYTLDEY SSLES+IN + 
Sbjct  153  IAFDWLGFGFSDKPQPDYGFDYTLDEYTSSLESLINAVA  191



>gb|KDO43504.1| hypothetical protein CISIN_1g015903mg [Citrus sinensis]
Length=398

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K  R   R S    +DY +DAPVS GDGFSF GGKYSD  SPADEWFKQG+IVKA  V+G
Sbjct  42   KNRRKCLRISCTYEDDYLIDAPVSEGDGFSFFGGKYSDGSSPADEWFKQGKIVKAVTVSG  101

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SGE AKDPIFGL +G+ SQ+  ++FRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP+L
Sbjct  102  SGETAKDPIFGLDLGSASQAD-EIFRWFCVESGNADNHTVLLIHGFPSQAYSYRKVLPVL  160

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++H IAFDWLGFGFS+KPQP YGFDYTLDEYV+SLES +N + 
Sbjct  161  SKNYHAIAFDWLGFGFSEKPQPGYGFDYTLDEYVASLESFVNEIA  205



>gb|EEE55899.1| hypothetical protein OsJ_04564 [Oryza sativa Japonica Group]
Length=395

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DAP S+GDGFSFSGGKY+D PS +DEWF QGR+VKAH V G+  KAK
Sbjct  33   RAARPNDEDYYLIDAPESIGDGFSFSGGKYTDGPSKSDEWFAQGRMVKAHPVYGNKGKAK  92

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DPIFGLTMGA SQSS+D+FRWFCVE G++ +  ++ IHGFPSQAYSYR VLP++S ++H 
Sbjct  93   DPIFGLTMGAESQSSNDVFRWFCVEAGSSSNPPVLFIHGFPSQAYSYRNVLPVVSDNYHA  152

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            IAFDWLGFGFSDKPQP YGFDYTLDEY SSLES+IN + 
Sbjct  153  IAFDWLGFGFSDKPQPDYGFDYTLDEYTSSLESLINAVA  191



>gb|KFK35301.1| hypothetical protein AALP_AA5G266800 [Arabis alpina]
Length=394

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 149/205 (73%), Gaps = 8/205 (4%)
 Frame = +2

Query  89   IHT-SFSSLHSQCHSLCTIASQFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLD  265
            IH  +FS+ H Q  S  T  S  P   +   R    Y   K  RF C+S  +  +DY +D
Sbjct  5    IHNPTFSNTH-QLRSSLTSVSASPTSSYLFSR----YSPTKHPRFFCKS--NNQDDYLID  57

Query  266  APvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQS  445
            APVSVGDGFSFSGGKYSD+PS +DEW K+G+ VKAH V GSG  AKDPIFGLTMGA SQ+
Sbjct  58   APVSVGDGFSFSGGKYSDQPSSSDEWLKKGKWVKAHRVGGSGLDAKDPIFGLTMGASSQA  117

Query  446  SSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKP  625
            S D+FRWF +E+G      ++LIHGFPSQ+YSYRK LP+LSK++  IAFDWLGFGFSDKP
Sbjct  118  SKDVFRWFSIESGNVDSPPVILIHGFPSQSYSYRKALPVLSKNYRAIAFDWLGFGFSDKP  177

Query  626  QPKYGFDYTLDEYVSSLESVINTLT  700
            Q  YGF+YTLD++VSSLES I+ +T
Sbjct  178  QAGYGFNYTLDDFVSSLESFIDEVT  202



>ref|XP_006447950.1| hypothetical protein CICLE_v10015502mg [Citrus clementina]
 gb|ESR61190.1| hypothetical protein CICLE_v10015502mg [Citrus clementina]
Length=398

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K  R   R S    +DY +DAPVS GDGFSF GGKYSD  SPADEWFKQG+IVKA  V+G
Sbjct  42   KNRRKCLRISCTYEDDYLIDAPVSEGDGFSFFGGKYSDGSSPADEWFKQGKIVKAVTVSG  101

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SGE AKDPIFGL +G+ SQ+  ++FRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP+L
Sbjct  102  SGETAKDPIFGLDLGSASQAD-EIFRWFCVESGNADNHTVLLIHGFPSQAYSYRKVLPVL  160

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++H IAFDWLGFGFS+KPQP YGFDY LDEYV+SLES +N + 
Sbjct  161  SKNYHAIAFDWLGFGFSEKPQPGYGFDYNLDEYVASLESFVNEIA  205



>ref|XP_011624946.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Amborella trichopoda]
Length=380

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K   F  R++ + +E Y +DAPVSVGDGFSFSGGKYSD PS +DEWFKQG+IVKAH V G
Sbjct  40   KRCNFNTRATGEEDEGYLIDAPVSVGDGFSFSGGKYSDAPSLSDEWFKQGKIVKAHPVLG  99

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            +GEKAKDPIFGLTMG GSQ+SSD+FRWF VE+G      ++LIHGFPSQAYSYRKV+PIL
Sbjct  100  TGEKAKDPIFGLTMGVGSQASSDVFRWFSVESGRTGKHLVILIHGFPSQAYSYRKVIPIL  159

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVS  670
            +  +HV+AFDWLGFGFSDKPQPKYGFDYTL+  VS
Sbjct  160  AVDYHVVAFDWLGFGFSDKPQPKYGFDYTLNGNVS  194



>ref|XP_009626422.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Nicotiana tomentosiformis]
Length=360

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 130/204 (64%), Gaps = 41/204 (20%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIAS----QFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDA  268
             ++LH  C  +   +       P HQFSL +        KL RF CRSSSD N+      
Sbjct  1    MATLHCHCFRMLPSSPPDRINLPLHQFSLPKYHGAQGRKKLLRFRCRSSSDNND------  54

Query  269  PvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSS  448
                                           VKAH V+G+GEKAKDP+FGLTMG GSQ+S
Sbjct  55   -------------------------------VKAHPVSGTGEKAKDPLFGLTMGGGSQAS  83

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            +DLFRWFCVE+G+  +S IVL+HG PSQAYSYRK+LPIL K++H IAFDWLGFGFSDKPQ
Sbjct  84   TDLFRWFCVESGSTDNSTIVLVHGLPSQAYSYRKILPILEKNYHAIAFDWLGFGFSDKPQ  143

Query  629  PKYGFDYTLDEYVSSLESVINTLT  700
            P+YGFDYTLDEYV+SLES++N LT
Sbjct  144  PRYGFDYTLDEYVASLESILNALT  167



>ref|XP_006469341.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Citrus sinensis]
Length=398

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K  R   R S    +DY +DAPVS GDGFSF GGKYSD  SPADEWFKQG+IVKA  V+G
Sbjct  42   KNRRKCLRISCTYEDDYLIDAPVSEGDGFSFFGGKYSDGSSPADEWFKQGKIVKAVTVSG  101

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPIL  565
            SGE AKDPIFGL +G+ SQ+  ++FRWFCVE+G A +  ++LIHGFPSQAYSYRKVLP+L
Sbjct  102  SGETAKDPIFGLDLGSASQAD-EIFRWFCVESGNADNHTVLLIHGFPSQAYSYRKVLPVL  160

Query  566  SKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SK++H IAFDW GFGFS+KPQP YGFDY LDEYV+SLES +N + 
Sbjct  161  SKNYHAIAFDWPGFGFSEKPQPGYGFDYNLDEYVASLESFVNEIA  205



>ref|XP_009775314.1| PREDICTED: epoxide hydrolase 3 isoform X2 [Nicotiana sylvestris]
Length=360

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 127/204 (62%), Gaps = 41/204 (20%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIAS----QFPPHQFSLKRTSRNYQSLKLSRFLCRSSSDGNEDYFLDA  268
             ++LH  C  +   +       P HQFS  +        KL +F  RSSSD NE      
Sbjct  1    MATLHCHCFRMLPSSPPDRINLPLHQFSFPKYHGAQGRKKLLQFHFRSSSDNNE------  54

Query  269  PvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSS  448
                                           VKAH V+G+GEKAKDP+FGLTMG GSQ+S
Sbjct  55   -------------------------------VKAHPVSGTGEKAKDPLFGLTMGGGSQAS  83

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            SDLFRWFCVE G+  +S IVL+HG PSQAYSYRKVLPIL K++H IAFDWLGFGFSDKPQ
Sbjct  84   SDLFRWFCVENGSTDNSTIVLVHGLPSQAYSYRKVLPILEKNYHAIAFDWLGFGFSDKPQ  143

Query  629  PKYGFDYTLDEYVSSLESVINTLT  700
            P+YGFDYTLDEYV+SLES+IN LT
Sbjct  144  PRYGFDYTLDEYVASLESIINALT  167



>ref|XP_011458132.1| PREDICTED: uncharacterized hydrolase YNR064C-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=389

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 5/131 (4%)
 Frame = +2

Query  308  KYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT  487
            KYS EPSP+DEWFKQG+IVKA+   GSGEKAKDPIFGL MGA SQ+++D+FRWFCVE+G+
Sbjct  71   KYSGEPSPSDEWFKQGKIVKAYTSLGSGEKAKDPIFGLAMGADSQAAADVFRWFCVESGS  130

Query  488  AYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYV  667
            A +  ++LIHG PSQAYSYRKVLPILSK++H IAFDWL     DKPQPKYGFDYTL+EYV
Sbjct  131  ADNPSVILIHGLPSQAYSYRKVLPILSKAYHAIAFDWL-----DKPQPKYGFDYTLNEYV  185

Query  668  SSLESVINTLT  700
            +SLES IN + 
Sbjct  186  TSLESFINEVA  196



>ref|XP_004971072.1| PREDICTED: uncharacterized protein LOC101762331 isoform X2 [Setaria 
italica]
Length=311

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DA  S+GDGFSFSGGKY + PS +DEWF QG+++ A+ V G   KAK
Sbjct  35   RAALPNDEDYYLIDAEESIGDGFSFSGGKYGEGPSKSDEWFAQGKMIDAYPVYGDKGKAK  94

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DP FGLTMG+GSQ S D+FRWFCVE G + +  ++LIHG PSQAYSYR VLP+LS  +H 
Sbjct  95   DPFFGLTMGSGSQPSDDVFRWFCVEAGNSSNPKVLLIHGLPSQAYSYRNVLPVLSDKYHA  154

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            +AFDWLGFGFSDKPQPKYGFDYTLDEY +SLES++N + 
Sbjct  155  VAFDWLGFGFSDKPQPKYGFDYTLDEYTASLESLVNAVA  193



>gb|ACG27604.1| hydrolase-like protein [Zea mays]
Length=380

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DA  S+GDGFSFSGGKY D PS +DEWF QG++V A+ V G   KAK
Sbjct  35   RAALPKDEDYYLIDADESIGDGFSFSGGKYGDGPSKSDEWFAQGKMVNAYPVYGDKGKAK  94

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DP FGLTMG+GSQSS D+FRWFCVE G++ +  ++LIHG PSQAYSYR V+P+L+  +H 
Sbjct  95   DPFFGLTMGSGSQSSYDIFRWFCVEAGSSSNPKVLLIHGLPSQAYSYRNVMPVLADKYHA  154

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            IAFDWLGFGFSDKPQPKYGFDYTLDEY SSLE ++N + 
Sbjct  155  IAFDWLGFGFSDKPQPKYGFDYTLDEYTSSLEFLVNAVA  193



>ref|XP_004971071.1| PREDICTED: uncharacterized protein LOC101762331 isoform X1 [Setaria 
italica]
Length=380

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +2

Query  227  RSSSDGNEDYFL-DAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAK  403
            R++   +EDY+L DA  S+GDGFSFSGGKY + PS +DEWF QG+++ A+ V G   KAK
Sbjct  35   RAALPNDEDYYLIDAEESIGDGFSFSGGKYGEGPSKSDEWFAQGKMIDAYPVYGDKGKAK  94

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            DP FGLTMG+GSQ S D+FRWFCVE G + +  ++LIHG PSQAYSYR VLP+LS  +H 
Sbjct  95   DPFFGLTMGSGSQPSDDVFRWFCVEAGNSSNPKVLLIHGLPSQAYSYRNVLPVLSDKYHA  154

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            +AFDWLGFGFSDKPQPKYGFDYTLDEY +SLES++N + 
Sbjct  155  VAFDWLGFGFSDKPQPKYGFDYTLDEYTASLESLVNAVA  193



>gb|EMT05833.1| hypothetical protein F775_06870 [Aegilops tauschii]
Length=441

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  314  SDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAY  493
            ++ PS +DEWF QGR+VKAH + G+ EKAKDP FGLTMG+GSQSS D+F WFCVE G++ 
Sbjct  71   AEGPSKSDEWFAQGRMVKAHALYGNKEKAKDPFFGLTMGSGSQSSGDVFNWFCVEAGSSS  130

Query  494  DSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  673
            +  ++LIHGFPSQAYSYR VLP+LS  +  IAFDWLGFGFSDKPQPKYGFDYTLDEY S+
Sbjct  131  NPTVLLIHGFPSQAYSYRNVLPVLSDKYRSIAFDWLGFGFSDKPQPKYGFDYTLDEYTSA  190

Query  674  LESVINTLT  700
            LES+I+ + 
Sbjct  191  LESLIDAVA  199



>ref|XP_003564939.1| PREDICTED: epoxide hydrolase 3 [Brachypodium distachyon]
Length=378

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +2

Query  314  SDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAY  493
            ++E S +DEWF QGR+VKAH + GS EKAKDP FGLTMG  SQSS D+F WFCVE G++ 
Sbjct  62   AEELSKSDEWFAQGRMVKAHALYGSKEKAKDPFFGLTMGKESQSSDDVFSWFCVEAGSSS  121

Query  494  DSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  673
            +  ++L+HGFPSQAYSYR VLP+LS  +H IAFDWLGFGFSDKPQPKYGFDYTLDE+ SS
Sbjct  122  NHTVLLVHGFPSQAYSYRNVLPVLSDKYHPIAFDWLGFGFSDKPQPKYGFDYTLDEFTSS  181

