BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5053

Length=659
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076286.1|  PREDICTED: probable inactive leucine-rich re...    153   3e-39   Sesamum indicum [beniseed]
ref|XP_004299037.1|  PREDICTED: probable inactive leucine-rich re...    151   1e-38   Fragaria vesca subsp. vesca
ref|XP_008339638.1|  PREDICTED: probable inactive leucine-rich re...    150   3e-38   Malus domestica [apple tree]
ref|XP_009357243.1|  PREDICTED: probable inactive leucine-rich re...    149   6e-38   Pyrus x bretschneideri [bai li]
gb|EYU40794.1|  hypothetical protein MIMGU_mgv1a024372mg                148   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_007227346.1|  hypothetical protein PRUPE_ppa002204mg             148   1e-37   
ref|XP_008389257.1|  PREDICTED: probable inactive leucine-rich re...    148   2e-37   
ref|XP_008243284.1|  PREDICTED: probable inactive leucine-rich re...    148   2e-37   Prunus mume [ume]
ref|XP_012075725.1|  PREDICTED: probable inactive leucine-rich re...    147   4e-37   Jatropha curcas
ref|XP_009356227.1|  PREDICTED: probable inactive leucine-rich re...    143   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_010695919.1|  PREDICTED: probable inactive leucine-rich re...    142   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011070766.1|  PREDICTED: probable inactive leucine-rich re...    142   2e-35   
emb|CDP00668.1|  unnamed protein product                                142   3e-35   Coffea canephora [robusta coffee]
ref|XP_002282768.1|  PREDICTED: probable inactive leucine-rich re...    141   6e-35   Vitis vinifera
ref|XP_009630462.1|  PREDICTED: probable inactive leucine-rich re...    140   1e-34   Nicotiana tomentosiformis
ref|XP_011038748.1|  PREDICTED: probable inactive leucine-rich re...    140   1e-34   Populus euphratica
emb|CAN73490.1|  hypothetical protein VITISV_040575                     140   1e-34   Vitis vinifera
gb|KDO76897.1|  hypothetical protein CISIN_1g005102mg                   140   1e-34   Citrus sinensis [apfelsine]
ref|XP_009801886.1|  PREDICTED: probable inactive leucine-rich re...    139   2e-34   Nicotiana sylvestris
ref|XP_003555253.1|  PREDICTED: probable inactive leucine-rich re...    139   2e-34   Glycine max [soybeans]
ref|XP_003555049.1|  PREDICTED: probable inactive leucine-rich re...    139   3e-34   Glycine max [soybeans]
ref|XP_006448399.1|  hypothetical protein CICLE_v10014433mg             139   3e-34   Citrus clementina [clementine]
ref|XP_006468755.1|  PREDICTED: probable inactive leucine-rich re...    139   4e-34   Citrus sinensis [apfelsine]
ref|XP_010922469.1|  PREDICTED: probable inactive leucine-rich re...    139   4e-34   Elaeis guineensis
ref|XP_007044230.1|  Leucine-rich repeat protein kinase family pr...    139   5e-34   
ref|XP_008446637.1|  PREDICTED: probable inactive leucine-rich re...    138   8e-34   Cucumis melo [Oriental melon]
ref|XP_011655791.1|  PREDICTED: probable inactive leucine-rich re...    137   1e-33   Cucumis sativus [cucumbers]
ref|XP_002315920.1|  leucine-rich repeat transmembrane protein ki...    137   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004238893.1|  PREDICTED: probable inactive leucine-rich re...    135   6e-33   Solanum lycopersicum
ref|XP_011022504.1|  PREDICTED: probable inactive leucine-rich re...    135   7e-33   Populus euphratica
ref|XP_002311473.2|  leucine-rich repeat transmembrane protein ki...    135   9e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010262185.1|  PREDICTED: probable inactive leucine-rich re...    134   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002526283.1|  ATP binding protein, putative                      134   2e-32   Ricinus communis
ref|XP_010279368.1|  PREDICTED: probable inactive leucine-rich re...    133   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008377042.1|  PREDICTED: probable inactive leucine-rich re...    128   8e-32   
gb|EYU30010.1|  hypothetical protein MIMGU_mgv1a002330mg                132   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006344171.1|  PREDICTED: probable inactive leucine-rich re...    131   2e-31   Solanum tuberosum [potatoes]
ref|XP_002876736.1|  hypothetical protein ARALYDRAFT_484030             131   3e-31   
gb|KJB31482.1|  hypothetical protein B456_005G193500                    130   4e-31   Gossypium raimondii
ref|XP_010916465.1|  PREDICTED: probable inactive leucine-rich re...    130   5e-31   
ref|XP_003536668.1|  PREDICTED: probable inactive leucine-rich re...    130   6e-31   Glycine max [soybeans]
gb|KJB31483.1|  hypothetical protein B456_005G193500                    130   7e-31   Gossypium raimondii
ref|XP_009395564.1|  PREDICTED: probable inactive leucine-rich re...    129   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_178230.1|  leucine-rich repeat transmembrane protein kinas...    129   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810049.1|  PREDICTED: probable inactive leucine-rich re...    129   9e-31   Phoenix dactylifera
ref|XP_008809165.1|  PREDICTED: probable inactive leucine-rich re...    129   1e-30   Phoenix dactylifera
ref|XP_006306904.1|  hypothetical protein CARUB_v10008465mg             129   1e-30   Capsella rubella
ref|XP_009418392.1|  PREDICTED: probable inactive leucine-rich re...    129   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010477947.1|  PREDICTED: probable inactive leucine-rich re...    128   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010499124.1|  PREDICTED: probable inactive leucine-rich re...    128   2e-30   Camelina sativa [gold-of-pleasure]
gb|EPS65629.1|  hypothetical protein M569_09144                         128   2e-30   Genlisea aurea
ref|NP_564228.1|  leucine-rich repeat-containing protein kinase         128   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424856.1|  PREDICTED: probable inactive leucine-rich re...    127   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010066684.1|  PREDICTED: probable inactive leucine-rich re...    127   7e-30   Eucalyptus grandis [rose gum]
ref|XP_009413652.1|  PREDICTED: probable inactive leucine-rich re...    127   8e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010502083.1|  PREDICTED: probable inactive leucine-rich re...    127   8e-30   Camelina sativa [gold-of-pleasure]
gb|KFK33342.1|  hypothetical protein AALP_AA5G001600                    126   1e-29   Arabis alpina [alpine rockcress]
ref|XP_008229314.1|  PREDICTED: probable inactive leucine-rich re...    127   1e-29   
ref|XP_006843749.2|  PREDICTED: probable inactive leucine-rich re...    126   1e-29   Amborella trichopoda
ref|XP_010460394.1|  PREDICTED: probable inactive leucine-rich re...    126   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_011623083.1|  PREDICTED: probable inactive leucine-rich re...    126   1e-29   Amborella trichopoda
ref|XP_007142963.1|  hypothetical protein PHAVU_007G032100g             126   1e-29   Phaseolus vulgaris [French bean]
ref|XP_010513827.1|  PREDICTED: probable inactive leucine-rich re...    126   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010527771.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    125   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_007216807.1|  hypothetical protein PRUPE_ppa023239mg             125   3e-29   Prunus persica
ref|XP_006415859.1|  hypothetical protein EUTSA_v10006964mg             125   4e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010554434.1|  PREDICTED: probable inactive leucine-rich re...    125   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_004497046.1|  PREDICTED: probable inactive leucine-rich re...    125   4e-29   Cicer arietinum [garbanzo]
ref|XP_008343005.1|  PREDICTED: probable inactive leucine-rich re...    124   5e-29   
emb|CDY42116.1|  BnaA09g28440D                                          123   1e-28   Brassica napus [oilseed rape]
emb|CDY17688.1|  BnaA06g35070D                                          123   2e-28   Brassica napus [oilseed rape]
gb|KJB61249.1|  hypothetical protein B456_009G348000                    122   2e-28   Gossypium raimondii
ref|XP_009394442.1|  PREDICTED: probable inactive leucine-rich re...    123   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393570.1|  PREDICTED: probable inactive leucine-rich re...    122   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006398506.1|  hypothetical protein EUTSA_v10000800mg             122   5e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006290656.1|  hypothetical protein CARUB_v10016748mg             121   6e-28   Capsella rubella
ref|XP_010906986.1|  PREDICTED: probable inactive leucine-rich re...    121   6e-28   Elaeis guineensis
ref|XP_010534193.1|  PREDICTED: probable inactive leucine-rich re...    119   8e-28   Tarenaya hassleriana [spider flower]
gb|KEH44189.1|  LRR receptor-like kinase                                120   1e-27   Medicago truncatula
ref|XP_010542166.1|  PREDICTED: probable inactive leucine-rich re...    119   2e-27   
ref|XP_009101362.1|  PREDICTED: probable inactive leucine-rich re...    120   2e-27   Brassica rapa
emb|CDX84980.1|  BnaC05g20750D                                          120   2e-27   
ref|XP_010542164.1|  PREDICTED: probable inactive leucine-rich re...    119   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_009344127.1|  PREDICTED: probable inactive leucine-rich re...    119   5e-27   Pyrus x bretschneideri [bai li]
gb|KFK44531.1|  hypothetical protein AALP_AA1G268700                    119   5e-27   Arabis alpina [alpine rockcress]
ref|XP_009115301.1|  PREDICTED: probable inactive leucine-rich re...    119   6e-27   Brassica rapa
ref|XP_009341317.1|  PREDICTED: probable inactive leucine-rich re...    116   4e-26   
ref|XP_004147142.2|  PREDICTED: probable inactive leucine-rich re...    114   2e-25   Cucumis sativus [cucumbers]
emb|CDX77808.1|  BnaC07g20620D                                          112   1e-24   
gb|EPS72631.1|  hypothetical protein M569_02128                         110   3e-24   Genlisea aurea
ref|XP_008467183.1|  PREDICTED: probable inactive leucine-rich re...    110   4e-24   Cucumis melo [Oriental melon]
gb|KHN42429.1|  Putative inactive leucine-rich repeat receptor-li...    109   8e-24   Glycine soja [wild soybean]
ref|XP_010108889.1|  putative inactive leucine-rich repeat recept...    107   4e-23   Morus notabilis
gb|KHN06695.1|  Putative inactive leucine-rich repeat receptor-li...    105   2e-22   Glycine soja [wild soybean]
dbj|BAJ89657.1|  predicted protein                                      103   8e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007033179.1|  Leucine-rich repeat protein kinase family pr...    103   9e-22   
ref|XP_006430721.1|  hypothetical protein CICLE_v10013476mg             103   1e-21   Citrus clementina [clementine]
ref|XP_011035107.1|  PREDICTED: probable inactive leucine-rich re...    103   1e-21   Populus euphratica
gb|KDO63201.1|  hypothetical protein CISIN_1g042348mg                   101   5e-21   Citrus sinensis [apfelsine]
ref|XP_008441289.1|  PREDICTED: probable inactive leucine-rich re...    101   9e-21   Cucumis melo [Oriental melon]
ref|XP_004309737.1|  PREDICTED: probable inactive leucine-rich re...    100   9e-21   Fragaria vesca subsp. vesca
ref|XP_002305177.1|  hypothetical protein POPTR_0004s09480g             100   1e-20   
ref|XP_006482200.1|  PREDICTED: probable inactive leucine-rich re...    100   1e-20   Citrus sinensis [apfelsine]
ref|XP_003567755.1|  PREDICTED: probable inactive leucine-rich re...  99.4    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_002989681.1|  hypothetical protein SELMODRAFT_41472            99.0    4e-20   
ref|XP_002991799.1|  hypothetical protein SELMODRAFT_41473            99.0    5e-20   
ref|XP_010474154.1|  PREDICTED: probable inactive leucine-rich re...  99.0    5e-20   
ref|XP_002528076.1|  ATP binding protein, putative                    98.6    7e-20   Ricinus communis
ref|XP_011021296.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  97.4    2e-19   Populus euphratica
ref|XP_010032651.1|  PREDICTED: probable inactive leucine-rich re...  97.4    2e-19   Eucalyptus grandis [rose gum]
ref|XP_004138802.1|  PREDICTED: probable inactive leucine-rich re...  97.1    2e-19   Cucumis sativus [cucumbers]
ref|XP_011649930.1|  PREDICTED: probable inactive leucine-rich re...  97.1    2e-19   Cucumis sativus [cucumbers]
ref|NP_176855.1|  probable inactive leucine-rich repeat receptor-...  96.7    2e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01034.1|  hypothetical protein                                 96.7    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462033.1|  hypothetical protein SORBIDRAFT_02g013100        97.1    2e-19   Sorghum bicolor [broomcorn]
ref|XP_004968837.1|  PREDICTED: probable inactive leucine-rich re...  96.7    3e-19   Setaria italica
gb|KJB43117.1|  hypothetical protein B456_007G184800                  96.7    3e-19   Gossypium raimondii
ref|XP_012078013.1|  PREDICTED: probable inactive leucine-rich re...  96.3    4e-19   Jatropha curcas
ref|XP_006300314.1|  hypothetical protein CARUB_v10019896mg           96.3    4e-19   Capsella rubella
ref|XP_006391437.1|  hypothetical protein EUTSA_v10018224mg           95.9    4e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008674174.1|  PREDICTED: probable inactive leucine-rich re...  95.5    7e-19   
ref|XP_010511585.1|  PREDICTED: probable inactive leucine-rich re...  94.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010528994.1|  PREDICTED: probable inactive leucine-rich re...  94.4    1e-18   
ref|NP_001043190.1|  Os01g0514700                                     94.7    1e-18   
gb|EAY74284.1|  hypothetical protein OsI_02173                        94.7    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009406412.1|  PREDICTED: probable inactive leucine-rich re...  94.7    2e-18   
emb|CDX96123.1|  BnaA07g26080D                                        92.4    2e-18   
gb|KCW52086.1|  hypothetical protein EUGRSUZ_J01521                   90.5    3e-18   Eucalyptus grandis [rose gum]
ref|XP_010034448.1|  PREDICTED: probable inactive leucine-rich re...  90.5    4e-18   Eucalyptus grandis [rose gum]
gb|EEC68048.1|  hypothetical protein OsI_35883                        92.4    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006383406.1|  hypothetical protein POPTR_0005s15180g           92.8    6e-18   
ref|NP_001067730.1|  Os11g0300600                                     92.0    8e-18   
ref|XP_010032652.1|  PREDICTED: probable inactive leucine-rich re...  92.4    9e-18   Eucalyptus grandis [rose gum]
ref|XP_002457921.1|  hypothetical protein SORBIDRAFT_03g021850        92.0    1e-17   Sorghum bicolor [broomcorn]
gb|EAZ12114.1|  hypothetical protein OsJ_01996                        90.9    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010239182.1|  PREDICTED: probable LRR receptor-like serine...  90.5    2e-17   
ref|XP_010032653.1|  PREDICTED: probable inactive leucine-rich re...  90.9    2e-17   
ref|XP_002463642.1|  hypothetical protein SORBIDRAFT_01g003440        90.9    2e-17   Sorghum bicolor [broomcorn]
ref|XP_001759884.1|  predicted protein                                90.9    3e-17   
ref|XP_010930148.1|  PREDICTED: probable inactive leucine-rich re...  90.9    3e-17   Elaeis guineensis
ref|XP_008652405.1|  PREDICTED: probable LRR receptor-like serine...  90.1    5e-17   Zea mays [maize]
ref|XP_008783789.1|  PREDICTED: probable inactive leucine-rich re...  89.4    9e-17   Phoenix dactylifera
ref|NP_001169585.1|  uncharacterized protein LOC100383466             89.4    9e-17   Zea mays [maize]
tpg|DAA39565.1|  TPA: putative leucine-rich repat protein kinase ...  89.4    1e-16   
emb|CDY52887.1|  BnaC06g27800D                                        89.0    1e-16   Brassica napus [oilseed rape]
ref|XP_002888549.1|  hypothetical protein ARALYDRAFT_475779           88.2    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_009105234.1|  PREDICTED: probable inactive leucine-rich re...  87.4    4e-16   Brassica rapa
ref|XP_009403214.1|  PREDICTED: probable inactive leucine-rich re...  87.4    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004979190.1|  PREDICTED: probable inactive leucine-rich re...  87.0    6e-16   Setaria italica
ref|XP_006425984.1|  hypothetical protein CICLE_v100249621mg          85.1    6e-16   
ref|XP_006845210.1|  PREDICTED: probable inactive leucine-rich re...  86.3    8e-16   Amborella trichopoda
ref|XP_002867127.1|  hypothetical protein ARALYDRAFT_491249           86.3    9e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010105787.1|  putative inactive leucine-rich repeat recept...  85.5    2e-15   Morus notabilis
ref|XP_006589635.1|  PREDICTED: receptor protein kinase-like prot...  85.5    2e-15   Glycine max [soybeans]
ref|XP_002865012.1|  hypothetical protein ARALYDRAFT_496872           84.7    3e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006466547.1|  PREDICTED: probable LRR receptor-like serine...  84.7    3e-15   Citrus sinensis [apfelsine]
gb|KDO79072.1|  hypothetical protein CISIN_1g003847mg                 84.7    4e-15   Citrus sinensis [apfelsine]
ref|NP_567961.1|  leucine-rich repeat protein kinase family protein   84.7    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008669759.1|  PREDICTED: probable inactive leucine-rich re...  84.0    5e-15   Zea mays [maize]
emb|CAA17550.1|  receptor protein kinase-like protein                 84.0    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004972045.1|  PREDICTED: probable inactive leucine-rich re...  79.7    7e-15   
ref|XP_002307286.1|  leucine-rich repeat transmembrane protein ki...  83.6    8e-15   Populus trichocarpa [western balsam poplar]
ref|XP_003575565.2|  PREDICTED: receptor protein kinase-like prot...  83.6    9e-15   Brachypodium distachyon [annual false brome]
ref|XP_004500511.1|  PREDICTED: probable LRR receptor-like serine...  83.2    1e-14   Cicer arietinum [garbanzo]
gb|KHG13399.1|  hypothetical protein F383_10003                       83.2    1e-14   Gossypium arboreum [tree cotton]
ref|XP_010107888.1|  Receptor protein kinase-like protein             83.2    1e-14   Morus notabilis
ref|XP_002277291.2|  PREDICTED: probable inactive leucine-rich re...  83.2    1e-14   Vitis vinifera
emb|CBI29900.3|  unnamed protein product                              83.2    1e-14   Vitis vinifera
gb|KDO59808.1|  hypothetical protein CISIN_1g043706mg                 82.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_004135515.2|  PREDICTED: probable inactive leucine-rich re...  82.8    1e-14   Cucumis sativus [cucumbers]
ref|XP_008236371.1|  PREDICTED: receptor protein kinase-like prot...  82.4    2e-14   Prunus mume [ume]
ref|XP_003518066.1|  PREDICTED: probable inactive leucine-rich re...  82.0    2e-14   Glycine max [soybeans]
ref|XP_012075793.1|  PREDICTED: receptor protein kinase-like prot...  82.4    2e-14   Jatropha curcas
ref|XP_003554189.2|  PREDICTED: probable inactive leucine-rich re...  82.0    2e-14   Glycine max [soybeans]
ref|XP_002982402.1|  hypothetical protein SELMODRAFT_116152           82.4    2e-14   
ref|XP_002514942.1|  protein with unknown function                    82.0    2e-14   
ref|XP_006422938.1|  hypothetical protein CICLE_v10027853mg           82.0    2e-14   Citrus clementina [clementine]
gb|KJB30948.1|  hypothetical protein B456_005G169100                  82.0    3e-14   Gossypium raimondii
ref|XP_010447118.1|  PREDICTED: receptor protein kinase-like prot...  82.0    3e-14   Camelina sativa [gold-of-pleasure]
emb|CDP13327.1|  unnamed protein product                              81.6    3e-14   Coffea canephora [robusta coffee]
ref|XP_009403261.1|  PREDICTED: probable inactive leucine-rich re...  81.6    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007042520.1|  Interleukin-1 receptor-associated kinase, pu...  81.6    3e-14   
ref|XP_006487009.1|  PREDICTED: receptor protein kinase-like prot...  81.6    3e-14   Citrus sinensis [apfelsine]
gb|EYU37634.1|  hypothetical protein MIMGU_mgv1a001644mg              81.6    4e-14   Erythranthe guttata [common monkey flower]
dbj|BAJ94587.1|  predicted protein                                    81.6    4e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010444672.1|  PREDICTED: probable LRR receptor-like serine...  81.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_011071213.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  81.3    4e-14   
ref|XP_004239201.1|  PREDICTED: probable inactive leucine-rich re...  81.3    4e-14   Solanum lycopersicum
gb|KHG08504.1|  hypothetical protein F383_35684                       81.3    4e-14   Gossypium arboreum [tree cotton]
ref|XP_009800742.1|  PREDICTED: probable inactive leucine-rich re...  81.3    4e-14   Nicotiana sylvestris
gb|KJB47371.1|  hypothetical protein B456_008G023200                  81.3    4e-14   Gossypium raimondii
ref|XP_006605973.1|  PREDICTED: receptor protein kinase-like prot...  81.3    4e-14   Glycine max [soybeans]
ref|XP_009372312.1|  PREDICTED: probable inactive leucine-rich re...  81.3    5e-14   Pyrus x bretschneideri [bai li]
ref|XP_010271084.1|  PREDICTED: probable LRR receptor-like serine...  81.3    5e-14   Nelumbo nucifera [Indian lotus]
dbj|BAJ88818.1|  predicted protein                                    80.5    5e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008462844.1|  PREDICTED: probable LRR receptor-like serine...  80.9    5e-14   Cucumis melo [Oriental melon]
ref|XP_002323301.1|  leucine-rich repeat transmembrane protein ki...  80.9    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006576844.1|  PREDICTED: probable inactive leucine-rich re...  80.9    6e-14   Glycine max [soybeans]
ref|XP_010432446.1|  PREDICTED: receptor protein kinase-like prot...  80.9    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009394541.1|  PREDICTED: probable LRR receptor-like serine...  80.9    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010432447.1|  PREDICTED: receptor protein kinase-like prot...  80.9    6e-14   
ref|XP_007199418.1|  hypothetical protein PRUPE_ppa026375mg           80.9    6e-14   
ref|XP_009396270.1|  PREDICTED: probable LRR receptor-like serine...  80.9    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011033271.1|  PREDICTED: probable inactive leucine-rich re...  80.1    8e-14   Populus euphratica
ref|XP_003578742.1|  PREDICTED: probable inactive leucine-rich re...  80.5    8e-14   Brachypodium distachyon [annual false brome]
ref|NP_001169295.1|  uncharacterized LOC100383159 precursor           80.5    8e-14   Zea mays [maize]
gb|ABR16672.1|  unknown                                               79.7    9e-14   Picea sitchensis
ref|XP_011099092.1|  PREDICTED: probable LRR receptor-like serine...  80.5    9e-14   Sesamum indicum [beniseed]
ref|XP_006412255.1|  hypothetical protein EUTSA_v10024498mg           80.1    1e-13   
ref|XP_008340196.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  80.1    1e-13   
ref|XP_003550036.1|  PREDICTED: probable LRR receptor-like serine...  79.7    1e-13   Glycine max [soybeans]
gb|KHN27071.1|  Putative LRR receptor-like serine/threonine-prote...  79.7    1e-13   Glycine soja [wild soybean]
gb|EYU42102.1|  hypothetical protein MIMGU_mgv1a001951mg              79.7    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_011035108.1|  PREDICTED: probable inactive leucine-rich re...  79.7    1e-13   Populus euphratica
ref|XP_002966565.1|  hypothetical protein SELMODRAFT_407578           79.7    2e-13   
gb|KCW61968.1|  hypothetical protein EUGRSUZ_H04654                   79.3    2e-13   Eucalyptus grandis [rose gum]
ref|XP_006361554.1|  PREDICTED: probable inactive leucine-rich re...  79.3    2e-13   Solanum tuberosum [potatoes]
ref|XP_010244265.1|  PREDICTED: probable LRR receptor-like serine...  79.7    2e-13   Nelumbo nucifera [Indian lotus]
emb|CDY01423.1|  BnaA07g11960D                                        79.7    2e-13   
ref|XP_012079309.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Jatropha curcas
ref|XP_008446051.1|  PREDICTED: probable inactive leucine-rich re...  79.3    2e-13   Cucumis melo [Oriental melon]
ref|XP_010025331.1|  PREDICTED: probable inactive leucine-rich re...  79.3    2e-13   Eucalyptus grandis [rose gum]
ref|XP_004496951.1|  PREDICTED: receptor protein kinase-like prot...  79.3    2e-13   Cicer arietinum [garbanzo]
ref|XP_010484520.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010437246.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006442219.1|  hypothetical protein CICLE_v10018604mg           79.7    2e-13   Citrus clementina [clementine]