Query  674  LESVINTLT  700
            LES+IN + 
Sbjct  182  LESLINAVA  190



>emb|CDM85669.1| unnamed protein product [Triticum aestivum]
Length=375

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +2

Query  314  SDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAY  493
            ++ PS +DEWF QGR+VKAH + G+ EKAKDP FGLTMG+GSQSS D+F WFC E G++ 
Sbjct  60   AEGPSKSDEWFAQGRMVKAHALYGNKEKAKDPFFGLTMGSGSQSSGDVFNWFCAEAGSSS  119

Query  494  DSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  673
            +  ++LIHGFPSQAYSYR VLP+L+  +  IAFDWLGFGFSDKPQPKYGFDYTLDEY S+
Sbjct  120  NPTVLLIHGFPSQAYSYRNVLPVLADKYRCIAFDWLGFGFSDKPQPKYGFDYTLDEYTSA  179

Query  674  LESVINTLT  700
            LES+I+ + 
Sbjct  180  LESLIDAVA  188



>gb|EMS59018.1| hypothetical protein TRIUR3_05973 [Triticum urartu]
Length=502

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  314  SDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAY  493
            ++ PS +DEWF QGR+VKAH + G+ EKAKDP FGLTMG+GSQSS D+F WFCVE G++ 
Sbjct  213  AEGPSKSDEWFAQGRMVKAHALYGNKEKAKDPFFGLTMGSGSQSSGDVFNWFCVEAGSSS  272

Query  494  DSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSS  673
            +  ++LIHGFPSQAYSYR VLP+LS  +  IAFDWLGFGFSDKPQPKYGFDYTLDEY S+
Sbjct  273  NPTVLLIHGFPSQAYSYRNVLPVLSDKYRSIAFDWLGFGFSDKPQPKYGFDYTLDEYTSA  332

Query  674  LESVINTLT  700
            LES+I+ + 
Sbjct  333  LESLIDAVA  341



>ref|XP_001751246.1| predicted protein [Physcomitrella patens]
 gb|EDQ83563.1| predicted protein, partial [Physcomitrella patens]
Length=347

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 5/154 (3%)
 Frame = +2

Query  251  DYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMG  430
            DY +DAPVS GDGFSF+GG+YSDE   ADEWF +G++VKA+ V G  EKAKDP+FGL MG
Sbjct  1    DYLIDAPVSAGDGFSFAGGEYSDELGRADEWFARGKMVKAYPVEGGLEKAKDPLFGLAMG  60

Query  431  AGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWL---  601
              SQ+S D FRWF VE G   +  ++L+HGFPSQAYSYR V+  LS  +HV+AFDWL   
Sbjct  61   EASQTSDDSFRWFYVEEGDRKNPTVLLVHGFPSQAYSYRNVMSDLSSDYHVVAFDWLGNG  120

Query  602  --GFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
              GFGFSDKPQPKYGF+YT DEY ++L+ +++ L
Sbjct  121  LAGFGFSDKPQPKYGFNYTTDEYATALKLLVDAL  154



>ref|NP_001132271.2| uncharacterized protein LOC100193707 [Zea mays]
 gb|ACF81048.2| unknown [Zea mays]
Length=301

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  359  IVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
            +V A+ V G   KAKDP FGLTMG+GSQSS D+FRWFCVE G++    ++LIHG PSQAY
Sbjct  1    MVNAYPVYGDKGKAKDPFFGLTMGSGSQSSYDIFRWFCVEAGSSSSPKVLLIHGLPSQAY  60

Query  539  SYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            SYR V+P+L+  +H IAFDWLGFGFSDKPQPKYGFDYTLDEY SSLE ++N + 
Sbjct  61   SYRNVMPVLADKYHAIAFDWLGFGFSDKPQPKYGFDYTLDEYTSSLEFLVNAVA  114



>tpg|DAA56123.1| TPA: hydrolase-like protein [Zea mays]
 tpg|DAA56124.1| TPA: hydrolase-like protein [Zea mays]
Length=302

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  362  VKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYS  541
            V A+ V G   KAKDP FGLTMG+GSQSS D+FRWFCVE G++    ++LIHG PSQAYS
Sbjct  3    VNAYPVYGDKGKAKDPFFGLTMGSGSQSSYDIFRWFCVEAGSSSSPKVLLIHGLPSQAYS  62

Query  542  YRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            YR V+P+L+  +H IAFDWLGFGFSDKPQPKYGFDYTLDEY SSLE ++N + 
Sbjct  63   YRNVMPVLADKYHAIAFDWLGFGFSDKPQPKYGFDYTLDEYTSSLEFLVNAVA  115



>gb|ACU20429.1| unknown [Glycine max]
Length=116

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  425  MGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLG  604
            MG+GSQ++ D FRWFCVE+G+A +  ++LIHGFPSQAYSYRKVLP+LSK +HVIAFDWLG
Sbjct  1    MGSGSQATGDRFRWFCVESGSADNPSVILIHGFPSQAYSYRKVLPVLSKDYHVIAFDWLG  60

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FG SDKPQP+YGFDYTLDEYVSSLES+I+ L 
Sbjct  61   FGLSDKPQPRYGFDYTLDEYVSSLESLIDELA  92



>ref|XP_008356682.1| PREDICTED: uncharacterized protein LOC103420396 [Malus domestica]
Length=236

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 128/212 (60%), Gaps = 38/212 (18%)
 Frame = +2

Query  101  FSSLHSQCHSLCTIASQFPPH--QFSLKRTSRNYQSLKLS-RFLCRSSSDGNEDYFLDAP  271
             ++  ++  SLC  + Q   H    SL     N +  K + +F CRS  +G +DY++DAP
Sbjct  1    MAATQAKTPSLCYYSHQLHNHIPASSLXLVGNNLKXHKKTLKFTCRS--NGQDDYYIDAP  58

Query  272  vsvgdgfsfsggKYSDEPSPADEWFKQGR---IVKAHLVNGSGEKAKDPIFGLTMGAGSQ  442
            V VGDGFS                F  G    +VKA+   GSGEKAKDPIFGL MGA SQ
Sbjct  59   VEVGDGFS----------------FSGGAXLILVKAYAAFGSGEKAKDPIFGLAMGADSQ  102

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLG------  604
            + +D+F        +A +  ++LIHG PSQAYSY KVLPILSK +H IAFDWLG      
Sbjct  103  AXTDVF--------SADNPSVILIHGXPSQAYSYSKVLPILSKDYHAIAFDWLGKNQDHK  154

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSDKPQPKYG DYT +E+ +SLES IN ++
Sbjct  155  FGFSDKPQPKYGXDYTTNEFXASLESFINEVS  186



>ref|XP_006414993.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
 gb|ESQ56446.1| hypothetical protein EUTSA_v10025411mg [Eutrema salsugineum]
Length=284

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  425  MGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLG  604
            MGA SQ+S D+FRWFCVE+G      ++LIHGFPSQAYSYRK LP+LSK++  IAFDWLG
Sbjct  1    MGASSQASKDVFRWFCVESGNLDSPPVILIHGFPSQAYSYRKALPVLSKNYRAIAFDWLG  60

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSDKPQ  YGF+YTLDE+VSSLES I+ +T
Sbjct  61   FGFSDKPQAGYGFNYTLDEFVSSLESFIDEVT  92



>gb|ABK94940.1| unknown [Populus trichocarpa]
Length=282

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            RWFCVE+G A +  ++LIHGFPSQAYSYRKVLP LSK++H IAFDWLGFGFSDKPQP+YG
Sbjct  11   RWFCVESGNADNPTVILIHGFPSQAYSYRKVLPTLSKNYHAIAFDWLGFGFSDKPQPRYG  70

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT+DE+V+SLES+IN +
Sbjct  71   FDYTMDEFVASLESLINEI  89



>ref|XP_002983979.1| hypothetical protein SELMODRAFT_119529, partial [Selaginella 
moellendorffii]
 gb|EFJ14991.1| hypothetical protein SELMODRAFT_119529, partial [Selaginella 
moellendorffii]
Length=334

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +2

Query  308  KYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT  487
            KYSDE    D+W+ +G  + A+   GS    K+P+FG+ +GA SQ SS+ +RWF VE GT
Sbjct  15   KYSDERDKTDDWWARGDFMYAYSPQGSSNTVKEPLFGMKLGAQSQISSNEYRWFYVEEGT  74

Query  488  AYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYV  667
              +  I+L+HG  SQAYS+R V+ IL+K +HVIA DWLGFGFSDKP    GF+YT  EY 
Sbjct  75   NNNHTILLLHGLCSQAYSFRHVISILAKDYHVIAVDWLGFGFSDKPLYGNGFNYTTQEYT  134

Query  668  SSLESVINTL  697
            ++L  +++ L
Sbjct  135  NALSCLVDRL  144



>ref|XP_002960156.1| hypothetical protein SELMODRAFT_402209 [Selaginella moellendorffii]
 gb|EFJ37695.1| hypothetical protein SELMODRAFT_402209 [Selaginella moellendorffii]
Length=391

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +2

Query  308  KYSDEPSPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT  487
            KYSDE    D+W+ +G  + A+   GS    K+P+FG+ +GA SQ SS+ +RWF VE GT
Sbjct  61   KYSDERDKTDDWWARGDFMYAYSPQGSSNTVKEPLFGMKLGAQSQISSNEYRWFYVEEGT  120

Query  488  AYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYV  667
              +  I+L+HG  SQAYS+R V+ IL+K +HVIA DWLGFGFSDKP    GF+YT  EY 
Sbjct  121  NNNHTILLLHGLCSQAYSFRHVISILAKDYHVIAVDWLGFGFSDKPLYGNGFNYTTQEYT  180

Query  668  SSLESVINTL  697
            ++L  +++ L
Sbjct  181  NALSCLVDRL  190



>ref|XP_011624947.1| PREDICTED: uncharacterized protein LOC18438190 isoform X3 [Amborella 
trichopoda]
Length=330

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  206  KLSRFLCRSSSDGNEDYFLDAPvsvgdgfsfsggKYSDEPSPADEWFKQGRIVKAHLVNG  385
            K   F  R++ + +E Y +DAPVSVGDGFSFSGGKYSD PS +DEWFKQG+IVKAH V G
Sbjct  40   KRCNFNTRATGEEDEGYLIDAPVSVGDGFSFSGGKYSDAPSLSDEWFKQGKIVKAHPVLG  99

Query  386  SGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAY  538
            +GEKAKDPIFGLTMG GSQ+SSD+FRWF VE+G      ++LIHGFPSQ Y
Sbjct  100  TGEKAKDPIFGLTMGVGSQASSDVFRWFSVESGRTGKHLVILIHGFPSQGY  150



>ref|NP_001054059.1| Os04g0644600 [Oryza sativa Japonica Group]
 emb|CAD41916.2| OSJNBa0033G05.17 [Oryza sativa Japonica Group]
 dbj|BAF15973.1| Os04g0644600 [Oryza sativa Japonica Group]
 gb|EAZ32187.1| hypothetical protein OsJ_16393 [Oryza sativa Japonica Group]
 dbj|BAG94379.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS+  S   RWF  ETG+A      +V IHG PSQ++SYR V+  ++ + +H  A DW+G
Sbjct  115  GSRVKSGKLRWFVRETGSAGARRGTVVFIHGAPSQSFSYRMVMSQMADAGYHCFAPDWIG  174

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSD PQP YGFDYT +E+  SL+ +++TL 
Sbjct  175  FGFSDMPQPGYGFDYTEEEFHKSLDELLSTLN  206



>emb|CAJ86155.1| H0413E07.8 [Oryza sativa Indica Group]
 gb|EAY95781.1| hypothetical protein OsI_17656 [Oryza sativa Indica Group]
Length=392

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS+  S   RWF  ETG+A      +V IHG PSQ++SYR V+  ++ + +H  A DW+G
Sbjct  115  GSRVKSGKLRWFVRETGSAGARRGTVVFIHGAPSQSFSYRMVMSQMADAGYHCFAPDWIG  174

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSD PQP YGFDYT +E+  SL+ +++TL 
Sbjct  175  FGFSDMPQPGYGFDYTEEEFHKSLDELLSTLN  206



>ref|XP_006652910.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Oryza brachyantha]
Length=391

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 61/92 (66%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            G++  S   RWF  ETG+A      +V IHG P+Q++SYR V+  ++ + +H  A DW+G
Sbjct  114  GTRVKSGKLRWFVRETGSAGARRGTVVFIHGAPTQSFSYRMVMSQMADAGYHCFAPDWIG  173

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFSD PQP YGFDYT +E+  SL+ ++ TL 
Sbjct  174  FGFSDMPQPGYGFDYTEEEFHKSLDELLGTLN  205



>ref|XP_004135862.2| PREDICTED: uncharacterized protein LOC101210082 [Cucumis sativus]
 gb|KGN45257.1| hypothetical protein Csa_7G432390 [Cucumis sativus]
Length=390

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   +  FRWF  ETG+A      IV +HG P+Q+YSYR V+  LS    H  A DW+G
Sbjct  113  GSYVKAGKFRWFVRETGSAKSRRGTIVFLHGAPTQSYSYRVVMSELSAFGFHCFAPDWIG  172

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  +L+ +++ L
Sbjct  173  FGFSDKPQPGYGFNYTEKEYHEALDKLLDML  203



>ref|XP_007135767.1| hypothetical protein PHAVU_010G157100g [Phaseolus vulgaris]
 gb|ESW07761.1| hypothetical protein PHAVU_010G157100g [Phaseolus vulgaris]
Length=372

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q+YSYR V+  LS +  H  A DW+G
Sbjct  95   GSYVKSGKLRWFVRETGSASSRRGTIVFLHGAPTQSYSYRVVMSQLSDAGFHCFAPDWIG  154

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ ++  L
Sbjct  155  FGFSDKPQPGYGFDYTEKEFHDALDKLLQVL  185



>ref|XP_007023283.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007023284.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY25905.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY25906.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=374

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    +V +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  97   GSYIKSGKFRWFVRETGSPQSRRGTVVFLHGAPTQSYSYRVVMSQMSDAGFHCFAPDWIG  156

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+   L+ +++ L
Sbjct  157  FGFSDKPQPGYGFDYTEKEFHEELDKLLDVL  187



>ref|XP_010097191.1| hypothetical protein L484_025738 [Morus notabilis]
 gb|EXB67258.1| hypothetical protein L484_025738 [Morus notabilis]
Length=397

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S   RWF  ETG+A      +V +HG P+Q+YSYR V+  LS    H  A DW+G
Sbjct  115  GSYIKSGKLRWFVRETGSANSRKGTVVFLHGAPTQSYSYRVVMSQLSDLGFHCFAPDWIG  174

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ +++ L
Sbjct  175  FGFSDKPQPGYGFDYTEKEFHEALDKLLDVL  205



>ref|XP_008461135.1| PREDICTED: uncharacterized protein LOC103499813 [Cucumis melo]
Length=390

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q+YSYR V+  L+    H  A DW+G
Sbjct  113  GSYVKSGKLRWFVRETGSAKSRRGTIVFLHGAPTQSYSYRVVMSELAAFGFHCFAPDWIG  172

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  +L+ +++ L
Sbjct  173  FGFSDKPQPGYGFNYTEKEYHEALDKLLDVL  203



>gb|KJB35128.1| hypothetical protein B456_006G101700 [Gossypium raimondii]
Length=329

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  93   GSYIKSGKLRWFVRETGSPESRRGTVVFLHGAPTQSYSYRVVMSQMSDAGFHCFAPDWIG  152

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ +++ L
Sbjct  153  FGFSDKPQPGYGFDYTEKEFHEALDKLLDVL  183



>gb|KJB35131.1| hypothetical protein B456_006G101700 [Gossypium raimondii]
Length=291

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  93   GSYIKSGKLRWFVRETGSPESRRGTVVFLHGAPTQSYSYRVVMSQMSDAGFHCFAPDWIG  152

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ +++ L
Sbjct  153  FGFSDKPQPGYGFDYTEKEFHEALDKLLDVL  183



>dbj|BAD42955.1| unknown protein [Arabidopsis thaliana]
Length=185

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  11   GSTIKSGKLRWFVRETGSKESRRGTIVFVHGAPTQSFSYRTVMSELSDAGFHCFAPDWIG  70

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  71   FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  101



>gb|KJB35127.1| hypothetical protein B456_006G101700 [Gossypium raimondii]
 gb|KJB35129.1| hypothetical protein B456_006G101700 [Gossypium raimondii]
Length=370

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  93   GSYIKSGKLRWFVRETGSPESRRGTVVFLHGAPTQSYSYRVVMSQMSDAGFHCFAPDWIG  152

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ +++ L
Sbjct  153  FGFSDKPQPGYGFDYTEKEFHEALDKLLDVL  183



>ref|XP_008807054.1| PREDICTED: uncharacterized hydrolase YNR064C [Phoenix dactylifera]
Length=393

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG++ +    +V IHG P+Q+YSYR V+  ++ + +H  A DW+G
Sbjct  112  GSYVKSGKFRWFVRETGSSDNPRGTVVFIHGAPTQSYSYRVVISQMADAGYHCFAPDWIG  171

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF YT +E+ ++ + ++ TL
Sbjct  172  FGFSDKPQPGYGFLYTEEEFHAAFDRLLATL  202



>ref|XP_010906730.1| PREDICTED: uncharacterized hydrolase YNR064C [Elaeis guineensis]
Length=389

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 60/91 (66%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG++ +    IV IHG P+Q+YSYR V+  ++ + +H  A DW+G
Sbjct  112  GSYVKSGKLRWFVRETGSSNNPHGTIVFIHGAPTQSYSYRVVMSQMADAGYHCFAPDWIG  171

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF YT +E+ S  + ++ TL
Sbjct  172  FGFSDKPQPGYGFLYTEEEFHSEFDRLLATL  202



>gb|KCW53846.1| hypothetical protein EUGRSUZ_J03079 [Eucalyptus grandis]
Length=273

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    IV +HG P+Q+YSYR V+  +S      +A DW+G
Sbjct  105  GSYIKSGKFRWFVRETGSPESRRGTIVFLHGAPTQSYSYRVVMSEMSNVGFRCLAPDWIG  164

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+    + ++N L
Sbjct  165  FGFSDKPQPGYGFNYTEKEFHEEFDKLLNVL  195



>gb|KFK35798.1| hypothetical protein AALP_AA4G037800 [Arabis alpina]
Length=290

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  +S++  H  A DW+G
Sbjct  13   GSTIKSGKLRWFVRETGSKESRRGTIVFVHGAPTQSFSYRTVMSQMSEAGFHCFAPDWIG  72

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + +++ L
Sbjct  73   FGFSDKPQPGYGFNYTEKEYHEAFDKLLDVL  103



>gb|KHN01316.1| Haloalkane dehalogenase [Glycine soja]
Length=290

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  13   GSYVKSGKLRWFVRETGSANGRRGTIVFLHGAPTQSFSYRVVMSQLSDAGFHCFAPDWIG  72

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  73   FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  103



>emb|CDO98174.1| unnamed protein product [Coffea canephora]
Length=390

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q+YSYR V+  ++ S  H  A DW+G
Sbjct  113  GSYIKSGGLRWFVRETGSAASRRGTIVFLHGAPTQSYSYRNVMSQMADSGFHCFAPDWIG  172

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+    + +++ L
Sbjct  173  FGFSDKPQPGYGFDYTETEFHDGFDKLLDVL  203



>dbj|BAD44400.1| unknown protein [Arabidopsis thaliana]
Length=380

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 68/113 (60%), Gaps = 11/113 (10%)
 Frame = +2

Query  368  AHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYS  541
              ++ G+ +K K+  +G T+ +G        RWF  ETG+  +    IV +HG P+Q++S
Sbjct  89   GQMLYGTEDKGKE--YGSTIKSGK------LRWFVRETGSKESRRGTIVFVHGAPTQSFS  140

Query  542  YRKVLPILSKS-HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            YR V+  LS +  H  A DW+GFGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  141  YRTVMSELSDAGFHCFAPDWIGFGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  193



>gb|KCW53845.1| hypothetical protein EUGRSUZ_J03079 [Eucalyptus grandis]
Length=298

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    IV +HG P+Q+YSYR V+  +S      +A DW+G
Sbjct  105  GSYIKSGKFRWFVRETGSPESRRGTIVFLHGAPTQSYSYRVVMSEMSNVGFRCLAPDWIG  164

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+    + ++N L
Sbjct  165  FGFSDKPQPGYGFNYTEKEFHEEFDKLLNVL  195



>ref|NP_001031176.1| putative hydrolase [Arabidopsis thaliana]
 gb|AEE32817.1| putative hydrolase [Arabidopsis thaliana]
Length=288

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  11   GSTIKSGKLRWFVRETGSKESRRGTIVFVHGAPTQSFSYRTVMSELSDAGFHCFAPDWIG  70

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  71   FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  101



>ref|XP_009144839.1| PREDICTED: uncharacterized protein LOC103868501 [Brassica rapa]
 emb|CDY49911.1| BnaA05g14820D [Brassica napus]
Length=376

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q++SYR V+  +S+   H  A DW+G
Sbjct  99   GSTIKSGKLRWFVRETGSKESRRGTVVFLHGAPTQSFSYRTVMSEMSEFGFHCYAPDWIG  158

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + +++TL
Sbjct  159  FGFSDKPQPGYGFNYTEKEYHEAFDKLLDTL  189



>emb|CDX87912.1| BnaC06g09740D [Brassica napus]
Length=376

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 9/98 (9%)
 Frame = +2

Query  413  FGLTMGAGSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHV  583
            FG T+ AG        RWF  ETG+  +    +V +HG P+Q++SYR V+  +S+   H 
Sbjct  98   FGSTIKAGK------LRWFVRETGSKESRRGTVVFLHGAPTQSFSYRTVMSEMSEFGFHC  151

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
             A DW+GFGFSDKPQP YGF+YT  EY  + + +++TL
Sbjct  152  YAPDWIGFGFSDKPQPGYGFNYTEKEYHEAFDKLLDTL  189



>gb|AAD55611.1|AC008016_21 Contains PF|00561 alpha/beta hydrolase fold [Arabidopsis thaliana]
Length=379

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  103  GSTIKSGKLRWFVRETGSKESRRGTIVFVHGAPTQSFSYRTVMSELSDAGFHCFAPDWIG  162

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  163  FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  193



>ref|NP_175660.2| putative hydrolase [Arabidopsis thaliana]
 gb|AAL38708.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51368.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43191.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44235.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32816.1| putative hydrolase [Arabidopsis thaliana]
Length=380

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  103  GSTIKSGKLRWFVRETGSKESRRGTIVFVHGAPTQSFSYRTVMSELSDAGFHCFAPDWIG  162

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  163  FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  193



>gb|KHN37999.1| Haloalkane dehalogenase [Glycine soja]
Length=257

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      I+ +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  98   GSYVKSGKLRWFVRETGSANGRRGTIIFLHGAPTQSFSYRVVMSQLSDAGFHCFAPDWIG  157

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  158  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  188



>ref|XP_003528305.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Glycine max]
Length=374

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  97   GSYVKSGKLRWFVRETGSANGRRGTIVFLHGAPTQSFSYRVVMSQLSDAGFHCFAPDWIG  156

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  157  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  187



>ref|XP_010250215.1| PREDICTED: uncharacterized protein LOC104592505 [Nelumbo nucifera]
Length=377

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    IV IHG P+Q+YSYR V+  ++ +  H  A DW+G
Sbjct  100  GSYVKSGKFRWFVRETGSPGSRRGTIVFIHGAPTQSYSYRVVMAQMADAGFHCFAPDWIG  159

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+    + ++  L
Sbjct  160  FGFSDKPQPGYGFNYTEQEFHVEFDKLLEVL  190



>ref|XP_003604363.1| Haloalkane dehalogenase [Medicago truncatula]
 gb|KEH28676.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=270

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  L  +  H  A DW+G
Sbjct  106  GSYVKSGKLRWFVRETGSANSRRGTIVFLHGAPTQSFSYRVVMSELGDAGFHCFAPDWIG  165

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  166  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  196



>ref|XP_010033976.1| PREDICTED: uncharacterized protein LOC104423192 [Eucalyptus grandis]
 gb|KCW53844.1| hypothetical protein EUGRSUZ_J03079 [Eucalyptus grandis]
Length=383

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    IV +HG P+Q+YSYR V+  +S      +A DW+G
Sbjct  105  GSYIKSGKFRWFVRETGSPESRRGTIVFLHGAPTQSYSYRVVMSEMSNVGFRCLAPDWIG  164

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+    + ++N L
Sbjct  165  FGFSDKPQPGYGFNYTEKEFHEEFDKLLNVL  195



>ref|XP_003531724.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Glycine max]
Length=376

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      I+ +HG P+Q++SYR V+  LS +  H  A DW+G
Sbjct  98   GSYVKSGKLRWFVRETGSANGRRGTIIFLHGAPTQSFSYRVVMSQLSDAGFHCFAPDWIG  157

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  158  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  188



>ref|XP_004506957.1| PREDICTED: haloalkane dehalogenase-like isoform X2 [Cicer arietinum]
Length=343

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  L+ +  H  A DW+G
Sbjct  104  GSYIKSGKLRWFVRETGSANSRRGTIVFLHGAPTQSFSYRIVMSQLADAGFHCFAPDWIG  163

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  164  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  194



>gb|ACJ83315.1| unknown [Medicago truncatula]
Length=217

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  L  +  H  A DW+G
Sbjct  106  GSYVKSGKLRWFVRETGSANSRRGPIVFLHGAPAQSFSYRVVMSELGDAGFHCFAPDWIG  165

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  166  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  196



>gb|AFK40709.1| unknown [Medicago truncatula]
Length=215

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  L  +  H  A DW+G
Sbjct  106  GSYVKSGKLRWFVRETGSANSRRGPIVFLHGAPAQSFSYRVVMSELGDAGFHCFAPDWIG  165

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  166  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  196



>gb|AFK39749.1| unknown [Lotus japonicus]
Length=265

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 64/113 (57%), Gaps = 11/113 (10%)
 Frame = +2

Query  368  AHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYS  541
              ++N +  K KD         GS   S   RWF  ETG+A      IV +HG P Q++ 
Sbjct  83   GQMLNRTEGKGKD--------FGSYVKSGKLRWFVRETGSAESRRGTIVFLHGAPMQSFG  134

Query  542  YRKVLPILSKS-HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            YR V+  L+ +  H  A DW+GFGFSDKPQP YGF+YT  E+  +L++++  L
Sbjct  135  YRVVMSQLADAGFHCFAPDWIGFGFSDKPQPGYGFNYTEKEFHDALDNLLEVL  187



>ref|XP_004506956.1| PREDICTED: haloalkane dehalogenase-like isoform X1 [Cicer arietinum]
Length=381

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  L+ +  H  A DW+G
Sbjct  104  GSYIKSGKLRWFVRETGSANSRRGTIVFLHGAPTQSFSYRIVMSQLADAGFHCFAPDWIG  163

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  164  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  194



>ref|XP_010500850.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Camelina sativa]
Length=380

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  103  GSTIRSGKLRWFVRETGSKESRRGTVVFLHGAPTQSFSYRTVMSEMSNAGFHCYAPDWIG  162

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  S + ++  L
Sbjct  163  FGFSDKPQPGYGFNYTEKEYHESFDKLLEVL  193



>gb|AES86560.2| alpha/beta fold hydrolase [Medicago truncatula]
Length=383

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYD--SCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+A      IV +HG P+Q++SYR V+  L  +  H  A DW+G
Sbjct  106  GSYVKSGKLRWFVRETGSANSRRGTIVFLHGAPTQSFSYRVVMSELGDAGFHCFAPDWIG  165

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  E+  +L+ ++  L
Sbjct  166  FGFSDKPQPGYGFNYTEKEFHDALDKLLEVL  196



>ref|XP_006392914.1| hypothetical protein EUTSA_v10011571mg [Eutrema salsugineum]
 gb|ESQ30200.1| hypothetical protein EUTSA_v10011571mg [Eutrema salsugineum]
Length=382

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++S+R V+  +S++  H  A DW+G
Sbjct  105  GSTIKSGKLRWFVRETGSKESRRGTIVFLHGAPTQSFSFRTVMSQMSEAGFHCFAPDWIG  164

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + +++ L
Sbjct  165  FGFSDKPQPGYGFNYTEKEYHEAFDKLLDVL  195



>ref|XP_002894382.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70641.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=380