ref|XP_010432075.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006393926.1|  hypothetical protein EUTSA_v10003700mg           79.3    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010691679.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007134648.1|  hypothetical protein PHAVU_010G064900g           79.0    2e-13   Phaseolus vulgaris [French bean]
ref|XP_011097240.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Sesamum indicum [beniseed]
ref|XP_004289190.1|  PREDICTED: probable LRR receptor-like serine...  79.3    2e-13   Fragaria vesca subsp. vesca
ref|XP_006478014.1|  PREDICTED: leucine-rich repeat receptor-like...  79.3    2e-13   Citrus sinensis [apfelsine]
ref|XP_002300237.2|  hypothetical protein POPTR_0001s30800g           79.0    2e-13   
gb|EPS65472.1|  hypothetical protein M569_09303                       79.0    2e-13   Genlisea aurea
gb|KDO44090.1|  hypothetical protein CISIN_1g001274mg                 79.3    2e-13   Citrus sinensis [apfelsine]
gb|KFK41150.1|  hypothetical protein AALP_AA2G092300                  79.0    2e-13   Arabis alpina [alpine rockcress]
ref|XP_009103436.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-13   Brassica rapa
ref|XP_010250769.1|  PREDICTED: probable inactive leucine-rich re...  79.0    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_011030400.1|  PREDICTED: receptor protein kinase-like prot...  79.0    3e-13   Populus euphratica
ref|XP_012085656.1|  PREDICTED: probable inactive leucine-rich re...  79.0    3e-13   Jatropha curcas
emb|CDO97218.1|  unnamed protein product                              79.0    3e-13   Coffea canephora [robusta coffee]
ref|XP_009335840.1|  PREDICTED: receptor protein kinase-like prot...  78.6    3e-13   
gb|AAL06915.1|  AT5g67280/K3G17_4                                     79.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437653.1|  PREDICTED: receptor protein kinase-like prot...  79.0    3e-13   Camelina sativa [gold-of-pleasure]
ref|NP_201529.1|  receptor-like kinase                                78.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373088.1|  PREDICTED: receptor protein kinase-like prot...  78.6    3e-13   
gb|KFK41396.1|  hypothetical protein AALP_AA2G125200                  78.6    3e-13   Arabis alpina [alpine rockcress]
ref|XP_002518685.1|  Interleukin-1 receptor-associated kinase, pu...  78.6    3e-13   
ref|XP_007047392.1|  Leucine-rich repeat protein kinase family pr...  78.6    3e-13   
ref|XP_007047393.1|  Leucine-rich repeat protein kinase family pr...  78.6    3e-13   
ref|XP_011008771.1|  PREDICTED: probable LRR receptor-like serine...  78.6    4e-13   Populus euphratica
emb|CDY12827.1|  BnaC07g16060D                                        78.6    4e-13   Brassica napus [oilseed rape]
gb|KHN19832.1|  Putative LRR receptor-like serine/threonine-prote...  78.2    4e-13   Glycine soja [wild soybean]
ref|XP_003525827.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-13   Glycine max [soybeans]
ref|XP_010464265.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009335839.1|  PREDICTED: receptor protein kinase-like prot...  78.2    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_004148196.1|  PREDICTED: probable inactive receptor-like p...  78.2    4e-13   Cucumis sativus [cucumbers]
ref|XP_009335851.1|  PREDICTED: receptor protein kinase-like prot...  78.2    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_008222077.1|  PREDICTED: probable inactive leucine-rich re...  78.2    5e-13   Prunus mume [ume]
ref|XP_010548431.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  77.8    6e-13   
ref|XP_004306158.1|  PREDICTED: probable inactive leucine-rich re...  77.4    6e-13   Fragaria vesca subsp. vesca
ref|XP_008233794.1|  PREDICTED: probable inactive receptor-like p...  77.4    7e-13   
gb|EPS64530.1|  hypothetical protein M569_10249                       77.0    7e-13   Genlisea aurea
ref|XP_008454813.1|  PREDICTED: probable inactive receptor-like p...  77.4    7e-13   Cucumis melo [Oriental melon]
ref|XP_006438068.1|  hypothetical protein CICLE_v10030842mg           77.4    7e-13   Citrus clementina [clementine]
ref|XP_009418520.1|  PREDICTED: probable LRR receptor-like serine...  77.4    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48631.1|  hypothetical protein B456_008G078600                  77.4    8e-13   Gossypium raimondii
ref|NP_195442.2|  putative LRR receptor-like serine/threonine-pro...  77.4    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           77.0    9e-13   
ref|XP_004151865.2|  PREDICTED: probable LRR receptor-like serine...  77.0    9e-13   Cucumis sativus [cucumbers]
gb|AAL57701.1|  AT4g37250/C7A10_110                                   77.0    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           77.0    1e-12   Capsella rubella
ref|XP_009591095.1|  PREDICTED: probable inactive leucine-rich re...  77.0    1e-12   Nicotiana tomentosiformis
ref|XP_008355046.1|  PREDICTED: receptor protein kinase-like prot...  77.0    1e-12   
gb|KJB79389.1|  hypothetical protein B456_013G047000                  76.6    1e-12   Gossypium raimondii
ref|XP_006346368.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   Solanum tuberosum [potatoes]
ref|XP_003552276.1|  PREDICTED: probable inactive leucine-rich re...  77.0    1e-12   Glycine max [soybeans]
ref|XP_002881831.1|  leucine-rich repeat family protein               76.6    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_009801481.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   
ref|XP_008338348.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  77.0    1e-12   
ref|XP_009335001.1|  PREDICTED: receptor protein kinase-like prot...  76.6    1e-12   
gb|KHG18716.1|  hypothetical protein F383_09210                       76.6    1e-12   
gb|KCW54821.1|  hypothetical protein EUGRSUZ_I007622                  73.2    1e-12   
ref|XP_011088209.1|  PREDICTED: probable LRR receptor-like serine...  76.6    2e-12   
ref|NP_181758.1|  leucine-rich repeat protein kinase family protein   76.3    2e-12   
ref|XP_008802352.1|  PREDICTED: probable LRR receptor-like serine...  76.6    2e-12   
ref|XP_004230741.1|  PREDICTED: probable LRR receptor-like serine...  76.6    2e-12   
ref|XP_009116483.1|  PREDICTED: probable inactive leucine-rich re...  76.3    2e-12   
emb|CBI27592.3|  unnamed protein product                              76.3    2e-12   
ref|XP_009115347.1|  PREDICTED: receptor protein kinase-like prot...  76.3    2e-12   
gb|ERM99222.1|  hypothetical protein AMTR_s00092p00117150             76.6    2e-12   
ref|XP_006836369.2|  PREDICTED: leucine-rich repeat receptor-like...  76.6    2e-12   
emb|CDY06072.1|  BnaA09g37080D                                        75.9    2e-12   
ref|XP_004496523.1|  PREDICTED: probable inactive leucine-rich re...  76.3    2e-12   
gb|AID60133.1|  leucine-rich repeat protein kinase family protein     76.3    2e-12   
ref|XP_008776550.1|  PREDICTED: probable inactive leucine-rich re...  75.9    2e-12   
ref|XP_004305952.1|  PREDICTED: probable LRR receptor-like serine...  76.3    2e-12   
ref|XP_007045046.1|  Leucine-rich repeat protein kinase family pr...  75.9    2e-12   
gb|KJB17978.1|  hypothetical protein B456_003G027300                  75.9    2e-12   
gb|KJB79388.1|  hypothetical protein B456_013G047000                  75.9    2e-12   
ref|XP_002888603.1|  predicted protein                                75.9    2e-12   
ref|XP_008384755.1|  PREDICTED: probable inactive receptor-like p...  75.9    2e-12   
ref|XP_010540115.1|  PREDICTED: leucine-rich repeat receptor-like...  76.3    2e-12   
dbj|BAK05926.1|  predicted protein                                    75.5    2e-12   
ref|XP_002963890.1|  hypothetical protein SELMODRAFT_80116            75.9    2e-12   
ref|XP_010508595.1|  PREDICTED: probable inactive leucine-rich re...  75.9    2e-12   
emb|CAB16774.1|  receptor kinase-like protein                         75.9    2e-12   
ref|XP_010052092.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    3e-12   
ref|XP_006484071.1|  PREDICTED: probable inactive leucine-rich re...  75.9    3e-12   
ref|XP_007162278.1|  hypothetical protein PHAVU_001G138500g           75.5    3e-12   
ref|XP_009345120.1|  PREDICTED: probable inactive leucine-rich re...  75.5    3e-12   
gb|KDO81950.1|  hypothetical protein CISIN_1g005226mg                 75.5    3e-12   
ref|XP_009593464.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-12   
ref|XP_007225190.1|  hypothetical protein PRUPE_ppa002123mg           75.5    3e-12   
ref|XP_003529180.1|  PREDICTED: probable inactive leucine-rich re...  75.5    3e-12   
ref|XP_009367617.1|  PREDICTED: probable LRR receptor-like serine...  75.5    3e-12   
ref|XP_007142177.1|  hypothetical protein PHAVU_008G258700g           75.5    3e-12   
emb|CDP02539.1|  unnamed protein product                              75.5    3e-12   
ref|XP_010068916.1|  PREDICTED: probable inactive receptor-like p...  75.5    3e-12   
ref|XP_010446684.1|  PREDICTED: probable LRR receptor-like serine...  75.5    3e-12   
emb|CDP10092.1|  unnamed protein product                              75.5    3e-12   
ref|XP_009372471.1|  PREDICTED: probable LRR receptor-like serine...  75.5    3e-12   
emb|CDX71991.1|  BnaC08g28830D                                        72.8    3e-12   
gb|KCW65702.1|  hypothetical protein EUGRSUZ_G03081                   75.1    4e-12   
ref|XP_002315618.1|  leucine-rich repeat family protein               75.1    4e-12   
ref|XP_007220635.1|  hypothetical protein PRUPE_ppa002525mg           75.1    4e-12   
ref|XP_009350532.1|  PREDICTED: probable LRR receptor-like serine...  75.5    4e-12   
ref|XP_006381040.1|  leucine-rich repeat transmembrane protein ki...  75.1    4e-12   
emb|CDX69035.1|  BnaC01g04180D                                        75.1    4e-12   
gb|KHG04119.1|  hypothetical protein F383_04939                       75.1    4e-12   
ref|XP_006598177.1|  PREDICTED: leucine-rich repeat receptor-like...  75.5    4e-12   
gb|KJB17979.1|  hypothetical protein B456_003G027300                  75.1    4e-12   
ref|XP_010517745.1|  PREDICTED: probable inactive leucine-rich re...  75.1    5e-12   
gb|KHN27763.1|  Leucine-rich repeat receptor-like serine/threonin...  75.5    5e-12   
ref|XP_004509103.1|  PREDICTED: probable LRR receptor-like serine...  75.1    5e-12   
ref|XP_010943198.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  75.1    5e-12   
ref|XP_004492498.1|  PREDICTED: probable inactive leucine-rich re...  75.1    5e-12   
ref|XP_008799666.1|  PREDICTED: probable LRR receptor-like serine...  75.1    5e-12   
ref|XP_011041520.1|  PREDICTED: probable inactive leucine-rich re...  74.7    5e-12   
gb|ERN11265.1|  hypothetical protein AMTR_s00024p00236830             74.7    5e-12   
ref|NP_179132.1|  leucine-rich repeat protein kinase-like protein     74.7    5e-12   
ref|XP_006411910.1|  hypothetical protein EUTSA_v10024484mg           74.7    5e-12   
ref|XP_006432830.1|  hypothetical protein CICLE_v10000648mg           74.7    5e-12   
gb|KEH44107.1|  LRR receptor-like kinase family protein               74.7    6e-12   
ref|XP_009369580.1|  PREDICTED: probable inactive receptor-like p...  74.7    6e-12   
ref|XP_006404813.1|  hypothetical protein EUTSA_v10000055mg           74.7    6e-12   
ref|XP_011625311.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    6e-12   
ref|XP_007028918.1|  Leucine-rich repeat protein kinase family pr...  74.3    6e-12   
emb|CDY14823.1|  BnaC04g48200D                                        74.3    6e-12   
ref|XP_002524923.1|  LIM domain kinase, putative                      74.7    6e-12   
ref|XP_010905098.1|  PREDICTED: probable LRR receptor-like serine...  74.3    7e-12   
ref|XP_010506042.1|  PREDICTED: probable inactive leucine-rich re...  74.3    7e-12   
ref|NP_176918.1|  Leucine-rich repeat protein kinase family protein   74.3    7e-12   
ref|XP_011101397.1|  PREDICTED: probable LRR receptor-like serine...  74.3    7e-12   
ref|XP_011101396.1|  PREDICTED: probable LRR receptor-like serine...  74.3    8e-12   
ref|XP_010248952.1|  PREDICTED: probable inactive leucine-rich re...  74.3    8e-12   
ref|XP_006576501.1|  PREDICTED: probable inactive leucine-rich re...  74.3    8e-12   