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  103  GSIIKSGKLRWFVRETGSKESRRGTIVFVHGAPTQSFSYRTVMSEMSDAGFHCFAPDWIG  162

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  163  FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  193



>ref|XP_010545744.1| PREDICTED: uncharacterized protein LOC104818013 [Tarenaya hassleriana]
Length=386

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V IHG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  109  GSTRKSGKLRWFVRETGSPDSRRGTVVFIHGAPTQSFSYRNVMSQMSDAGFHCFAPDWIG  168

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSD+PQP YGF+YT  EY    + +++ L
Sbjct  169  FGFSDQPQPGYGFNYTEKEYHEEFDRLLDVL  199



>ref|XP_002448631.1| hypothetical protein SORBIDRAFT_06g030510 [Sorghum bicolor]
 gb|EES12959.1| hypothetical protein SORBIDRAFT_06g030510 [Sorghum bicolor]
Length=286

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   +  FRWF  ETG+  A    IV +HG P+Q++SYR V+  ++ + +H  A DW+G
Sbjct  126  GSYVRAGEFRWFVRETGSPDARRGTIVFLHGAPAQSFSYRVVMAQMADAGYHCYAPDWIG  185

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFS+ PQP YGFD+  DE+  + + ++ TL 
Sbjct  186  FGFSEMPQPGYGFDFKEDEFHKAFDDLLGTLN  217



>ref|XP_002517672.1| hydrolase, putative [Ricinus communis]
 gb|EEF44836.1| hydrolase, putative [Ricinus communis]
Length=375

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S    WF  ETG+  +    IV +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  98   GSYVKSGKLTWFVRETGSPKSRRGTIVFLHGAPTQSYSYRVVMSQMSDAGFHCFAPDWIG  157

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  +L+ ++  L
Sbjct  158  FGFSDKPQPGYGFNYTEKEYHEALDQLLEVL  188



>ref|XP_010462087.1| PREDICTED: uncharacterized protein LOC104742750 [Camelina sativa]
 ref|XP_010462088.1| PREDICTED: uncharacterized protein LOC104742750 [Camelina sativa]
Length=381

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  104  GSTIRSGKLRWFVRETGSKESRRGTVVFLHGAPTQSFSYRTVMSEMSNAGFHCYAPDWIG  163

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  164  FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  194



>ref|XP_004241692.1| PREDICTED: uncharacterized protein LOC101262019 [Solanum lycopersicum]
Length=383

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    IV +HG P+Q+YSYR V+  LS +  H  A DW+G
Sbjct  104  GSYVKSGKFRWFVRETGSPESRRGTIVFLHGAPTQSYSYRVVMSQLSDAGFHCFAPDWIG  163

Query  605  FGFSDKPQPKYGFDYT  652
            FGFSDKPQP YGFDYT
Sbjct  164  FGFSDKPQPGYGFDYT  179



>ref|XP_006356226.1| PREDICTED: uncharacterized protein LOC102600388 [Solanum tuberosum]
Length=383

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    IV +HG P+Q+YSYR V+  LS +  H  A DW+G
Sbjct  104  GSYVKSGKFRWFVRETGSPESRRGTIVFLHGAPTQSYSYRVVMSQLSDAGFHCFAPDWIG  163

Query  605  FGFSDKPQPKYGFDYT  652
            FGFSDKPQP YGFDYT
Sbjct  164  FGFSDKPQPGYGFDYT  179



>ref|XP_002299933.2| hypothetical protein POPTR_0001s20870g [Populus trichocarpa]
 gb|EEE84738.2| hypothetical protein POPTR_0001s20870g [Populus trichocarpa]
Length=383

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S    WF  ETG+  +    I+ +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  106  GSYVKSGELIWFVRETGSPDSRRGTIIFLHGAPAQSYSYRVVMSQMSDAGFHCFAPDWIG  165

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ +++ L
Sbjct  166  FGFSDKPQPGYGFDYTEKEFHEALDKLLDVL  196



>gb|EPS67727.1| hypothetical protein M569_07047, partial [Genlisea aurea]
Length=207

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS  +S  F+WF  ETG++      I+ +HG P+Q++SYR V+  L+    H  A DW+G
Sbjct  51   GSYINSGGFQWFVRETGSSDSRRGTILFLHGAPTQSFSYRLVISQLADMGFHCFAPDWIG  110

Query  605  FGFSDKPQPKYGFDYTLD-EYVSSLESVINTL  697
            FGFSDKPQP YGFDYT + EY  +L++++ +L
Sbjct  111  FGFSDKPQPGYGFDYTAEKEYHQALDTLLESL  142



>ref|XP_010479758.1| PREDICTED: uncharacterized protein LOC104758569 [Camelina sativa]
 ref|XP_010479759.1| PREDICTED: uncharacterized protein LOC104758569 [Camelina sativa]
Length=382

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    +V +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  105  GSTIRSGKLRWFVRETGSKESRRGTVVFLHGAPTQSFSYRTVMSEMSDAGFHCYAPDWIG  164

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF+YT  EY  + + ++  L
Sbjct  165  FGFSDKPQPGYGFNYTEKEYHEAFDKLLEVL  195



>ref|XP_007215833.1| hypothetical protein PRUPE_ppa010168mg [Prunus persica]
 gb|EMJ17032.1| hypothetical protein PRUPE_ppa010168mg [Prunus persica]
Length=261

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +2

Query  464  WFCVETGTAYDS--CIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLGFGFSDKPQPK  634
            WF  ETG+A      ++ +HG P+Q+YSYR V+  +S+   H  A DWLGFGFSDKPQP 
Sbjct  122  WFVRETGSAESQRGTVIFLHGAPTQSYSYRNVMSQMSELGFHCFAPDWLGFGFSDKPQPG  181

Query  635  YGFDYTLDEYVSSLESVINTL  697
            YGFDY  +E+    + +++ L
Sbjct  182  YGFDYKEEEFHEEFDKLLDVL  202



>gb|ACN34535.1| unknown [Zea mays]
 gb|AFW59650.1| hypothetical protein ZEAMMB73_032229 [Zea mays]
Length=403

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   +  FRWF  ETG+  A    IV +HG P+Q++SYR V+  ++ + +H  A DW+G
Sbjct  126  GSYVRAGEFRWFVRETGSPDARRGTIVFLHGAPTQSFSYRVVMAQMADAGYHCFAPDWIG  185

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFS+ PQP YGFD+  DE+  + + ++ TL 
Sbjct  186  FGFSEMPQPGYGFDFKEDEFHKAFDDLLGTLN  217



>ref|XP_011007692.1| PREDICTED: uncharacterized protein LOC105113285 [Populus euphratica]
 ref|XP_011007693.1| PREDICTED: uncharacterized protein LOC105113285 [Populus euphratica]
Length=380

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S    WF  ETG+  +    +V +HG P+Q+YSYR V+  +S +  H  A DW+G
Sbjct  103  GSYIKSGELIWFVRETGSPDSRRGTVVFLHGAPAQSYSYRVVMSQMSDAGFHCFAPDWIG  162

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+  +L+ +++ L
Sbjct  163  FGFSDKPQPGYGFDYTEKEFHEALDKLLDVL  193



>ref|XP_012073134.1| PREDICTED: uncharacterized hydrolase YNR064C isoform X2 [Jatropha 
curcas]
Length=368

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  F WF  ETG+  +    +V +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  91   GSYKKSGKFTWFVRETGSPDSRRGTVVFLHGAPTQSFSYRVVMSQMSDAGFHCFAPDWIG  150

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+    + +++ L
Sbjct  151  FGFSDKPQPGYGFDYTEKEFHEEFDRLLDVL  181



>ref|XP_011073395.1| PREDICTED: uncharacterized protein LOC105158360 [Sesamum indicum]
Length=368

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    +V +HG P+Q+YSYR V+  ++ +  H  A DW+G
Sbjct  91   GSYIKSGGFRWFVRETGSPESRRGTVVFLHGAPTQSYSYRVVMSQMADAGFHCFAPDWIG  150

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQ  YGFDYT  E+    + +++TL
Sbjct  151  FGFSDKPQAGYGFDYTEKEFHEVFDKLLDTL  181



>ref|XP_012073133.1| PREDICTED: uncharacterized hydrolase YNR064C isoform X1 [Jatropha 
curcas]
 gb|KDP37054.1| hypothetical protein JCGZ_06110 [Jatropha curcas]
Length=374

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  F WF  ETG+  +    +V +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  97   GSYKKSGKFTWFVRETGSPDSRRGTVVFLHGAPTQSFSYRVVMSQMSDAGFHCFAPDWIG  156

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGFDYT  E+    + +++ L
Sbjct  157  FGFSDKPQPGYGFDYTEKEFHEEFDRLLDVL  187



>ref|XP_004977019.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Setaria italica]
Length=408

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  F+WF  ETG+  A    IV +HG P+Q++SYR V+  ++ + +H  A DWLG
Sbjct  131  GSYVRSGEFKWFVRETGSSDARRGTIVFLHGAPTQSFSYRVVMAQMADAGYHCFAPDWLG  190

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFS+ PQP YGFDY  +E+  + + ++ TL 
Sbjct  191  FGFSEMPQPGYGFDYKEEEFHKAFDDLLGTLN  222



>ref|XP_003580670.1| PREDICTED: uncharacterized hydrolase YNR064C [Brachypodium distachyon]
Length=392

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            G    S   RWF  ETG+  A    I+ IHG P+Q++SYR V+  +S + +H  A DW+G
Sbjct  114  GKTVRSGDLRWFVRETGSPDARRGTIIFIHGAPTQSFSYRMVMSQMSDAGYHCFAPDWIG  173

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFS+ PQP YGFDY  +E+  + + ++ TL 
Sbjct  174  FGFSEMPQPGYGFDYKEEEFHKAFDDLLGTLN  205



>ref|XP_004303285.1| PREDICTED: abhydrolase domain-containing protein 8 [Fragaria 
vesca subsp. vesca]
Length=384

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 71/127 (56%), Gaps = 17/127 (13%)
 Frame = +2

Query  326  SPADEWFKQGRIVKAHLVNGSGEKAKDPIFGLTMGAGSQSSSDLFRWFCVETGTAYDS--  499
            +PAD+    G +    ++N   EK +D  +G  + +G         WF  ETG+A     
Sbjct  85   TPADD----GNV--GQMLNRIEEKGRD--YGKYIRSGEHV------WFVRETGSAESQRG  130

Query  500  CIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSL  676
             IV +HG P+Q+YSYR V+  +S+   H  A DWLGFGFSDKPQP Y FDYT  E+    
Sbjct  131  TIVFLHGAPTQSYSYRNVMSQMSELGFHCFAPDWLGFGFSDKPQPGYDFDYTEKEFHDEF  190

Query  677  ESVINTL  697
            + +++ L
Sbjct  191  DRLLDVL  197



>ref|XP_006856536.1| PREDICTED: abhydrolase domain-containing protein 8 [Amborella 
trichopoda]
 ref|XP_011627860.1| PREDICTED: abhydrolase domain-containing protein 8 [Amborella 
trichopoda]
 gb|ERN18003.1| hypothetical protein AMTR_s00046p00146170 [Amborella trichopoda]
Length=378

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   +  FRWF  ETG++      I+ +HG P+Q+YSYR V+  ++    H  A DW+G
Sbjct  100  GSYVKAGKFRWFVRETGSSKTQRGTIIFVHGAPTQSYSYRVVMAQMADLGFHCFAPDWIG  159

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQP YGF Y  +E+  + ++++  L
Sbjct  160  FGFSDKPQPGYGFSYIEEEFHEAFDNLLEAL  190



>ref|XP_009592214.1| PREDICTED: uncharacterized protein LOC104089100 [Nicotiana tomentosiformis]
Length=383

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    ++ +HG P+Q+YSYR V+  ++ S  H  A DW+G
Sbjct  105  GSYVKSGKFRWFVRETGSPESRRGTVIFLHGAPTQSYSYRVVMSQMADSGFHCFAPDWIG  164

Query  605  FGFSDKPQPKYGFDYT  652
            FGFSDKPQP YGFDYT
Sbjct  165  FGFSDKPQPGYGFDYT  180



>gb|EYU21671.1| hypothetical protein MIMGU_mgv11b007012mg [Erythranthe guttata]
Length=371

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S  F+WF  ETG+  +    IV +HG P+Q+YSYR V+  ++    H  A DW+G
Sbjct  93   GSYIRSGKFKWFVRETGSPESRRGTIVFLHGAPTQSYSYRVVMSEMAGYGFHCFAPDWIG  152

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFSDKPQ  YGFDYT  E+    + +++TL
Sbjct  153  FGFSDKPQAGYGFDYTEKEFHDVFDKLLDTL  183



>ref|XP_006305087.1| hypothetical protein CARUB_v10009454mg [Capsella rubella]
 gb|EOA37985.1| hypothetical protein CARUB_v10009454mg [Capsella rubella]
Length=379

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S   RWF  ETG+  +    IV +HG P+Q++SYR V+  +S +  H  A DW+G
Sbjct  102  GSTIKSGKLRWFVRETGSKESRRGTIVFLHGAPTQSFSYRTVMSEMSDAGFHCFAPDWIG  161

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFS KPQP YGF+YT  EY  + + ++  L
Sbjct  162  FGFSVKPQPGYGFNYTEQEYHEAFDKLLEVL  192



>ref|XP_001757240.1| predicted protein [Physcomitrella patens]
 gb|EDQ78099.1| predicted protein [Physcomitrella patens]
Length=388

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   +  FRW+  ETG+  A +  +V +HG P+Q+YSYR VL  ++K  +H  A DW+G
Sbjct  110  GSYLRAGEFRWWVRETGSRDARNGTVVFLHGAPTQSYSYRVVLEQMAKEGYHCYAPDWIG  169

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFS+KPQP+Y F YT + Y    + ++  L
Sbjct  170  FGFSEKPQPEYEFSYTEEAYHEEFDKLLAKL  200



>ref|XP_009786840.1| PREDICTED: uncharacterized protein LOC104234896 [Nicotiana sylvestris]
Length=382

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   S  FRWF  ETG+  +    ++ +HG P+Q+YSYR V+  ++ +  H  A DW+G
Sbjct  104  GSYVKSGKFRWFVRETGSPESRRGTVIFLHGAPTQSYSYRVVMSQMADTGFHCFAPDWIG  163

Query  605  FGFSDKPQPKYGFDYT  652
            FGFSDKPQP YGFDYT
Sbjct  164  FGFSDKPQPGYGFDYT  179



>ref|XP_010691107.1| PREDICTED: uncharacterized protein LOC104904536 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691108.1| PREDICTED: uncharacterized protein LOC104904536 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691109.1| PREDICTED: uncharacterized protein LOC104904536 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +2

Query  446  SSDLFRWFCVETGTA--YDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLGFGFS  616
            S DL  WF  ETG+       IV +HG P+Q+YSYR V+  +S +  H +A DW+GFGFS
Sbjct  106  SGDLV-WFVRETGSPDRGRGTIVFLHGAPTQSYSYRVVMSQMSDAGFHCLAPDWIGFGFS  164

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTL  697
            DKP PKYGFDYT  E+    + ++  L
Sbjct  165  DKPYPKYGFDYTEKEFHDEFDKLLEVL  191



>ref|XP_008228721.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103328108 
[Prunus mume]
Length=395

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 9/87 (10%)
 Frame = +2

Query  464  WFCVETG--------TAYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLGFGFS  616
            WF  ETG        T+    ++ +HG P+Q+YSYR V+  +S+   H  A DWLGFGFS
Sbjct  122  WFVRETGKKKTLPHYTSSSGTVIFLHGAPTQSYSYRNVMSQMSELGFHCFAPDWLGFGFS  181

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTL  697
            DKPQP YGFDY  +E+    + +++ L
Sbjct  182  DKPQPGYGFDYKEEEFHEEFDKLLDVL  208



>gb|AFW59648.1| hypothetical protein ZEAMMB73_032229 [Zea mays]
Length=207

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   +  FRWF  ETG+  A    IV +HG P+Q++SYR V+  ++ + +H  A DW+G
Sbjct  126  GSYVRAGEFRWFVRETGSPDARRGTIVFLHGAPTQSFSYRVVMAQMADAGYHCFAPDWIG  185

Query  605  FGFSDKPQPKYGFDYTLDEYV  667
            FGFS+ PQP YGFD+   E V
Sbjct  186  FGFSEMPQPGYGFDFKGQENV  206



>dbj|BAJ92131.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            G    S  FRWF  +TG+  +    I+ +HG P+Q++SYR V+  ++ + +H  A DWLG
Sbjct  124  GKSVRSGEFRWFVRQTGSPDSRRGTIMFLHGAPTQSFSYRTVMAQMADAGYHCFAPDWLG  183

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFS+ PQP YGFD+  +E+  + + ++ TL 
Sbjct  184  FGFSEMPQPGYGFDFKEEEFHKAFDELLVTLN  215



>gb|KDO41243.1| hypothetical protein CISIN_1g022534mg [Citrus sinensis]
Length=295

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYDS---CIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWL  601
            GS   S  +RWF  ETG+A DS    IV +HG PS +YSYR V+  +S +  H  A DWL
Sbjct  13   GSYIKSGEYRWFVRETGSA-DSRLGTIVFLHGAPSHSYSYRNVMSQMSDAGFHCFAPDWL  71

Query  602  GFGFSDKPQPKY-GFDYTLDEYVSSLESVINTL  697
            GFGFSDKP+  Y  FD+T +E+   L+ +++ L
Sbjct  72   GFGFSDKPEKGYDDFDFTENEFHEELDKLLDVL  104



>gb|EMT19510.1| hypothetical protein F775_09244 [Aegilops tauschii]
Length=446

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            G    S  FRWF  +TG+  +    I+ +HG P+Q++SYR V+  ++ + +H  A DW+G
Sbjct  121  GKSVRSGEFRWFVRQTGSPDSRRGTIMFLHGAPTQSFSYRTVMAQMADAGYHCFAPDWIG  180

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTLT  700
            FGFS+ PQP YGFD+  +E+  + + ++ TL 
Sbjct  181  FGFSEMPQPGYGFDFKEEEFHKAFDELLVTLN  212



>ref|XP_006492082.1| PREDICTED: uncharacterized hydrolase YNR064C-like [Citrus sinensis]
Length=399

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGTAYDS---CIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWL  601
            GS   S  +RWF  ETG+A DS    IV +HG PS +YSYR V+  +S +  H  A DWL
Sbjct  117  GSYIKSGEYRWFVRETGSA-DSRLGTIVFLHGAPSHSYSYRNVMSQMSDAGFHCFAPDWL  175

Query  602  GFGFSDKPQPKY-GFDYTLDEYVSSLESVINTL  697
            GFGFSDKP+  Y  FD+T +E+   L+ +++ L
Sbjct  176  GFGFSDKPEKGYDDFDFTENEFHEELDKLLDVL  208



>gb|ACR34580.1| unknown [Zea mays]
 gb|AFW59649.1| hypothetical protein ZEAMMB73_032229 [Zea mays]
Length=231

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLG  604
            GS   +  FRWF  ETG+  A    IV +HG P+Q++SYR V+  ++ + +H  A DW+G
Sbjct  126  GSYVRAGEFRWFVRETGSPDARRGTIVFLHGAPTQSFSYRVVMAQMADAGYHCFAPDWIG  185

Query  605  FGFSDKPQPKYGFDY  649
            FGFS+ PQP YGFD+
Sbjct  186  FGFSEMPQPGYGFDF  200



>emb|CBI36362.3| unnamed protein product [Vitis vinifera]
Length=383

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S  F WF  ETG+  +    I+ +HG P+Q+YSYR V+  +S    H  A DW+G
Sbjct  106  GSYIRSGEFVWFVRETGSPDSRRGTIIFLHGAPTQSYSYRVVMSQMSDVGFHCFAPDWIG  165

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFS+KP   YGFDYT  E+    + +++ L
Sbjct  166  FGFSEKPYSGYGFDYTEKEFHDEFDKLLDVL  196



>ref|XP_002263706.2| PREDICTED: uncharacterized protein LOC100250971 [Vitis vinifera]
Length=395

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +2

Query  434  GSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPILSK-SHHVIAFDWLG  604
            GS   S  F WF  ETG+  +    I+ +HG P+Q+YSYR V+  +S    H  A DW+G
Sbjct  118  GSYIRSGEFVWFVRETGSPDSRRGTIIFLHGAPTQSYSYRVVMSQMSDVGFHCFAPDWIG  177

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            FGFS+KP   YGFDYT  E+    + +++ L
Sbjct  178  FGFSEKPYSGYGFDYTEKEFHDEFDKLLDVL  208



>ref|XP_002989699.1| hypothetical protein SELMODRAFT_235851 [Selaginella moellendorffii]
 gb|EFJ09176.1| hypothetical protein SELMODRAFT_235851 [Selaginella moellendorffii]
Length=330

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 56/102 (55%), Gaps = 11/102 (11%)
 Frame = +2

Query  392  EKAKDPIFGLTMGAGSQSSSDLFRWFCVETGT--AYDSCIVLIHGFPSQAYSYRKVLPIL  565
            +K +D  FG  M  G       F WF  ETG+  A    IV +HG PSQ+YSYR V+  +
Sbjct  52   DKGRD--FGSFMDVGE------FSWFVRETGSKSAKKGTIVFLHGAPSQSYSYRNVMTQM  103

Query  566  SKS-HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVI  688
            + + +  IA DWLGFG S  PQP + F YT + Y   L  V+
Sbjct  104  ADAGYRCIAPDWLGFGLSQAPQPVFRFSYTEEAYHEELNKVL  145



>ref|XP_009336311.1| PREDICTED: uncharacterized protein LOC103928918 [Pyrus x bretschneideri]
 ref|XP_009338525.1| PREDICTED: uncharacterized protein LOC103930858 [Pyrus x bretschneideri]
Length=390

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  458  FRWFCVETGTAYDS--CIVLIHGFPSQAYSYRKVLPILSKSH--HVIAFDWLGFGFSDKP  625
            + WF  ETG+A      +V +HG P+Q+YSYR V+  LS+    H +A DWLGFGFSDKP
Sbjct  119  YVWFVRETGSAESERGTVVFLHGAPTQSYSYRSVMSQLSEDFGFHCLAPDWLGFGFSDKP  178

Query  626  QPKY-GFDYTLDEYVSSLESVINTL  697
            Q  Y  FDY  +E+    + +++ L
Sbjct  179  QAGYDDFDYKEEEFHKEFDKLLDKL  203



>ref|WP_003929445.1| alpha/beta hydrolase [Mycobacterium vaccae]
 gb|EJZ06831.1| alpha/beta hydrolase fold protein [Mycobacterium vaccae ATCC 
25954]
Length=288

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E GT  +  IVL+HGFP+ ++ +R ++P L+  +HVIA D+LGFG+SD P P   
Sbjct  15   RLFYREAGTPGNPVIVLLHGFPTSSFMFRTLIPELADRYHVIAPDYLGFGYSDAP-PVEE  73

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT D    S+  +++ L
Sbjct  74   FDYTFDALADSVAGLLSQL  92



>ref|WP_026257239.1| alpha/beta hydrolase [Actinopolymorpha alba]
Length=290

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G A    IVL+HGFP+ ++ +R ++P LS S+HVIA D+LGFG SD P P   FD
Sbjct  17   FYREAGVADAPAIVLLHGFPASSFMFRNLIPRLSDSYHVIAPDYLGFGLSDMP-PVEEFD  75

Query  647  YTLDEYVSSLESVINTL  697
            YT D     +E +++ L
Sbjct  76   YTFDALSELIEGLLSEL  92



>ref|WP_040513584.1| alpha/beta hydrolase [Glaciecola polaris]
Length=315

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            R F  E G      IVL+HG+PS ++SYR+++P+LS  +H+IA D+LG G+SD+P P   
Sbjct  32   RIFYREAGQHPKQTIVLLHGYPSSSHSYRELIPLLSGRYHIIAPDYLGSGYSDRPDPSTQ  91

Query  632  KYGFDYTLDEYVSSLESVINT  694
            KY F+  L  YV+ L   +N 
Sbjct  92   KYSFN-LLATYVAGLLETLNV  111



>dbj|GAA69295.1| alpha/beta hydrolase fold precursor [Pseudoalteromonas sp. BSi20429]
Length=298

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            + F  E GT +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S++P P   
Sbjct  23   KIFYREAGTQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSERPNPETQ  82

Query  632  KYGFDYTLDEYVSSLESVINT  694
            KY F+  L +YV  L + +  
Sbjct  83   KYTFE-LLAQYVEGLLTTLKV  102



>dbj|GAC31027.1| hypothetical protein GPLA_0106 [Glaciecola polaris LMG 21857]
Length=320

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            R F  E G      IVL+HG+PS ++SYR+++P+LS  +H+IA D+LG G+SD+P P   
Sbjct  37   RIFYREAGQHPKQTIVLLHGYPSSSHSYRELIPLLSGRYHIIAPDYLGSGYSDRPDPSTQ  96

Query  632  KYGFDYTLDEYVSSLESVINT  694
            KY F+  L  YV+ L   +N 
Sbjct  97   KYSFN-LLATYVAGLLETLNV  116



>ref|WP_010554489.1| MULTISPECIES: alpha/beta hydrolase [Pseudoalteromonas]
 gb|ERG08969.1| alpha/beta hydrolase fold protein [Pseudoalteromonas arctica 
A 37-1-2]
Length=331

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            + F  E GT +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S++P P   
Sbjct  56   KIFYREAGTQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSERPNPETQ  115

Query  632  KYGFDYTLDEYVSSLESVINT  694
            KY F+  L +YV  L + +  
Sbjct  116  KYTFE-LLAQYVEGLLTTLKV  135



>ref|XP_002991782.1| hypothetical protein SELMODRAFT_134090 [Selaginella moellendorffii]
 gb|EFJ07186.1| hypothetical protein SELMODRAFT_134090 [Selaginella moellendorffii]
Length=320

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 55/103 (53%), Gaps = 12/103 (12%)
 Frame = +2

Query  392  EKAKDPIFGLTMGAGSQSSSDLFRWFCVETG---TAYDSCIVLIHGFPSQAYSYRKVLPI  562
            +K +D  FG  M  G       F WF  ET    +A    IV +HG PSQ+YSYR V+  
Sbjct  52   DKGRD--FGSFMDVGE------FSWFVRETAGSKSAKKGTIVFLHGAPSQSYSYRNVMAQ  103

Query  563  LSKS-HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVI  688
            ++ + +  IA DWLGFG S  PQP + F YT + Y   L  V+
Sbjct  104  MADAGYRCIAPDWLGFGLSQAPQPVFRFSYTEEAYHEELNKVL  146



>ref|WP_036365440.1| alpha/beta hydrolase [Mycobacterium asiaticum]
Length=289

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G   D  IVL+HGFP+ +Y +R ++P L+ S+HVIA D LGFG SD P P   
Sbjct  15   RLFFREAGNPVDPTIVLLHGFPTSSYMFRGLIPALADSYHVIAPDHLGFGLSDAP-PVEE  73

Query  641  FDYTLD  658
            FDYT D
Sbjct  74   FDYTFD  79



>ref|WP_024612816.1| alpha/beta hydrolase [Pseudoalteromonas haloplanktis]
Length=336

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            + F  E GT +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S +P P   
Sbjct  56   KIFYREAGTQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSARPSPDKQ  115

Query  632  KYGFDYTLDEYVSSL  676
            KY FD  L +YV  L
Sbjct  116  KYTFD-LLAKYVDGL  129



>ref|WP_019861488.1| hydrolase [Mesorhizobium loti]
Length=292

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G A    ++L HG+P  +Y +R+++P L+     +AFDW GFG+SD P P   
Sbjct  17   RLFLREAGPADAPVLLLPHGYPCSSYQFRRLMPALADRWRTVAFDWPGFGYSDTPDPA-A  75

Query  641  FDYTLDEYVSSLESVIN  691
            FDY  D Y S L +V++
Sbjct  76   FDYDFDAYESVLTAVVD  92



>ref|WP_035641833.1| hydrolase [Flavobacterium rivuli]
 gb|KGO88459.1| hydrolase [Flavobacterium rivuli WB 3.3-2 = DSM 21788]
Length=287