ref|XP_006285308.1|  hypothetical protein CARUB_v10006690mg           74.3    8e-12   
gb|KFK32754.1|  hypothetical protein AALP_AA6G284500                  74.3    8e-12   
ref|XP_009347493.1|  PREDICTED: probable inactive leucine-rich re...  73.9    9e-12   
ref|XP_009142052.1|  PREDICTED: probable inactive leucine-rich re...  73.9    9e-12   
ref|XP_010024065.1|  PREDICTED: receptor protein kinase-like prot...  74.3    9e-12   
ref|XP_010065970.1|  PREDICTED: receptor protein kinase-like prot...  74.3    9e-12   
ref|XP_002306906.2|  hypothetical protein POPTR_0005s25640g           74.3    9e-12   
emb|CDY47962.1|  BnaA04g24400D                                        73.9    9e-12   
gb|KHN26789.1|  Leucine-rich repeat receptor-like serine/threonin...  74.3    1e-11   
ref|XP_006280060.1|  hypothetical protein CARUB_v10025940mg           73.9    1e-11   
gb|KHG22215.1|  hypothetical protein F383_06311                       73.9    1e-11   
ref|XP_010262890.1|  PREDICTED: probable inactive leucine-rich re...  72.0    1e-11   
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  73.9    1e-11   
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg           73.9    1e-11   
ref|XP_006297050.1|  hypothetical protein CARUB_v10013050mg           73.9    1e-11   
ref|XP_007138872.1|  hypothetical protein PHAVU_009G244600g           73.9    1e-11   
ref|XP_009395855.1|  PREDICTED: probable LRR receptor-like serine...  73.9    1e-11   
ref|XP_010531559.1|  PREDICTED: receptor protein kinase-like prot...  73.9    1e-11   
ref|XP_006844018.1|  PREDICTED: probable LRR receptor-like serine...  73.9    1e-11   
ref|XP_002988292.1|  hypothetical protein SELMODRAFT_127443           73.6    1e-11   
ref|XP_006300793.1|  hypothetical protein CARUB_v10019872mg           73.6    1e-11   
gb|ERN15722.1|  hypothetical protein AMTR_s00039p00029750             73.9    1e-11   
ref|XP_003516395.1|  PREDICTED: probable inactive leucine-rich re...  73.6    1e-11   
ref|XP_003537493.1|  PREDICTED: probable LRR receptor-like serine...  73.6    1e-11   
ref|XP_007140204.1|  hypothetical protein PHAVU_008G093000g           69.7    1e-11   
gb|AGO98724.1|  ovary receptor kinase 1                               73.6    1e-11   
gb|KHN04780.1|  Putative LRR receptor-like serine/threonine-prote...  73.2    2e-11   
ref|XP_004310210.1|  PREDICTED: probable inactive leucine-rich re...  73.6    2e-11   
ref|XP_010511694.1|  PREDICTED: probable inactive leucine-rich re...  73.6    2e-11   
ref|XP_010415324.1|  PREDICTED: probable inactive leucine-rich re...  73.6    2e-11   
ref|XP_006283164.1|  hypothetical protein CARUB_v10004195mg           73.2    2e-11   
ref|XP_009590527.1|  PREDICTED: probable LRR receptor-like serine...  73.2    2e-11   
ref|XP_002278529.1|  PREDICTED: probable LRR receptor-like serine...  73.2    2e-11   
ref|XP_007155889.1|  hypothetical protein PHAVU_003G240400g           73.2    2e-11   
ref|XP_002883890.1|  hypothetical protein ARALYDRAFT_480399           73.2    2e-11   
ref|XP_009123232.1|  PREDICTED: receptor protein kinase-like prot...  73.2    2e-11   
ref|XP_009348212.1|  PREDICTED: probable inactive leucine-rich re...  72.4    2e-11   
emb|CAN59805.1|  hypothetical protein VITISV_038877                   73.2    2e-11   
ref|XP_010030519.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  72.8    2e-11   
ref|XP_009796121.1|  PREDICTED: probable LRR receptor-like serine...  72.8    2e-11   
ref|XP_009143642.1|  PREDICTED: LRR receptor-like serine/threonin...  72.8    2e-11   
ref|XP_006854255.2|  PREDICTED: probable leucine-rich repeat rece...  73.2    2e-11   
emb|CDY31708.1|  BnaA05g08390D                                        72.8    2e-11   
ref|XP_010065971.1|  PREDICTED: receptor protein kinase-like prot...  72.8    3e-11   
ref|XP_008345968.1|  PREDICTED: receptor-like protein kinase HSL1     72.8    3e-11   
gb|EPS67146.1|  hypothetical protein M569_07630                       72.4    3e-11   
gb|ABO61511.1|  LRR receptor-like protein kinase m1'                  72.8    3e-11   
ref|XP_002456123.1|  hypothetical protein SORBIDRAFT_03g030925        69.3    3e-11   
ref|XP_010057719.1|  PREDICTED: probable inactive leucine-rich re...  72.4    3e-11   
gb|AAC36318.1|  leucine-rich receptor-like protein kinase             72.8    3e-11   
ref|XP_010024066.1|  PREDICTED: receptor protein kinase-like prot...  72.8    3e-11   
ref|XP_011029672.1|  PREDICTED: probable inactive leucine-rich re...  72.4    3e-11   
emb|CDX69286.1|  BnaC01g01670D                                        72.4    3e-11   
ref|XP_006661025.1|  PREDICTED: receptor protein kinase-like prot...  72.4    3e-11   
tpg|DAA47958.1|  TPA: putative leucine-rich repat protein kinase ...  72.0    3e-11   
ref|XP_009596436.1|  PREDICTED: LRR receptor-like serine/threonin...  72.0    3e-11   
gb|ACI95776.1|  PAN1                                                  72.4    3e-11   
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  72.4    3e-11   
ref|XP_010531616.1|  PREDICTED: probable inactive leucine-rich re...  72.4    3e-11   
ref|XP_011025618.1|  PREDICTED: somatic embryogenesis receptor ki...  69.3    4e-11   
ref|NP_001062569.1|  Os09g0110100                                     72.4    4e-11   
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  72.4    4e-11   
gb|AAT28307.1|  leucine-rich repeat receptor-like protein kinase      72.4    4e-11   
emb|CDY52422.1|  BnaCnng22430D                                        72.0    4e-11   
gb|EEC71258.1|  hypothetical protein OsI_03238                        72.0    4e-11   
gb|EAZ43742.1|  hypothetical protein OsJ_28366                        72.0    4e-11   
gb|EAZ08110.1|  hypothetical protein OsI_30375                        72.0    4e-11   
ref|XP_011025617.1|  PREDICTED: somatic embryogenesis receptor ki...  69.7    4e-11   
ref|XP_010682822.1|  PREDICTED: probable inactive leucine-rich re...  72.0    4e-11   
gb|EEE55167.1|  hypothetical protein OsJ_02982                        72.0    4e-11   
ref|XP_002866961.1|  hypothetical protein ARALYDRAFT_912621           72.0    4e-11   
ref|XP_006409566.1|  hypothetical protein EUTSA_v10022577mg           72.0    5e-11   
ref|XP_007143060.1|  hypothetical protein PHAVU_007G040400g           72.0    5e-11   
ref|XP_010488951.1|  PREDICTED: receptor protein kinase-like prot...  72.0    5e-11   
ref|XP_009140454.1|  PREDICTED: probable LRR receptor-like serine...  72.0    5e-11   
ref|XP_009596435.1|  PREDICTED: LRR receptor-like serine/threonin...  71.6    5e-11   
ref|XP_006280205.1|  hypothetical protein CARUB_v10026113mg           71.6    5e-11   
emb|CDX89556.1|  BnaC04g35750D                                        71.6    5e-11   
emb|CDY38934.1|  BnaA04g13550D                                        71.6    5e-11   
ref|XP_008350956.1|  PREDICTED: probable inactive leucine-rich re...  71.6    5e-11   
emb|CDP13981.1|  unnamed protein product                              71.6    6e-11   
ref|XP_002534272.1|  ATP binding protein, putative                    71.6    6e-11   
ref|XP_010467291.1|  PREDICTED: receptor protein kinase-like prot...  71.6    6e-11   
ref|XP_010922598.1|  PREDICTED: inactive receptor-like serine/thr...  71.2    6e-11   
ref|XP_010028759.1|  PREDICTED: LRR receptor-like serine/threonin...  71.2    6e-11   
ref|XP_007136059.1|  hypothetical protein PHAVU_009G014500g           71.6    6e-11   
ref|XP_012086926.1|  PREDICTED: inactive receptor-like serine/thr...  71.6    6e-11   
emb|CDX75634.1|  BnaA01g00680D                                        71.6    6e-11   
ref|XP_009391821.1|  PREDICTED: probable inactive leucine-rich re...  71.2    6e-11   
ref|XP_003552837.1|  PREDICTED: probable LRR receptor-like serine...  71.2    7e-11   
ref|XP_011045147.1|  PREDICTED: probable LRR receptor-like serine...  71.6    7e-11   
ref|XP_009137739.1|  PREDICTED: probable LRR receptor-like serine...  71.2    7e-11   
gb|KHN31298.1|  Putative LRR receptor-like serine/threonine-prote...  71.2    7e-11   
ref|XP_010558914.1|  PREDICTED: probable LRR receptor-like serine...  71.2    9e-11   
ref|XP_008392114.1|  PREDICTED: probable inactive leucine-rich re...  70.9    9e-11   
emb|CAH67463.1|  OSIGBa0159I10.8                                      70.9    9e-11   
emb|CDY32113.1|  BnaC04g44530D                                        70.9    9e-11   
ref|XP_003604546.1|  Leucine-rich repeat receptor-like protein ki...  70.9    9e-11   
ref|XP_002301998.2|  leucine-rich repeat family protein               71.2    9e-11   
emb|CDP21455.1|  unnamed protein product                              70.9    9e-11   
emb|CDP18494.1|  unnamed protein product                              71.2    9e-11   
ref|XP_007149249.1|  hypothetical protein PHAVU_005G054300g           71.2    9e-11   
ref|XP_011006986.1|  PREDICTED: probable LRR receptor-like serine...  70.9    1e-10   
gb|KDO77873.1|  hypothetical protein CISIN_1g005734mg                 70.9    1e-10   
ref|XP_010518114.1|  PREDICTED: receptor protein kinase-like prot...  70.9    1e-10   
ref|XP_006467639.1|  PREDICTED: probable LRR receptor-like serine...  70.9    1e-10   
ref|XP_002310117.1|  hypothetical protein POPTR_0007s10500g           70.9    1e-10   
emb|CAD41514.3|  OSJNBb0020O11.17                                     70.9    1e-10   
ref|XP_009769350.1|  PREDICTED: probable inactive leucine-rich re...  70.9    1e-10   
ref|XP_002263001.1|  PREDICTED: leucine-rich repeat receptor-like...  70.9    1e-10   
dbj|BAJ86449.1|  predicted protein                                    70.9    1e-10   
dbj|BAK02926.1|  predicted protein                                    70.9    1e-10   
gb|KJB29174.1|  hypothetical protein B456_005G088200                  67.8    1e-10   
gb|AAT28309.1|  leucine-rich repeat receptor-like protein kinase      70.9    1e-10   
ref|XP_008439806.1|  PREDICTED: receptor-like protein kinase HSL1     70.9    1e-10   
ref|XP_006363847.1|  PREDICTED: probable inactive leucine-rich re...  70.5    1e-10   
ref|XP_007213718.1|  hypothetical protein PRUPE_ppa000470mg           70.9    1e-10   
ref|XP_002312630.1|  leucine-rich repeat family protein               70.5    1e-10   
ref|XP_002520879.1|  ATP binding protein, putative                    70.9    1e-10   
ref|XP_010257070.1|  PREDICTED: probable inactive receptor-like p...  70.5    1e-10   
emb|CDX98990.1|  BnaC09g48450D                                        70.9    1e-10   
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              70.5    1e-10   
ref|XP_006380687.1|  hypothetical protein POPTR_0007s10500g           70.5    1e-10   
ref|XP_006449513.1|  hypothetical protein CICLE_v10014435mg           70.5    1e-10   
gb|KJB29173.1|  hypothetical protein B456_005G088200                  67.8    1e-10   
gb|KHG04550.1|  hypothetical protein F383_29256                       70.5    1e-10   
emb|CDP01924.1|  unnamed protein product                              70.9    1e-10   
ref|XP_003600961.1|  Ser-thr protein kinase                           70.5    1e-10   
ref|XP_010429278.1|  PREDICTED: probable LRR receptor-like serine...  70.5    1e-10   
gb|EYU39896.1|  hypothetical protein MIMGU_mgv1a022142mg              70.1    1e-10   
gb|AAT28308.1|  leucine-rich repeat receptor-like protein kinase      70.5    1e-10   
gb|KJB16403.1|  hypothetical protein B456_002G229000                  70.1    1e-10   
ref|XP_010547527.1|  PREDICTED: probable LRR receptor-like serine...  70.5    2e-10   
ref|XP_011651237.1|  PREDICTED: probable LRR receptor-like serine...  70.5    2e-10   
emb|CBI40267.3|  unnamed protein product                              70.1    2e-10   
ref|XP_010647897.1|  PREDICTED: receptor protein kinase-like prot...  70.1    2e-10   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg              70.1    2e-10   
ref|XP_008221441.1|  PREDICTED: probable inactive receptor-like p...  70.1    2e-10   
emb|CDP14870.1|  unnamed protein product                              70.1    2e-10   
ref|XP_010095317.1|  putative LRR receptor-like serine/threonine-...  70.1    2e-10   
gb|KFK40013.1|  hypothetical protein AALP_AA3G318700                  70.5    2e-10   
ref|XP_010913297.1|  PREDICTED: probable inactive leucine-rich re...  70.1    2e-10   



>ref|XP_011076286.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Sesamum indicum]
Length=714

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVL--SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNG  439
            +  LA  +LI C+   V+  SSLN+EG +LL FK+SI +DPEGS+++WN SDETPCSWNG
Sbjct  2    VAFLAFLVLILCSCCGVVFVSSLNDEGAALLSFKQSIKEDPEGSLTNWNYSDETPCSWNG  61

Query  440  ITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            ITCKDQRVVS+SIPKKKLSGFLSSSLGSLS+LRHVNLR+N+L G LP  LF+  GL+SLV
Sbjct  62   ITCKDQRVVSVSIPKKKLSGFLSSSLGSLSELRHVNLRNNKLFGGLPSELFKPQGLQSLV  121

Query  620  LYENYLSGPLPF  655
            LY N+ SG LPF
Sbjct  122  LYGNFFSGTLPF  133



>ref|XP_004299037.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
Length=714

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M+   L +++F NS +++ +LNEEG++LL FK+SI  DPEGS+S+WN SD  PC+WNGIT
Sbjct  1    MLCFVLVLVLFFNSDSLVGALNEEGQALLSFKQSITQDPEGSLSNWNSSDANPCTWNGIT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+QRVVSLSIPKKKL G L S++GSLS+LRHVNLR+N+L GSLP  LF ALGL+SLVLY
Sbjct  61   CKEQRVVSLSIPKKKLFGLLPSAMGSLSELRHVNLRNNKLYGSLPVELFEALGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N  SG +P
Sbjct  121  GNSFSGSVP  129



>ref|XP_008339638.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=715

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS +++ SLNEEG +LL FK+SI +DPEGS+S+WN SD  PC+WNGITC DQRVVSLSI
Sbjct  12   CNSHSLVDSLNEEGYALLSFKQSIAEDPEGSLSNWNSSDSNPCTWNGITCNDQRVVSLSI  71

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKLSGFL S++G+LS+LRHVNLR+N+L GSLP  LF+ALGL+SLVLY N LSG +P
Sbjct  72   PKKKLSGFLPSAMGALSELRHVNLRNNKLYGSLPLELFQALGLQSLVLYGNSLSGSVP  129



>ref|XP_009357243.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=715

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS +++ SLNEEG +LL FK+SI +DPEGS+S+WN SD  PC+WNGITCKDQRVVSLSI
Sbjct  13   CNSHSLVDSLNEEGYALLSFKQSIAEDPEGSLSNWNSSDSNPCTWNGITCKDQRVVSLSI  72

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKLSGFL S++G+LS+LRHVNLR+N+L GSLP  L +ALGL+SLVLY N LSG +P
Sbjct  73   PKKKLSGFLPSAMGALSELRHVNLRNNKLYGSLPLELLQALGLQSLVLYGNSLSGSVP  130



>gb|EYU40794.1| hypothetical protein MIMGU_mgv1a024372mg, partial [Erythranthe 
guttata]
Length=636