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G      + L+HG+P+ ++ +RK++PIL+K +HVIA D  GFGFS+ P P   ++
Sbjct  19   FYREAGPKDAPVLFLLHGYPTSSFMFRKLIPILAKEYHVIAPDLPGFGFSESPDPS-TYN  77

Query  647  YTLDEYVSSLESVINTL  697
            YT D   S++++ I+TL
Sbjct  78   YTFDNLASAMQAFIDTL  94



>ref|WP_024600260.1| alpha/beta hydrolase [Pseudoalteromonas haloplanktis]
Length=331

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            + F  E G  +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S++P PK  
Sbjct  56   KIFYREAGIQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSERPNPKTQ  115

Query  641  FDYTLDEYVSSLESVINTL  697
              YT +     +E ++ TL
Sbjct  116  -KYTFELLAQYVEGLLTTL  133



>ref|WP_035356644.1| alpha/beta hydrolase, partial [Edaphobacter aggregans]
Length=256

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  458  FRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKY  637
             R F  E G+     IVL+HGFPS ++ +R ++P L+   HVIA D++GFG+SD P+   
Sbjct  12   LRIFYREAGSKASPTIVLLHGFPSSSHMFRDLIPQLADKFHVIAPDYVGFGYSDAPETG-  70

Query  638  GFDYTLDEYVSSLESVI  688
             FDYT D   S +E ++
Sbjct  71   KFDYTFDNLASHIEELL  87



>ref|WP_024608243.1| alpha/beta hydrolase [Pseudoalteromonas haloplanktis]
Length=331

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 4/81 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            + F  E G  +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S++P P   
Sbjct  56   KIFYREAGIQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSERPNPETQ  115

Query  632  KYGFDYTLDEYVSSLESVINT  694
            KY F+  L +YV  L + +  
Sbjct  116  KYTFE-LLAQYVEGLLTTLKV  135



>ref|WP_039988767.1| alpha/beta hydrolase [Glaciecola arctica]
Length=338

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---KY  637
            F  E G  +   IVL+HG+PS +++YR+++P+LS  +HVIA D+LG G+S++P P   KY
Sbjct  61   FYREAGEQHKQTIVLLHGYPSSSHTYRELIPLLSGRYHVIAPDYLGSGYSERPDPAEQKY  120

Query  638  GFDYTLDEYVSSL  676
             FD  L +YV+ L
Sbjct  121  TFD-LLAKYVNGL  132



>ref|WP_036786596.1| hypothetical protein [Polaribacter sp. Hel1_33_49]
Length=296

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F ++TG  +++C+V++HG+ + +Y YRKVLP L K + VI  D +GFGFSDK + KY   
Sbjct  32   FTIDTGGEHENCLVILHGYLTSSYDYRKVLPELCKHYRVIIQDLIGFGFSDKIENKYFTI  91

Query  647  YTLDEYVSSLESVI  688
                +YV  L +++
Sbjct  92   TEQTDYVLELWNIL  105



>dbj|GAC17888.1| alpha/beta hydrolase fold protein [Glaciecola arctica BSs20135]
Length=353

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---KY  637
            F  E G  +   IVL+HG+PS +++YR+++P+LS  +HVIA D+LG G+S++P P   KY
Sbjct  76   FYREAGEQHKQTIVLLHGYPSSSHTYRELIPLLSGRYHVIAPDYLGSGYSERPDPAEQKY  135

Query  638  GFDYTLDEYVSSL  676
             FD  L +YV+ L
Sbjct  136  TFD-LLAKYVNGL  147



>gb|KGL61066.1| alpha/beta hydrolase [Polaribacter sp. Hel1_33_49]
Length=292

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F ++TG  +++C+V++HG+ + +Y YRKVLP L K + VI  D +GFGFSDK + KY   
Sbjct  28   FTIDTGGEHENCLVILHGYLTSSYDYRKVLPELCKHYRVIIQDLIGFGFSDKIENKYFTI  87

Query  647  YTLDEYVSSLESVI  688
                +YV  L +++
Sbjct  88   TEQTDYVLELWNIL  101



>ref|WP_035160260.1| alpha/beta hydrolase [Cobetia crustatorum]
Length=309

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G  +   IVL+HG+P+ ++SYR+++P+LS  +HV+A D++G G+SD+P P+  
Sbjct  32   RLFYREAGEQHAQTIVLLHGYPASSHSYRELIPLLSGRYHVVAPDYMGSGYSDRPDPEEQ  91

Query  641  FDYTLDEYVSSLESVINTL  697
              YT D      E ++  L
Sbjct  92   -PYTFDRLARYTEGLLKAL  109



>ref|WP_044007567.1| hypothetical protein, partial [Jannaschia sp. CCS1]
Length=276

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = +2

Query  473  VETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYT  652
            V+ GT     ++L+HG P+ +Y YRK +P L+++H VIA D +GFG SDKP+ +   DYT
Sbjct  4    VDEGTG--DPVLLLHGNPTWSYLYRKFIPALAQTHRVIAPDHIGFGLSDKPEAEG--DYT  59

Query  653  LDEYVSSLESVINTL  697
            LD ++ +LE+++  L
Sbjct  60   LDAHIQNLEALVQQL  74



>ref|WP_045227390.1| alpha/beta hydrolase [Methylococcaceae bacterium 73a]
Length=325

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G   +  IVL+HGFPS +++YR+++P+LS S H+IA D+LG G+SD P P++ 
Sbjct  31   RIFYREAGDRRNPTIVLLHGFPSSSHTYRELIPLLSGSFHIIAPDYLGSGYSDHPSPEHT  90

Query  641  FDYTLDEYVSSLESVINTL  697
              YT D     +  ++ TL
Sbjct  91   -RYTFDLLAKHVLGLLRTL  108



>gb|ABD55542.1| alpha/beta hydrolase [Jannaschia sp. CCS1]
Length=314

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 4/75 (5%)
 Frame = +2

Query  473  VETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYT  652
            V+ GT     ++L+HG P+ +Y YRK +P L+++H VIA D +GFG SDKP+ +   DYT
Sbjct  42   VDEGTG--DPVLLLHGNPTWSYLYRKFIPALAQTHRVIAPDHIGFGLSDKPEAEG--DYT  97

Query  653  LDEYVSSLESVINTL  697
            LD ++ +LE+++  L
Sbjct  98   LDAHIQNLEALVQQL  112



>ref|WP_002961150.1| alpha/beta hydrolase [Pseudoalteromonas haloplanktis]
 gb|EGI72457.1| alpha/beta hydrolase fold precursor [Pseudoalteromonas haloplanktis 
ANT/505]
Length=329

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            + F  E G  +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S +P PK  
Sbjct  56   KIFYREAGAQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSARPNPKTQ  115

Query  641  FDYTLDEYVSSLESVINTL  697
              YT +     +E ++ TL
Sbjct  116  -KYTFELLAQYVEGLLTTL  133



>ref|WP_039489797.1| MULTISPECIES: alpha/beta hydrolase [Pseudoalteromonas]
 gb|KHM46387.1| alpha/beta hydrolase [Pseudoalteromonas flavipulchra NCIMB 2033 
= ATCC BAA-314]
 gb|KID33995.1| alpha/beta hydrolase [Pseudoalteromonas distincta]
Length=329

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            + F  E G  +   IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S +P PK  
Sbjct  56   KIFYREAGAQHKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSARPNPKTQ  115

Query  641  FDYTLDEYVSSLESVINTL  697
              YT +     +E ++ TL
Sbjct  116  -KYTFELLAQYVEGLLTTL  133



>ref|WP_019494557.1| hydrolase [Calothrix sp. PCC 7103]
Length=283

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = +2

Query  452  DLFRWFCVET---GTAYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLGFGFSD  619
            D   WF  E+   G +    ++L+HG  SQ+YS+R +LP L++   H IA DW+G+GFS 
Sbjct  11   DSLEWFYRESEPIGRSDLLPVILLHGLVSQSYSWRNILPALAQQGTHAIAPDWIGYGFSS  70

Query  620  KPQPKYGFDYTLDEYVSSLESVINTL  697
            KP+ K  F YT D ++++LE  I  L
Sbjct  71   KPE-KRDFAYTPDAFITALEKFITEL  95



>ref|WP_003891450.1| alpha/beta hydrolase fold protein [Mycobacterium smegmatis]
 gb|ELQ92237.1| alpha/beta hydrolase fold protein [Mycobacterium smegmatis MKD8]
Length=287

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G A    IVL+HGFP+ ++ +R ++P+L+++H VIA D LGFGFSD P     
Sbjct  14   RIFYREAGPADAPPIVLLHGFPTSSFMFRDLIPLLARNHRVIAPDHLGFGFSDAPSADE-  72

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT D      E ++  L
Sbjct  73   FDYTFDALADLTEGLLTHL  91



>ref|WP_030904260.1| alpha/beta hydrolase [Streptomyces sp. NRRL F-5126]
Length=289

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G A    IVL+HGFP+ ++ +R ++P+L++ +HVIA D LGFGFSD P     
Sbjct  15   RIFYREAGDAGAPAIVLLHGFPTSSFMFRNLIPVLAQRYHVIAPDHLGFGFSDAPAATE-  73

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT D      + ++  L
Sbjct  74   FDYTFDALSDLTKGLLRQL  92



>ref|WP_020536171.1| hypothetical protein [Lewinella cohaerens]
Length=294

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +2

Query  497  SCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSL  676
              I+L+HG PS +Y YRK++P L+K+H VIAFDWLGFG SDKP      DYT D +  S 
Sbjct  40   ETILLLHGEPSWSYLYRKMIPGLAKNHRVIAFDWLGFGRSDKPTQIS--DYTFDFHFQSF  97

Query  677  ESVINTL  697
              +++ L
Sbjct  98   HHLLDQL  104



>ref|WP_035153850.1| hydrolase [Calothrix sp. 336/3]
 gb|KFB83904.1| hydrolase [Calothrix sp. 336/3]
Length=280

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 5/84 (6%)
 Frame = +2

Query  458  FRWFCVET---GTAYDSCIVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLGFGFSDKP  625
             +WF  E    G +    +VL+HG  SQ+YS+R ++P L+K     IA DW+G+GFSDKP
Sbjct  13   LKWFYREAEPIGRSELLPVVLLHGIVSQSYSWRNIIPALAKQGTRAIAPDWIGYGFSDKP  72

Query  626  QPKYGFDYTLDEYVSSLESVINTL  697
            + K  F YT D ++++L  +I+ L
Sbjct  73   E-KRDFAYTPDAFITALGDLIDAL  95



>ref|WP_034696482.1| hydrolase [Chryseobacterium sp. CF365]
Length=289

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G A    I+L+HG+P+ ++ +R ++PILSK +HVIA D  GFG+SD P  K  F 
Sbjct  19   FYREAGPANAPTILLLHGYPTSSHMFRNLIPILSKKYHVIAPDLPGFGYSDAPDHK-EFS  77

Query  647  YTLDEYVSSLESVINTLT  700
            YT D    ++E+ +  L 
Sbjct  78   YTFDNLAGTVEAFVEKLN  95



>ref|WP_034751257.1| hypothetical protein [Chryseobacterium vrystaatense]
 gb|KFF23287.1| hypothetical protein IW16_23650 [Chryseobacterium vrystaatense]
Length=289

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G A    I+L+HG+P+ ++ +R ++P+LS+ +HVIA D  GFG+SD P  K  FD
Sbjct  19   FYREAGPADAPTILLLHGYPTSSHMFRNLIPVLSREYHVIAPDLPGFGYSDAPDHK-QFD  77

Query  647  YTLDEYVSSLESVINTL  697
            YT D     +ES  + L
Sbjct  78   YTFDNLARMIESFTDKL  94



>ref|WP_011142803.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_925755.1| hypothetical protein glr2809 [Gloeobacter violaceus PCC 7421]
 dbj|BAC90750.1| glr2809 [Gloeobacter violaceus PCC 7421]
Length=286

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILS-KSHHVIAFDWLGFGFSDKPQPKY  637
            +WF    G+     ++L+HG PS ++ +R+ +P+L+ +   VIA DW+GFG SDKP  K 
Sbjct  14   QWFYRSAGSESGPPVLLLHGLPSHSHGWREAVPVLAERGLWVIAADWVGFGGSDKPD-KS  72

Query  638  GFDYTLDEYVSSLESVINTLT  700
             F+YT D ++++L + ++ L 
Sbjct  73   AFNYTPDAFIAALAAFVDALA  93



>emb|CDI12216.1| fragment of putative alpha/beta-Hydrolases superfamily (part 
1) [Rhizobium sp. IRBG74]
Length=91

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G      ++L HG+P  +Y YR+++P L+   H +AFDW GFG+SD P P   F 
Sbjct  19   FFREAGPIEAPVLLLPHGYPCSSYQYRRLMPALADQWHTVAFDWPGFGYSDTPDPA-QFG  77

Query  647  YTLDEYVSSLES  682
            Y  D Y   L +
Sbjct  78   YDFDAYAEVLNN  89



>ref|WP_023758537.1| hydrolase [Mesorhizobium sp. LNHC252B00]
 gb|ESY73934.1| hydrolase [Mesorhizobium sp. LNHC252B00]
Length=292

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G      ++L HG+P  ++ +R+++P LS     +AFDW GFG+SD P+P  GF 
Sbjct  19   FVREAGREDAPAVLLPHGYPCSSFQFRRLMPALSDRWRTVAFDWPGFGYSDTPEPA-GFG  77

Query  647  YTLDEYVSSLESVINTL  697
            Y  D Y   L  V + L
Sbjct  78   YDFDAYADVLTDVTDVL  94



>ref|WP_024592380.1| alpha/beta hydrolase [Pseudoalteromonas haloplanktis]
Length=331

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---  631
            + F  E G      IVL+HG+PS ++SYR+++P+LS  +HVIA D+LG G+S++P P   
Sbjct  56   KIFYREAGIQNKQTIVLLHGYPSSSHSYRELIPLLSGRYHVIAPDYLGSGYSERPNPETQ  115