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 2/129 (2%)
 Frame = +2

Query  275  LALFILIFCNSQAVL--SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            L   I   C S ++L  +SLNEEG++LL FK SI +DP GS+++WN SD+T CSWNGITC
Sbjct  5    LTFLISTLCISSSILVATSLNEEGEALLSFKSSIKEDPNGSLNNWNSSDQTSCSWNGITC  64

Query  449  KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
            KDQRVVS+SIPKKKLSGFLS SLGSLS+LRH+NLRSN L+G LPP LF+A GL+SLVLYE
Sbjct  65   KDQRVVSISIPKKKLSGFLSPSLGSLSELRHINLRSNNLSGELPPELFKAKGLQSLVLYE  124

Query  629  NYLSGPLPF  655
            N  SG +PF
Sbjct  125  NSFSGTVPF  133



>ref|XP_007227346.1| hypothetical protein PRUPE_ppa002204mg [Prunus persica]
 gb|EMJ28545.1| hypothetical protein PRUPE_ppa002204mg [Prunus persica]
Length=701

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS  ++ SLN+EG +LL FK+S+ +DPEGS+S+WN SDE PC+WNGITCK+QRVVSLSI
Sbjct  12   CNSHVLVGSLNDEGFALLSFKQSMTEDPEGSLSNWNSSDENPCTWNGITCKEQRVVSLSI  71

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKL GFL S++GSLS+LRHVNLR+N+L GSLP  LF ALGL+SLVLY N LSG +P
Sbjct  72   PKKKLFGFLPSAMGSLSELRHVNLRNNKLYGSLPLELFEALGLQSLVLYGNSLSGSVP  129



>ref|XP_008389257.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=716

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS  ++ SLN+EG +LL FK SI +DPEGS+S+WN SD  PC+WNGITCKDQRVVSLSI
Sbjct  13   CNSHCLVDSLNDEGYALLSFKHSIAEDPEGSLSNWNSSDSNPCTWNGITCKDQRVVSLSI  72

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKLSG L S++G+LS+LRHVNLR+N L GSLP  LF+ALGL+SLVLY N LSG +P
Sbjct  73   PKKKLSGSLPSAMGALSELRHVNLRNNMLYGSLPLELFQALGLQSLVLYGNSLSGSVP  130



>ref|XP_008243284.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Prunus mume]
Length=715

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS  ++ SLN+EG +LL FK+S+  DPEGS+S+WN SDE PC+WNGITCK+QRVVSLSI
Sbjct  12   CNSHVLVGSLNDEGFALLSFKQSMTKDPEGSLSNWNSSDENPCTWNGITCKEQRVVSLSI  71

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKL GFL S++GSLS+LRHVNLR+N+L GSLP  LF ALGL+SLVLY N LSG +P
Sbjct  72   PKKKLYGFLPSAMGSLSELRHVNLRNNKLYGSLPLELFEALGLQSLVLYGNSLSGSVP  129



>ref|XP_012075725.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Jatropha curcas]
 gb|KDP35025.1| hypothetical protein JCGZ_09313 [Jatropha curcas]
Length=715

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M IL L +   CN    + SLN EG +LL FK+SI  DPEGS+S+WN SDE PCSWNG+T
Sbjct  1    MFILILLVFALCNCHGSVGSLNNEGFALLSFKQSIYQDPEGSLSNWNSSDENPCSWNGVT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+ RVVSLSIPKKKL GFL SSLGSLS LRHVNLR+NRL G+LP  LF+A GL+SLVLY
Sbjct  61   CKELRVVSLSIPKKKLYGFLPSSLGSLSDLRHVNLRNNRLFGNLPAELFQAQGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N  SG LP
Sbjct  121  GNAFSGFLP  129



>ref|XP_009356227.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=716

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            NS  ++ SLN+EG +LL FK SI +DPEGS+S+WN SD  PC+WNGI CKDQRVVSLSIP
Sbjct  14   NSHCLVDSLNDEGYALLSFKHSIAEDPEGSLSNWNSSDSNPCTWNGIACKDQRVVSLSIP  73

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            KKKLSG L S++G+LS+LRHVNLR+N L GSLP  LF+ALGL+SLVLY N LSG +P
Sbjct  74   KKKLSGSLPSAMGALSELRHVNLRNNMLYGSLPLELFQALGLQSLVLYGNSLSGSVP  130



>ref|XP_010695919.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Beta vulgaris subsp. vulgaris]
Length=706

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M  L L+I +  N ++ ++ LNEEG +LL FK+SI  DPE S+S+WN+SDE PCSWNGIT
Sbjct  1    MYHLVLWIFLLINPKSSVNCLNEEGLALLSFKQSITQDPESSLSNWNQSDENPCSWNGIT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+Q+VVSLSIPKKKL GFL SSLGSLS LRHVNLRSNR  G LP  LF+A GL+SLVL+
Sbjct  61   CKNQKVVSLSIPKKKLVGFLPSSLGSLSDLRHVNLRSNRFYGPLPLQLFQAQGLQSLVLF  120

Query  626  ENYLSGPLP  652
             N++ G LP
Sbjct  121  GNFIYGSLP  129



>ref|XP_011070766.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Sesamum indicum]
Length=706

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  305  SQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPK  484
            S  VLSSLN +G +LL FK+S+ DDP G++S WN SDETPCSWNGITCKDQRV+S+SIPK
Sbjct  17   SIVVLSSLNADGVALLSFKQSVKDDPAGALSSWNYSDETPCSWNGITCKDQRVISVSIPK  76

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLPF  655
            KKLSG +SSSLGSLS+LRHVNLRSN  +G+LP  LF+A  L+SLVLY N LSG LPF
Sbjct  77   KKLSGAVSSSLGSLSELRHVNLRSNNFSGNLPSELFKAQRLQSLVLYGNSLSGTLPF  133



>emb|CDP00668.1| unnamed protein product [Coffea canephora]
Length=698

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQR  460
            LFIL   +    +  LN EG +L+ FK +I  DPEGSM+ WN SDETPCSWNGITCKDQ+
Sbjct  9    LFILSLFSFHGFVGCLNNEGFALMSFKNAIQQDPEGSMNSWNHSDETPCSWNGITCKDQK  68

Query  461  VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLS  640
            V+S+SIPKKKL+GFLSSSLGSL +LRHVNLR+N+L GSLP  LF A GL+SLVL+ N+ S
Sbjct  69   VISVSIPKKKLTGFLSSSLGSLPELRHVNLRNNKLFGSLPGELFAAQGLQSLVLFGNFFS  128

Query  641  GPLP  652
            GP+P
Sbjct  129  GPIP  132



>ref|XP_002282768.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Vitis vinifera]
 emb|CBI26974.3| unnamed protein product [Vitis vinifera]
Length=713

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS A++ SLNEEG +LL FK+S+ +DPE S+ +WN SDE PCSWNGITCK++RVVS+SI
Sbjct  12   CNSHALVGSLNEEGVALLSFKRSVGEDPERSLDNWNSSDENPCSWNGITCKEERVVSVSI  71

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKL GFL S+LGSL+QLRHVNLR+N+  GSLP  LF+A GL+SLVLY N LSG +P
Sbjct  72   PKKKLLGFLPSALGSLTQLRHVNLRNNKFFGSLPVELFKAQGLQSLVLYGNNLSGSVP  129



>ref|XP_009630462.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana tomentosiformis]
Length=713

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +2

Query  266  MVILALFI-LIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            M+ L L+I L+  NS  ++SSLN EG +L  FKK I  DPEGS+ +WN SDETPCSWNGI
Sbjct  1    MLALYLYIFLVLSNSCVLVSSLNNEGIALWSFKKGIGQDPEGSLKNWNYSDETPCSWNGI  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TCKD +VVS+SIPKKKL+GF+S +LGSLS+LRHVNLRSN  +GSLP  LF   GL+SLVL
Sbjct  61   TCKDFKVVSVSIPKKKLTGFVSYTLGSLSELRHVNLRSNLFSGSLPVELFEVQGLQSLVL  120

Query  623  YENYLSGPLPF  655
            Y N  SG +PF
Sbjct  121  YGNSFSGVIPF  131



>ref|XP_011038748.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=716

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M  L L +L   N  +++S LN EG +LL FK+SI +DPEGS+S+WN SD+ PCSWNG+T
Sbjct  1    MFSLILLLLAIFNCHSLVSCLNNEGYALLSFKQSIYEDPEGSLSNWNSSDDNPCSWNGVT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CKD +V+S+SIPKK+L GFL S+LGSLS LRHVNLR+NR  GSLP  LF+A GL+SLVLY
Sbjct  61   CKDFKVMSVSIPKKRLYGFLPSALGSLSDLRHVNLRNNRFFGSLPAELFQAQGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N LSG LP
Sbjct  121  GNSLSGSLP  129



>emb|CAN73490.1| hypothetical protein VITISV_040575 [Vitis vinifera]
Length=713

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CNS A + SLNEEG +LL FK+S+ +DPE S+ +WN SDE PCSWNGITCK++RVVS+SI
Sbjct  12   CNSHAKVGSLNEEGVALLSFKRSVGEDPERSLDNWNSSDENPCSWNGITCKEERVVSVSI  71

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKL GFL S+LGSL+QLRHVNLR+N+  GSLP  LF+A GL+SLVLY N LSG +P
Sbjct  72   PKKKLLGFLPSALGSLTQLRHVNLRNNKFFGSLPVELFKAQGLQSLVLYGNNLSGSVP  129



>gb|KDO76897.1| hypothetical protein CISIN_1g005102mg [Citrus sinensis]
Length=714

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M    +  L+ CN    + SLN EG +LL FK+S+ +DPEGS+S+WN SDE PCSWNGIT
Sbjct  1    MCFWVVLFLVLCNFNGFVDSLNGEGYALLSFKQSVHEDPEGSLSNWNSSDENPCSWNGIT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+QRVVS+SIPKKKL GFL S+LGSL+ LRHVNLR+N+  GSLP  L  A GL+SLVLY
Sbjct  61   CKEQRVVSVSIPKKKLLGFLPSALGSLTDLRHVNLRNNKFFGSLPLELLEAQGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N  SG +P
Sbjct  121  GNSFSGSVP  129



>ref|XP_009801886.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana sylvestris]
Length=713

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +2

Query  266  MVILALFI-LIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            M+ L L+I ++  NS  ++SSLN EG +L  FKK I  DPEGS+++WN SDETPCSWNGI
Sbjct  1    MLALCLYIFMVLSNSCILVSSLNNEGIALWSFKKGIGQDPEGSLNNWNYSDETPCSWNGI  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TCKD +V+S+SIPKKKL+GF+SSSLGSLS+LRHVNLRSN  +GSLP  LF+  GL+SLVL
Sbjct  61   TCKDFKVISVSIPKKKLTGFVSSSLGSLSELRHVNLRSNLFSGSLPVELFKVQGLQSLVL  120