Query  632  KYGFDYTLDEYVSSLESVINT  694
            KY F+  L +YV  L + +  
Sbjct  116  KYTFE-LLAQYVEGLLTTLKV  135



>ref|WP_012783485.1| alpha/beta hydrolase [Actinosynnema mirum]
 gb|ACU34823.1| alpha/beta hydrolase fold protein [Actinosynnema mirum DSM 43827]
Length=291

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G      +VL+HGFP+ +  YR ++P L+  HHVIA D LGFG SD 
Sbjct  11   ATVDGRRLFYREAGDPVKPAVVLLHGFPTSSSMYRDLIPALAADHHVIAPDHLGFGLSDA  70

Query  623  PQPKYGFDYTLD  658
            P P   FDYT D
Sbjct  71   P-PVTEFDYTFD  81



>ref|WP_029464904.1| hypothetical protein [Chitinophaga sp. JGI 0001002-D04]
Length=296

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 4/98 (4%)
 Frame = +2

Query  404  DPIFGLTMGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHV  583
            D  +G+T    +    D+F     E G A    I+ +HGFPS ++ YR +L  LS S+HV
Sbjct  7    DHTYGVTFKTVNVQGLDIF---YREAGPANAPLILFLHGFPSSSHMYRDILRDLSSSYHV  63

Query  584  IAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLESVINTL  697
            IA D+ GFG S +P P   F+YT +   + +E  I+TL
Sbjct  64   IAPDYPGFGLSSRPSPA-SFEYTFENIAAVMEQFIDTL  100



>ref|WP_035351445.1| alpha/beta hydrolase [Edaphobacter aggregans]
Length=282

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query  458  FRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKY  637
             R F  E G+     IVL+HGFPS ++ +R ++P L+   HVIA D++GFG+SD P    
Sbjct  12   LRIFYREAGSKASPTIVLLHGFPSSSHMFRDLIPQLADKFHVIAPDYVGFGYSDAPDAG-  70

Query  638  GFDYTLDEYVSSLESVI  688
             FDYT D   + +E ++
Sbjct  71   KFDYTFDNLAAHIEELL  87



>ref|WP_015141568.1| alpha/beta hydrolase [Nostoc sp. PCC 7524]
 gb|AFY51167.1| putative hydrolase or acyltransferase of alpha/beta superfamily 
[Nostoc sp. PCC 7524]
Length=281

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 5/86 (6%)
 Frame = +2

Query  452  DLFRWFCVETGTAYDS---CIVLIHGFPSQAYSYRKVLPIL-SKSHHVIAFDWLGFGFSD  619
            D F WF  E      S    +VL+HG  SQ+YS+R ++P L S+    IA DW+G+GFS 
Sbjct  11   DGFEWFYREAAPIGQSDLLPVVLLHGLVSQSYSWRNIMPALASQGTRAIAPDWIGYGFSG  70

Query  620  KPQPKYGFDYTLDEYVSSLESVINTL  697
            KP+ K  F YT D ++ +L+  IN L
Sbjct  71   KPE-KREFAYTPDAFIKALDGFINAL  95



>gb|KFY10029.1| hypothetical protein V491_07836 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=289

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  437  SQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFS  616
            S  ++D    F    G+A D  I+L+HGFPS ++ +R ++P+LSK +HVIA D+ GFGF+
Sbjct  7    STITADGVNVFYRSAGSASDPVILLLHGFPSSSHMFRNLIPLLSKQYHVIAPDFPGFGFT  66

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTL  697
            D P  +  + YT      + E+ ++ L
Sbjct  67   DVPADR-NYKYTFANLTQTTEAFLDAL  92



>ref|WP_030445674.1| alpha/beta hydrolase [Actinocatenispora sera]
Length=293

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G A    IVL+HGFP+ ++ +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATIDGHRLFYREAGDATAPTIVLLHGFPTSSFMFRNLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLD  658
            P P   FDYT D
Sbjct  69   P-PADDFDYTFD  79



>ref|WP_008263890.1| alpha/beta hydrolase fold protein [Mycobacterium sp. H4Y]
 gb|ELR82071.1| alpha/beta hydrolase fold protein [Mycobacterium sp. H4Y]
Length=289

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D +R F  E G       +L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATVDGYRLFYREAGDPRAPAALLLHGFPTSSYMFRGLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D        ++ TL
Sbjct  69   P-PVEEFDYTFDALTDLTAGLLRTL  92



>ref|WP_017309612.1| MULTISPECIES: hydrolase [Stigonematales]
 gb|KIY11094.1| hydrolase [Mastigocladus laminosus UU774]
Length=284

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  503  IVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLE  679
            +VL+HG  SQ+YS+R +LP+L++     IA DW+GFGFS KP+ K  F YT D ++++LE
Sbjct  31   VVLLHGLVSQSYSWRNILPVLAQQGTKAIAPDWIGFGFSAKPE-KRDFAYTPDAFITALE  89

Query  680  SVINTL  697
              I  L
Sbjct  90   GFIQAL  95



>gb|KIW71668.1| hypothetical protein PV04_03807 [Capronia semiimmersa]
Length=289

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G+  +  I+L+HGFPS +Y Y+K++PILS  +HV+A D  GFGF++ P     
Sbjct  10   RVFYREAGSPSNPTILLLHGFPSSSYQYQKLMPILSTKYHVVAPDLPGFGFTEIPS-SLD  68

Query  641  FDYTLDEYVSSLESVINTL  697
            F YT   + +++ S ++ L
Sbjct  69   FKYTFANFATTIGSFLDVL  87



>ref|WP_012921080.1| hydrolase [Kribbella flavida]
 gb|ADB32524.1| alpha/beta hydrolase fold protein [Kribbella flavida DSM 17836]
Length=298

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +2

Query  476  ETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTL  655
            E G    + +VL+HGFP+ +YS+R VLP+L +  +V+A D  GFGFSD P P   +DYT 
Sbjct  23   EAGAPCSTAVVLLHGFPTSSYSFRAVLPVLGRHAYVVAPDLPGFGFSDAP-PLGEYDYTF  81

Query  656  DEYVSSLESVINTL  697
            +     +E++++ L
Sbjct  82   ERLSHVIEALVDDL  95



>ref|WP_033343119.1| alpha/beta hydrolase [Catenuloplanes japonicus]
Length=285

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G      +VL+HGFP+ ++ +R ++P+L++ HHVIA D LGFG SD 
Sbjct  7    ATVDGRRLFYREAGNPDRPTVVLLHGFPTSSHMFRGLIPLLAEDHHVIAPDHLGFGLSDA  66

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P      DYT D   +  E ++  L
Sbjct  67   PT---DVDYTFDALTALTEGLLEQL  88



>ref|WP_020716171.1| hypothetical protein [Acidobacteriaceae bacterium KBS 89]
Length=282

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query  458  FRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKY  637
             + F  E G+     IVL+HGFPS ++ +R ++P L+   HVIA D++GFG+SD P    
Sbjct  12   LKVFYREAGSKVSPTIVLLHGFPSSSHMFRDLIPQLAGKFHVIAPDYVGFGYSDAPDASR  71

Query  638  GFDYTLDEYVSSLESVI  688
             FDYT D   S +E ++
Sbjct  72   -FDYTFDNLASHVEELL  87



>ref|WP_020563565.1| hypothetical protein [Methylosarcina fibrata]
Length=298

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +2

Query  425  MGAGSQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLG  604
            M     ++ D  + F  E G      IVL+HGFPS ++ +R ++P L+   HVIA D+LG
Sbjct  1    MNTFHHANIDGHKIFYREAGANSAPVIVLLHGFPSSSHMFRDLIPKLADRFHVIAPDYLG  60

Query  605  FGFSDKPQPKYGFDYTLDEYVSSLESVINT  694
            FG+SD+P  K  F YT D   + +E ++ T
Sbjct  61   FGYSDQPGAK-EFHYTFDNLSAQIEKLLFT  89



>ref|WP_040573189.1| alpha/beta hydrolase, partial [Methylovulum miyakonense]
Length=303

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP---KY  637
            F  E G      IVL+HGFPS +++YR+++P+LS   H+IA D+LG G+SD P P    Y
Sbjct  29   FFREAGDPSKPTIVLLHGFPSSSHTYRELIPLLSGKFHLIAPDYLGSGYSDHPDPGQTAY  88

Query  638  GFDYTLDEYVSSLESVIN  691
             FD  L +YVS L S ++
Sbjct  89   TFD-LLAKYVSGLLSALD  105



>ref|WP_007166357.1| alpha/beta hydrolase [Mycobacterium parascrofulaceum]
 gb|EFG77786.1| hydrolase, alpha/beta domain protein [Mycobacterium parascrofulaceum 
ATCC BAA-614]
Length=290

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G      +VL+HGFP+ +Y +R +LP L+  +HV+A D LGFG SD 
Sbjct  9    ATVDGRRLFYREAGDPNAPALVLLHGFPTSSYMFRHLLPALADRYHVVAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P  +  FDYT D        ++ TL
Sbjct  69   PSVRE-FDYTFDALTDLTAGLLGTL  92



>ref|WP_021592560.1| hypothetical protein [Actinomadura madurae]
Length=292

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G A    IVL+HGFP+ ++ +R ++P L++ +HVIA D LGFG SD P P   
Sbjct  15   RLFYREAGPADAPVIVLLHGFPTSSFMFRDLIPPLARRYHVIAPDLLGFGLSDAP-PAGE  73

Query  641  FDYTLD  658
            FDYT D
Sbjct  74   FDYTFD  79



>ref|WP_034848205.1| hydrolase [Elizabethkingia meningoseptica]
 gb|KFC34524.1| hydrolase [Elizabethkingia meningoseptica]
Length=289

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +2

Query  458  FRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKY  637
             + F  E G      ++L+HG+P+ ++ +R ++PILSK  H+IA D  GFGFSD P  K 
Sbjct  16   LKIFFREAGNPNKPTLLLLHGYPTSSHMFRNLIPILSKQLHIIAPDLPGFGFSDAPDHK-  74

Query  638  GFDYTLDEYVSSLESVINTL  697
             F+YT D     ++S I  L
Sbjct  75   AFNYTFDHLAQVMQSFIEQL  94



>gb|KFY27996.1| hypothetical protein V493_03163 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=289

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +2

Query  437  SQSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFS  616
            S  ++D  + F    G+A D  I+L+HGFPS ++ +R ++P+LSK +HVIA D  GFGF+
Sbjct  7    STITADGVQVFYRSAGSASDPVILLLHGFPSSSHMFRNLIPLLSKQYHVIAPDLPGFGFT  66

Query  617  DKPQPKYGFDYTLDEYVSSLESVINTL  697
              P  +  ++YT +    ++E+ ++ L
Sbjct  67   SVPAGR-NYEYTFENLTLTIEAFLDAL  92



>emb|CKG84785.1| alpha/beta hydrolase fold protein [Mycobacterium smegmatis]
Length=287

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F    G A    IVL+HGFP+ ++ +R ++P+L+++H VIA D LGFGFSD 
Sbjct  8    ATVDGQRIFYRAAGPADAPPIVLLHGFPTSSFMFRDLIPLLARNHRVIAPDHLGFGFSDA  67

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P     FDYT D      E ++  L
Sbjct  68   PSAD-EFDYTFDALADLTEGLLTHL  91



>ref|WP_012250781.1| hydrolase [Bordetella petrii]
 emb|CAP44235.1| putative hydrolase [Bordetella petrii]
Length=291

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +2

Query  449  SDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQ  628
            +D  R+F  E G      ++L+HGFPS ++ +R V+P L++   VIA D  GFGF++ P 
Sbjct  16   ADGLRFFYREAGDPQAPVLLLLHGFPSSSHQFRNVIPRLARKFRVIAPDLPGFGFTEVPA  75

Query  629  PKYGFDYTLDEYVSSLESVIN  691
             + G+ YT D    SLE++++
Sbjct  76   ER-GYRYTFDNLAKSLEALVD  95



>ref|WP_011726677.1| hydrolase [Mycobacterium smegmatis]
 ref|YP_884533.1| hydrolase [Mycobacterium smegmatis str. MC2 155]
 gb|ABK75028.1| hydrolase [Mycobacterium smegmatis str. MC2 155]
 gb|AFP36595.1| Alpha/beta hydrolase fold protein [Mycobacterium smegmatis str. 
MC2 155]
 gb|AIU05398.1| alpha/beta hydrolase [Mycobacterium smegmatis str. MC2 155]
 gb|AIU12023.1| alpha/beta hydrolase [Mycobacterium smegmatis]
 gb|AIU18647.1| alpha/beta hydrolase [Mycobacterium smegmatis]
Length=287

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F    G A    IVL+HGFP+ ++ +R ++P+L+++H VIA D LGFGFSD P     
Sbjct  14   RIFYRAAGPADAPPIVLLHGFPTSSFMFRDLIPLLARNHRVIAPDHLGFGFSDAPSAD-E  72

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT D      E ++  L
Sbjct  73   FDYTFDALADLTEGLLTHL  91



>ref|WP_039851703.1| hydrolase [Myroides odoratimimus]
Length=289

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G +    ++L+HG+P+ ++ +R ++PILSK +H+IA D  GFGFSD P  K  F+
Sbjct  19   FYREAGDSNKPTLLLLHGYPTSSHMFRNLIPILSKQYHIIAPDLPGFGFSDAPDHK-TFN  77

Query  647  YTLDEYVSSLESVINTL  697
            YT D     ++S I  +
Sbjct  78   YTFDHLAQVMQSFIEQV  94



>ref|WP_042910654.1| alpha/beta hydrolase [Mycobacterium intracellulare]
 gb|ETZ34876.1| alpha/beta hydrolase fold family protein [Mycobacterium intracellulare 
MIN_052511_1280]
Length=289

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G       +L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATVDGHRLFYREAGDPRAPAALLLHGFPTSSYMFRGLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D        ++ TL
Sbjct  69   P-PVEEFDYTFDALTDLTAGLVRTL  92



>ref|WP_034762421.1| hydrolase [Chryseobacterium gregarium]
Length=280

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G      I+L+HG+P+ ++ +R ++PILS  +HVIA D  GFG+SD P  K+ FD
Sbjct  9    FYREAGPKDAPTILLLHGYPTSSHMFRNLIPILSDKYHVIAPDLPGFGYSDAPDRKH-FD  67