Query  623  YENYLSGPLPF  655
            Y N  SG +PF
Sbjct  121  YGNLFSGVIPF  131



>ref|XP_003555253.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=710

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = +2

Query  281  LFILIFCNSQA-VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ  457
            LF L+ CNS A V+ SLN EG  LL  K+S+ D P+GSMS+WN SDE PCSWNGITCKDQ
Sbjct  7    LFFLLSCNSLAPVVHSLNAEGSVLLTLKQSLTD-PQGSMSNWNSSDENPCSWNGITCKDQ  65

Query  458  RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYL  637
             +VS+SIPK+KL G L+SSLGSLSQLRHVN R+N+L G+LPP LF+A GL+SLVLY N L
Sbjct  66   TIVSISIPKRKLYGSLTSSLGSLSQLRHVNFRNNKLFGNLPPQLFQAQGLQSLVLYGNSL  125

Query  638  SGPLP  652
            SG +P
Sbjct  126  SGSVP  130



>ref|XP_003555049.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=710

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +2

Query  266  MVILALFILIFCNSQ-AVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            M  L + + + CN   A +SSL  EG  LL  KKSI+ DPEGS+S+WN SD+TPCSWNGI
Sbjct  1    MFPLVVLLFLACNFHVAPVSSLTVEGSVLLALKKSIITDPEGSLSNWNSSDDTPCSWNGI  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TCKDQ VVS+SIPK+KL G L S LGSLS LRH+NLR+N L G LP GLF A GL+SLVL
Sbjct  61   TCKDQSVVSISIPKRKLHGVLPSELGSLSHLRHLNLRNNNLFGDLPVGLFEAQGLQSLVL  120

Query  623  YENYLSGPLP  652
            Y N LSG +P
Sbjct  121  YGNSLSGSVP  130



>ref|XP_006448399.1| hypothetical protein CICLE_v10014433mg [Citrus clementina]
 gb|ESR61639.1| hypothetical protein CICLE_v10014433mg [Citrus clementina]
Length=714

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M    +  L+ CN    + SLN EG +LL FK+S+ +DPEGS+S+WN SDE PCSWNGIT
Sbjct  1    MCFWVVLFLVLCNFNGFVDSLNGEGYALLSFKQSVHEDPEGSLSNWNSSDENPCSWNGIT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+QRVVS+SIPKKKL GFL S+LGSL+ LRHVNLR+N   GSLP  L  A GL+SLVLY
Sbjct  61   CKEQRVVSVSIPKKKLLGFLPSALGSLTDLRHVNLRNNMFFGSLPVELLEAQGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N  SG +P
Sbjct  121  GNSFSGSVP  129



>ref|XP_006468755.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Citrus sinensis]
Length=714

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M    +  L+ CN    + SLN EG +LL FK+S+ +DPEGS+S+WN SDE PCSWNGIT
Sbjct  1    MCFWVVLFLVLCNFNGFVDSLNGEGYALLSFKQSVHEDPEGSLSNWNSSDENPCSWNGIT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+QRVVS+SIPKKKL GFL S+LGSL+ LRHVNLR+N   GSLP  L  A GL+SLVLY
Sbjct  61   CKEQRVVSVSIPKKKLLGFLPSALGSLTDLRHVNLRNNMFFGSLPVELLEAQGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N  SG +P
Sbjct  121  GNSFSGSVP  129



>ref|XP_010922469.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=712

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  314  VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKl  493
            ++SSLNEEG +LL FK SI +DPEG +S+WN SD  PCSWNGITC++  V+SLSIPKK+L
Sbjct  22   LVSSLNEEGFALLSFKSSIREDPEGCLSNWNSSDPNPCSWNGITCREGVVISLSIPKKRL  81

Query  494  sgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +GFL S+LGSL  LRH+NLR+NRL G LPPGLF A GL+SLVLY N+LSGPLP
Sbjct  82   AGFLPSALGSLPSLRHMNLRNNRLFGRLPPGLFAAGGLQSLVLYGNFLSGPLP  134



>ref|XP_007044230.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY00062.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=716

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M  L L +L   N   + + LN +G +LL FK+SI  DPEGS+S+WN SD++PCSWNG+T
Sbjct  1    MFSLVLVVLALFNFHGLATCLNNDGYALLSFKQSIYADPEGSLSNWNFSDDSPCSWNGVT  60

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+QRVVS+SIPKKKL GFL S+LGSLS LRHVNLR+N+  G LP  L +A GL+SLVLY
Sbjct  61   CKEQRVVSVSIPKKKLYGFLPSALGSLSDLRHVNLRNNKFFGGLPVELLQAQGLQSLVLY  120

Query  626  ENYLSGPLP  652
             N LSGPLP
Sbjct  121  GNSLSGPLP  129



>ref|XP_008446637.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=717

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            ++SLN EG +LL FK+SI +DPEG +S+WN SDETPCSWNG+TCKD RVVSLSIP+KKL+
Sbjct  20   MASLNNEGNALLSFKQSITEDPEGCLSNWNSSDETPCSWNGVTCKDLRVVSLSIPRKKLN  79

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G LSSSLG LS+LRHVNLRSN+L+G+LP  LF+A G++SLVLY N  +G +P
Sbjct  80   GVLSSSLGFLSELRHVNLRSNKLHGTLPVELFQANGIQSLVLYGNSFTGSVP  131



>ref|XP_011655791.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis sativus]
 gb|KGN52108.1| hypothetical protein Csa_5G610420 [Cucumis sativus]
Length=718

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            ++SLN EG +LL FK+SI +DPEG +S+WN SDETPCSWNG+TCKD RVVSLSIP+KKL+
Sbjct  21   MASLNNEGNALLSFKQSITEDPEGCLSNWNSSDETPCSWNGVTCKDLRVVSLSIPRKKLN  80

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G LSSSLG LS+LRHVNLRSN+L+G+LP  LF+A G++SLVLY N  +G +P
Sbjct  81   GVLSSSLGFLSELRHVNLRSNKLHGTLPVELFQANGIQSLVLYGNSFTGSVP  132



>ref|XP_002315920.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF02091.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=716

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            N  +++S LN EG +LL FK+SI +DPEGS+S+WN SD+ PCSWNG+TCKD +V+S+SIP
Sbjct  13   NCHSLVSCLNNEGYALLSFKQSIYEDPEGSLSNWNSSDDNPCSWNGVTCKDFKVMSVSIP  72

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            KK+L GFL S+LGSLS LRHVNLR+NR +GSLP  LF+A GL+SLVLY N LSG LP
Sbjct  73   KKRLYGFLPSALGSLSDLRHVNLRNNRFSGSLPAELFQAQGLQSLVLYGNSLSGSLP  129



>ref|XP_004238893.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Solanum lycopersicum]
Length=715

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRV  463
              LI C+    ++SLN+EG +L  FKK I  DPEGS+ +WN SDETPCSWNG+TCKD +V
Sbjct  9    IFLILCSCCVFVTSLNDEGIALWSFKKGIGQDPEGSLKNWNFSDETPCSWNGVTCKDLKV  68

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            VS+SIP+KKL+GFLSSSLGSL++LRHVNLRSN  +GSLP  LF   GL+SLVLY N  SG
Sbjct  69   VSVSIPRKKLTGFLSSSLGSLTELRHVNLRSNLFSGSLPVELFEVQGLQSLVLYGNSFSG  128

Query  644  PLPF  655
             +PF
Sbjct  129  VIPF  132



>ref|XP_011022504.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=724

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            NS ++++SLN EG +LL FK+SI +DPEGS+S+WN SD+ PCSWNG+TC+D  V+SLSIP
Sbjct  20   NSYSLVTSLNSEGYALLSFKQSINEDPEGSLSNWNSSDDNPCSWNGVTCRDLNVMSLSIP  79

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            KKKL GFL S+LGSLS LRH+NLR+NRL G LP  LF+A GL+SLVLY N LSG LP
Sbjct  80   KKKLYGFLPSALGSLSDLRHINLRNNRLFGPLPAELFQAQGLQSLVLYGNSLSGSLP  136



>ref|XP_002311473.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE88840.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=724

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            NS ++++SLN EG +LL FK+SI +DPEGS+S+WN SD+ PCSWNG+TCKD +V+SLSIP
Sbjct  20   NSYSLVTSLNSEGYALLSFKQSINEDPEGSLSNWNSSDDNPCSWNGVTCKDLKVMSLSIP  79

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            KKKL GFL S+LGSLS LRH+NLR+NR  G LP  LF+A GL+SLVLY N  SG LP
Sbjct  80   KKKLYGFLPSALGSLSDLRHINLRNNRFFGPLPAELFQAQGLQSLVLYGNSFSGSLP  136



>ref|XP_010262185.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=713

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            NS A++ SLN EG +LL FK+SI++DPEG++ +WN +DE PCSWNGITC++ RVVSLSIP
Sbjct  15   NSSALVDSLNGEGFTLLSFKQSIIEDPEGALINWNYTDENPCSWNGITCREDRVVSLSIP  74

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            KK+L G L   LGSL+ LRHVNLR+N+L GSLP  +F A GL+SLVLY N L G +P
Sbjct  75   KKRLVGLLDPVLGSLTALRHVNLRNNKLYGSLPVKIFEAQGLQSLVLYGNSLYGSIP  131



>ref|XP_002526283.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF36072.1| ATP binding protein, putative [Ricinus communis]
Length=715

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            NS  V+S LN EG +LL FK+SI  DPEGS+S+WN SDETPCSWNG+TCK+ +VVS+SIP
Sbjct  13   NSNGVIS-LNSEGFALLSFKQSIYQDPEGSLSNWNSSDETPCSWNGVTCKELKVVSVSIP  71

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            KKKL GFL SSLGSLS LRHVNLR+N   GSLP  LF+A GL+SLVLY N LSG LP
Sbjct  72   KKKLFGFLPSSLGSLSDLRHVNLRNNMFFGSLPSQLFQAQGLQSLVLYGNSLSGSLP  128



>ref|XP_010279368.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=711

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQR  460
            +F+L+F NS  ++  LN+EG +L  FK+S+  DPEGS+S+WN SDE PCSWNGITCK+++
Sbjct  9    VFLLLF-NSSVLVGCLNDEGVALWSFKQSL-QDPEGSLSNWNYSDENPCSWNGITCKEEK  66

Query  461  VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLS  640
            VVS+SIPKKKL GFL  +LGSL+ LRHVNLR+N+L GSLP  LF A GL+SLVLY N LS
Sbjct  67   VVSVSIPKKKLGGFLPPALGSLTALRHVNLRNNKLYGSLPVKLFEAQGLQSLVLYGNSLS  126

Query  641  GPLP  652
            G +P
Sbjct  127  GSIP  130



>ref|XP_008377042.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=295

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  266  MVILALFILIF--CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNG  439
            +++L +  L F  CNS +++S +NEEG +LL FK+S+  +PE S+S WN SD+TPCSW G
Sbjct  34   LMVLQVLCLAFLVCNSLSLVSCINEEGLALLSFKESLTKNPESSLSTWNSSDQTPCSWXG  93