Query  647  YTLDEYVSSLESVINTL  697
            YT      +++  I+TL
Sbjct  68   YTFANMTKTMQCFIDTL  84



>ref|WP_045055854.1| hydrolase [Chroococcales cyanobacterium CENA595]
 gb|KJH70729.1| hydrolase [Chroococcales cyanobacterium CENA595]
Length=281

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = +2

Query  458  FRWFCVETGTAYDS---CIVLIHGFPSQAYSYRKVLPILS-KSHHVIAFDWLGFGFSDKP  625
              WF  E+    ++    ++L+HG PSQ+YS+R ++P L+ K    IA DW+GFG+S KP
Sbjct  13   LEWFYRESAPRGETDLLPVILLHGLPSQSYSWRHIMPALADKGTRAIAPDWIGFGYSSKP  72

Query  626  QPKYGFDYTLDEYVSSLESVINTL  697
              K  F YT D ++++L  +I  L
Sbjct  73   D-KRDFAYTPDAFITALAELIAAL  95



>gb|EKJ95143.1| alpha/beta hydrolase fold protein [Rhizobium lupini HPC(L)]
Length=337

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 62/135 (46%), Gaps = 24/135 (18%)
 Frame = +2

Query  314  SDEPSPADEWFKQGRIVKAHLVNGSGEKAKDP------IFGLTMGAGSQSSSDLFRWFCV  475
            + EP PA          +  +V G GE  +        I    M  G+ S       F  
Sbjct  22   TTEPEPAK---------RVMMVPGDGEAVRRERVNRCNITHRRMTIGTHSL------FFR  66

Query  476  ETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP-KYGFDYT  652
            E G      ++L HG+P  +Y YR+++P L+     +AFDW GFG+SD P P ++G+D+ 
Sbjct  67   EAGPIEAPVLLLPHGYPCSSYQYRRLMPALADQWRTVAFDWPGFGYSDTPDPAEFGYDF-  125

Query  653  LDEYVSSLESVINTL  697
             D Y   L +V   L
Sbjct  126  -DAYAEVLNNVAEAL  139



>gb|EHO11930.1| hypothetical protein HMPREF9712_00177 [Myroides odoratimimus 
CCUG 10230]
Length=325

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G +    ++L+HG+P+ ++ +R ++PILSK +H+IA D  GFGFSD P  K  F+
Sbjct  55   FYREAGDSNKPTLLLLHGYPTSSHMFRNLIPILSKQYHIIAPDLPGFGFSDAPDHK-TFN  113

Query  647  YTLDEYVSSLESVINTL  697
            YT D     ++S I  +
Sbjct  114  YTFDHLAQVMQSFIEQV  130



>gb|KIW48116.1| hypothetical protein PV06_00735 [Exophiala oligosperma]
Length=288

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +2

Query  458  FRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKY  637
             R F  E G+A +  ++L+HGFP+ ++ YR ++ IL++ +HVIA D  GFGF++ P+ K 
Sbjct  9    IRVFYREAGSASNPTVLLLHGFPASSFQYRNLMLILAEKYHVIAPDLPGFGFTEVPE-KL  67

Query  638  GFDYTLDEYVSSLESVINTL  697
             F YT     +++ S ++ L
Sbjct  68   NFKYTFANIATTIGSFLDVL  87



>ref|WP_035451424.1| hydrolase [Lactobacillus composti]
 dbj|GAF38900.1| alpha/beta hydrolase fold [Lactobacillus composti DSM 18527 = 
JCM 14202]
Length=292

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  RW  VE G  +   +VLI GFP  AY++R+V+PIL+ ++HV+A D  G G+S  
Sbjct  12   TTDDGIRWHLVEAGVTHKLTLVLIAGFPESAYAWRRVIPILAANYHVLAIDLPGQGYSSV  71

Query  623  PQPKYGFD  646
            P    GFD
Sbjct  72   PTT--GFD  77



>ref|WP_009951924.1| MULTISPECIES: alpha/beta hydrolase [Mycobacterium]
 gb|AFC47006.1| alpha/beta hydrolase fold protein [Mycobacterium intracellulare 
MOTT-02]
 gb|AFC52170.1| alpha/beta hydrolase fold protein [Mycobacterium intracellulare 
MOTT-64]
 gb|AFJ33613.1| alpha/beta hydrolase fold protein [Mycobacterium sp. MOTT36Y]
 gb|AFS12784.1| 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase [Mycobacterium 
indicus pranii MTCC 9506]
 gb|ETZ39410.1| alpha/beta hydrolase fold family protein [Mycobacterium intracellulare 
MIN_061107_1834]
 gb|EUA25320.1| alpha/beta hydrolase fold family protein [Mycobacterium avium 
subsp. avium 2285 (S)]
 gb|EUA57294.1| alpha/beta hydrolase fold family protein [Mycobacterium intracellulare 
1956]
 gb|AIT83932.1| alpha/beta hydrolase [Mycobacterium intracellulare 1956]
Length=289

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G       +L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATVDGHRLFYREAGDPRAPAALLLHGFPTSSYMFRGLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D        ++ TL
Sbjct  69   P-PVEEFDYTFDALTDLTAGLLRTL  92



>ref|WP_020821568.1| alpha/beta hydrolase fold protein [Mycobacterium yongonense]
 gb|AGP62186.1| alpha/beta hydrolase fold protein [Mycobacterium yongonense 05-1390]
Length=289

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G       +L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATVDGHRLFYREAGDPRTPTALLLHGFPTSSYMFRGLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D        ++ TL
Sbjct  69   P-PVEEFDYTFDALTDLTAGLLRTL  92



>ref|WP_024441819.1| alpha/beta hydrolase [Mycobacterium sp. UM_WGJ]
Length=290

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +2

Query  440  QSSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSD  619
             ++ D  R F  E G +    +VL+HGFP+ +Y +R ++  L+  +HVIA D+LGFG+SD
Sbjct  9    HATVDGHRLFYREAGRSDAPAVVLLHGFPTSSYMFRDLITRLADDYHVIAPDYLGFGYSD  68

Query  620  KPQPKYGFDYTLDEYVSSLESVINTL  697
             P     FDYT D      +++++ L
Sbjct  69   MPLASE-FDYTFDNLADLTQALLDQL  93



>ref|WP_032789500.1| alpha/beta hydrolase [Streptomyces sp. JS01]
 gb|KFK85217.1| alpha/beta hydrolase [Streptomyces sp. JS01]
Length=288

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  476  ETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFDYTL  655
            E G A    IVL+HG+P+ ++ +R+++P+L+ ++HVIA D LGFG SD P P   FDYT 
Sbjct  20   EAGPADAPVIVLLHGYPTSSFMFRELIPLLADAYHVIAPDHLGFGHSDAP-PATEFDYTF  78

Query  656  DEYVSSLESVINTLT  700
            D        +++ L 
Sbjct  79   DALAELTSGLLDQLV  93



>ref|WP_036396872.1| alpha/beta hydrolase [Mycobacterium cosmeticum]
 emb|CDO06658.1| alpha/beta hydrolase fold protein [Mycobacterium cosmeticum]
Length=291

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G A+   ++L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD P     
Sbjct  15   RLFYREAGDAHAPAVILLHGFPTSSYMFRHLIPALANDYHVIAPDHLGFGLSDAPTAD-D  73

Query  641  FDYTLDEYVSSLESVINTLT  700
            F+YT D        ++  L 
Sbjct  74   FNYTFDTLTRLTAGLLQALN  93



>ref|WP_035689835.1| hydrolase [Flavobacterium reichenbachii]
 gb|KFF02898.1| hydrolase [Flavobacterium reichenbachii]
Length=287

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +2

Query  458  FRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKY  637
             + F  E G+     ++L+HG+P+ ++ +R ++P+LSK +HVIA D  GFGFSD P    
Sbjct  14   LKIFYREAGSKDAPTVLLLHGYPTSSHMFRNLIPMLSKKYHVIAPDLPGFGFSDAPD-HL  72

Query  638  GFDYTLDEYVSSLESVINTL  697
             F YT D   ++++  I+ L
Sbjct  73   SFQYTFDNLANTMQGFIDKL  92



>ref|WP_024450885.1| alpha/beta hydrolase [Mycobacterium sp. UM_RHS]
Length=291

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G A+   ++L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD P     
Sbjct  15   RLFYREAGDAHAPAVILLHGFPTSSYMFRHLIPALANDYHVIAPDHLGFGLSDAPTAD-D  73

Query  641  FDYTLDEYVSSLESVINTLT  700
            F+YT D        ++  L 
Sbjct  74   FNYTFDTLTRLTAGLLQALN  93



>ref|WP_029111689.1| alpha/beta hydrolase [Mycobacterium sp. URHD0025]
Length=286

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G      IVL+HGFP+ +Y +R ++P L+  +HVIA D LG+G SD P     
Sbjct  14   RLFYREAGAPDAPAIVLLHGFPTSSYMFRDLIPRLADRYHVIAPDHLGYGHSDAPAVT-E  72

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT D      +S++N L
Sbjct  73   FDYTFDALADLTDSLLNQL  91



>ref|WP_016863530.1| hydrolase [Fischerella muscicola]
Length=283

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = +2

Query  503  IVLIHGFPSQAYSYRKVLPILSKS-HHVIAFDWLGFGFSDKPQPKYGFDYTLDEYVSSLE  679
            +VL+HG  SQ+YS+R +LP L++     IA DW+GFGFS KP+ K  F YT D ++++LE
Sbjct  31   VVLLHGLVSQSYSWRNILPALAQQGTKAIAPDWIGFGFSAKPE-KRDFAYTSDAFITALE  89

Query  680  SVINTL  697
              I  L
Sbjct  90   GFIKAL  95



>ref|WP_014379096.1| alpha/beta hydrolase [Mycobacterium intracellulare]
 gb|AFC41867.1| alpha/beta hydrolase fold protein [Mycobacterium intracellulare 
ATCC 13950]
Length=289

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G       +L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATVDGHRLFYREAGDPRAPTALLLHGFPTSSYMFRGLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D        ++ TL
Sbjct  69   P-PVEEFDYTFDALTDLTAGLLRTL  92



>ref|WP_042936317.1| hydrolase [Rhizobium lupini]
Length=282

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 3/78 (4%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQP-KYGF  643
            F  E G      ++L HG+P  +Y YR+++P L+     +AFDW GFG+SD P P ++G+
Sbjct  9    FFREAGPIEAPVLLLPHGYPCSSYQYRRLMPALADQWRTVAFDWPGFGYSDTPDPAEFGY  68

Query  644  DYTLDEYVSSLESVINTL  697
            D+  D Y   L +V   L
Sbjct  69   DF--DAYAEVLNNVAEAL  84



>ref|WP_039330420.1| hydrolase [Myroides sp. A21]
Length=289

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G      ++L+HG+P+ ++ +R ++PILSK +H+IA D  GFGFSD P  K  F+
Sbjct  19   FYREAGDPNKPTLLLLHGYPTSSHMFRNLIPILSKQYHIIAPDLPGFGFSDAPDHK-TFN  77

Query  647  YTLDEYVSSLESVINTL  697
            YT D     ++S I  +
Sbjct  78   YTFDHLAQVMQSFIEQV  94



>dbj|GAO01748.1| putative hydrolase YNR064C [Anaeromyxobacter sp. PSR-1]
Length=312

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E G      IVL+HGFPS ++ +R ++P+L+   HV+A D+ GFG SD P P   + 
Sbjct  44   FFREAGPPDAPAIVLLHGFPSSSHMFRDLIPLLATRFHVVAPDYPGFGHSDAPPPG-AYR  102

Query  647  YTLDEYVSSLESVINTL  697
            YT D    ++E+++  L
Sbjct  103  YTFDRLAETMETLLEQL  119



>ref|WP_036454597.1| alpha/beta hydrolase [Mycobacterium sp. TKK-01-0059]
 gb|KEF97733.1| hypothetical protein K883_02505 [Mycobacterium sp. TKK-01-0059]
Length=289

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
            ++ D  R F  E G       +L+HGFP+ +Y +R ++P L+  +HVIA D LGFG SD 
Sbjct  9    ATVDGHRLFYREAGDPRAPTALLLHGFPTSSYMFRGLIPALADRYHVIAPDHLGFGLSDA  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D        ++ TL
Sbjct  69   P-PVEEFDYTFDALTDLTAGLLRTL  92



>emb|CCD34864.1| similar to alpha/beta hydrolase [Botrytis cinerea T4]
Length=179

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  467  FCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYGFD  646
            F  E+G +    ++L+HGFPS ++ +R ++P+LSK +H++A D  GFGF+  P+    + 
Sbjct  17   FYRESGPSDAPTLLLLHGFPSSSHQFRNLIPLLSKKYHILAPDIPGFGFTTVPE-SLNYK  75

Query  647  YTLDEYVSSLESVINTL  697
            YT D   +S+ES +  L
Sbjct  76   YTFDALTTSIESFLREL  92



>ref|WP_026442337.1| hypothetical protein [Acidobacterium sp. PMMR2]
Length=288

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +2

Query  443  SSSDLFRWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDK  622
             + D  + F  E G      +VL+HGFPS ++ +R ++P LS  +HVIA D  GFG+SD+
Sbjct  9    QAVDGVKIFYREAGDPSRHTVVLLHGFPSSSHMFRDLIPELSGKYHVIAADMPGFGYSDQ  68

Query  623  PQPKYGFDYTLDEYVSSLESVINTL  697
            P P   FDYT D     ++  ++++
Sbjct  69   P-PSDQFDYTFDHIAEVMDRFLDSV  92



>ref|WP_020013448.1| hypothetical protein [Promicromonospora sukumoe]
Length=288

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  461  RWFCVETGTAYDSCIVLIHGFPSQAYSYRKVLPILSKSHHVIAFDWLGFGFSDKPQPKYG  640
            R F  E G+     +VL+HGFP+ ++ +R ++P+L+  +HVIA D LGFG SD P     
Sbjct  15   RLFYREAGSPQAPTLVLLHGFPTSSHMFRNLIPLLADRYHVIAPDHLGFGLSDTPGANE-  73

Query  641  FDYTLDEYVSSLESVINTL  697
            FDYT D      E +++ +
Sbjct  74   FDYTFDALTDLTEGLLDAI  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394