Query  440  ITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            +TC++++VVSLSIP K+LSG    +LG+LS LRH+NLR N+L+GSLP  LF A  L+SLV
Sbjct  94   VTCREEKVVSLSIPNKQLSGIFPRALGNLSALRHLNLRENKLSGSLPSELFNAKALQSLV  153

Query  620  LYENYLSGPLP  652
            L  N LSG +P
Sbjct  154  LSGNSLSGSVP  164



>gb|EYU30010.1| hypothetical protein MIMGU_mgv1a002330mg [Erythranthe guttata]
Length=687

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L + IL   ++    S LN+EG +LL FK  I  DP+ S+++WN SDETPCSWNGITCK 
Sbjct  7    LLILILYISDNTTPASCLNDEGVALLSFKHFIKHDPDASLNNWNHSDETPCSWNGITCKQ  66

Query  455  QRVVSLSIPKKKlsgflssslgslsql--RHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
            QRVVS+SIPKKKLSG LSSS    S    RHVNLR+N  +G LP  LF A GL+SLVLY 
Sbjct  67   QRVVSISIPKKKLSGILSSSSSLGSLSELRHVNLRNNNFSGELPSELFTARGLQSLVLYG  126

Query  629  NYLSGPLPF  655
            N  SGPLPF
Sbjct  127  NSFSGPLPF  135



>ref|XP_006344171.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Solanum tuberosum]
Length=714

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRV  463
              LI C S   ++SLN+EG +L  FKK I  DPEGS+ +WN SDETPCSWNG+TCKD +V
Sbjct  9    IFLILC-SCVFVTSLNDEGIALWSFKKGIGQDPEGSLKNWNFSDETPCSWNGVTCKDLKV  67

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            VS+SIPKKKL+GFLSSSLGSL+ LRHVNLRSN  +GSLP  LF   GL+SLVLY N  SG
Sbjct  68   VSVSIPKKKLTGFLSSSLGSLTGLRHVNLRSNLFSGSLPVELFEVQGLQSLVLYGNSFSG  127

Query  644  PLPF  655
             +P 
Sbjct  128  VIPI  131



>ref|XP_002876736.1| hypothetical protein ARALYDRAFT_484030 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52995.1| hypothetical protein ARALYDRAFT_484030 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L +F+ + CN   V+S LN+EG +LL FK+S+ DDP GS+S+WN SDE  CSWNG+TCK+
Sbjct  5    LIIFVALLCNV-TVISGLNDEGFALLTFKQSVHDDPTGSLSNWNSSDEDACSWNGVTCKE  63

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             RVVSLSIP+K L G L SSLG LS LRH+NLRSNR  GSLP  LF+  GL+SLVLY N 
Sbjct  64   LRVVSLSIPRKSLYGSLPSSLGFLSSLRHLNLRSNRFYGSLPIQLFQLQGLQSLVLYGNS  123

Query  635  LSGPL  649
              G L
Sbjct  124  FDGSL  128



>gb|KJB31482.1| hypothetical protein B456_005G193500 [Gossypium raimondii]
Length=642

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            ++ LN EG +L+ FK+SI +DPEGS+S+WN SD+ PCSWNG+TCK+QRVVS+SIPKKKL 
Sbjct  18   VTCLNNEGYALISFKQSIYEDPEGSLSNWNSSDDNPCSWNGVTCKEQRVVSVSIPKKKLY  77

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            GFL SSLG LS LRHVNLR+N+  G+LP  L  A GL+SLVLY N LSG LP
Sbjct  78   GFLPSSLGFLSDLRHVNLRNNKFFGTLPVELLEAQGLQSLVLYGNSLSGSLP  129



>ref|XP_010916465.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=708

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            + +LNEEG +LL FK SI +DPEGS+++WN S   PCSWNGITCK+  VVS+++PK KL 
Sbjct  24   VGALNEEGVALLSFKASISEDPEGSLANWNSSSLDPCSWNGITCKEGAVVSVALPKNKLL  83

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G L SSLGSL  LRH+NLRSNRL G LPPGLF A GL+SLVL  N LSGPLP
Sbjct  84   GSLPSSLGSLPSLRHINLRSNRLQGRLPPGLFAARGLQSLVLSGNSLSGPLP  135



>ref|XP_003536668.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=712

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +2

Query  299  CNSQA-VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLS  475
            CNS A V+ SLN EG  LL  K+++ D P+GSMS+WN  DE PCSWNGITCKDQ VVS+S
Sbjct  14   CNSLAPVVYSLNAEGSVLLTLKQTLTD-PQGSMSNWNSFDENPCSWNGITCKDQTVVSIS  72

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            IPK+KL G L SSLGSLSQLRH+N R+N+L G+LPP LF+A GL+S+VLY N LSG +P
Sbjct  73   IPKRKLYGSLPSSLGSLSQLRHINFRNNKLFGNLPPRLFQAQGLQSMVLYGNSLSGSVP  131



>gb|KJB31483.1| hypothetical protein B456_005G193500 [Gossypium raimondii]
Length=717

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            ++ LN EG +L+ FK+SI +DPEGS+S+WN SD+ PCSWNG+TCK+QRVVS+SIPKKKL 
Sbjct  18   VTCLNNEGYALISFKQSIYEDPEGSLSNWNSSDDNPCSWNGVTCKEQRVVSVSIPKKKLY  77

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            GFL SSLG LS LRHVNLR+N+  G+LP  L  A GL+SLVLY N LSG LP
Sbjct  78   GFLPSSLGFLSDLRHVNLRNNKFFGTLPVELLEAQGLQSLVLYGNSLSGSLP  129



>ref|XP_009395564.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=697

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  314  VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKl  493
             +  LN +G +LL FK++I  DP+GS+ +WN SDE PCSWNGITC++  VV+LS+PKKKL
Sbjct  25   AVGGLNSDGTALLSFKEAIRGDPKGSLGNWNSSDENPCSWNGITCREGSVVALSLPKKKL  84

Query  494  sgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             G+L S+LGSL  LRHVNLRSNRL GSLP GLF A GLE LVL+ N+LSG +P
Sbjct  85   VGYLPSALGSLQSLRHVNLRSNRLFGSLPAGLFAARGLERLVLFGNFLSGSIP  137



>ref|NP_178230.1| leucine-rich repeat transmembrane protein kinase-like protein 
[Arabidopsis thaliana]
 gb|AAD14521.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59280.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC05416.1| leucine-rich repeat transmembrane protein kinase-like protein 
[Arabidopsis thaliana]
Length=716

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L +F+ + CN   V+S LN+EG +LL FK+S+ DDP GS+++WN SDE  CSWNG+TCK+
Sbjct  5    LIIFVALLCNV-TVISGLNDEGFALLTFKQSVHDDPTGSLNNWNSSDENACSWNGVTCKE  63

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             RVVSLSIP+K L G L SSLG LS LRH+NLRSNR  GSLP  LF   GL+SLVLY N 
Sbjct  64   LRVVSLSIPRKNLYGSLPSSLGFLSSLRHLNLRSNRFYGSLPIQLFHLQGLQSLVLYGNS  123

Query  635  LSGPL  649
              G L
Sbjct  124  FDGSL  128



>ref|XP_008810049.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=712

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            +SSL EEG +LL FK SI +DPEGS+ +WN SD  PCSWNGITC++  V+SLSIPKK+L+
Sbjct  23   VSSLTEEGSALLSFKASIREDPEGSLGNWNSSDPNPCSWNGITCREGVVISLSIPKKRLA  82

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLPF  655
            GFL S+LGS+  LRH+NLR+NRL G LP GL  A GL S+VLY N+LS PLP 
Sbjct  83   GFLPSALGSIPSLRHINLRNNRLFGRLPAGLLAAAGLRSVVLYGNFLSDPLPL  135



>ref|XP_008809165.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=709

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            + +LNEEG +LL FK SI +DPEGS+++WN SD  PCSWNGITC++  VVS+S+PK KL 
Sbjct  25   VGALNEEGAALLSFKASIREDPEGSLANWNSSDLDPCSWNGITCREGEVVSISLPKSKLL  84

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G L SS GSL  LRH+NLR++RL G LPPG+F A GL+SLVL  N LSGPLP
Sbjct  85   GSLPSSFGSLPSLRHINLRNSRLQGGLPPGVFAARGLQSLVLSGNSLSGPLP  136



>ref|XP_006306904.1| hypothetical protein CARUB_v10008465mg [Capsella rubella]
 gb|EOA39802.1| hypothetical protein CARUB_v10008465mg [Capsella rubella]
Length=700

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            IL LF+LI+ N    L++LN+EG +LL  K+SI  DP+GSMS+WN  ++ PCSWNG+TC 
Sbjct  6    ILFLFLLIW-NFNGELNALNDEGYALLTLKRSISRDPDGSMSNWNSENQDPCSWNGVTCD  64

Query  452  DQR-VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
            D + VVSLSIP+K+L G+L SSLG L+ LRH+NLRSN L+G+LP  LF+A GL+SLVLY 
Sbjct  65   DHKVVVSLSIPRKRLVGYLPSSLGLLTNLRHLNLRSNELSGNLPAQLFKAQGLQSLVLYG  124

Query  629  NYLSGPLP  652
            N LSG +P
Sbjct  125  NLLSGSIP  132



>ref|XP_009418392.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=714

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +2

Query  281  LFILIFCNSQA--VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
             F+ + CN+    V+  LN EG +L+ FK  I DDP GS+ +WN SD+ PCSWNGITC+ 
Sbjct  14   FFLFLLCNTSLLLVVGGLNSEGTALISFKAGIRDDPAGSLRNWNSSDQDPCSWNGITCRG  73

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
              V +LS+PKKKL G+LSS+LGSL  LRHVNLR+NRL GSLP  LF A  L+SLVLY N+
Sbjct  74   GSVAALSLPKKKLVGYLSSALGSLRSLRHVNLRNNRLFGSLPASLFAARQLQSLVLYGNF  133

Query  635  LSGPLP  652
            LSG LP
Sbjct  134  LSGSLP  139



>ref|XP_010477947.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=702

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L   +L+  N    L++LN+EG +LL  K+SI  DP+GS+S+WN  D+ PCSWNG+TC D
Sbjct  6    LLFLVLLIWNFNVELNALNDEGFALLTLKRSISRDPDGSLSNWNSEDQDPCSWNGVTCDD  65

Query  455  QR-VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
             + VVSLSIP+KKL GFL SSLG L+ LRH+NLRSN L+GSLP  LF+A GL+SLVLY N
Sbjct  66   HKVVVSLSIPRKKLVGFLPSSLGVLTNLRHLNLRSNELSGSLPAELFKAQGLQSLVLYGN  125

Query  632  YLSGPLP  652
             LSG +P
Sbjct  126  LLSGSIP  132



>ref|XP_010499124.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=703

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L   +L+  N    L++LN+EG +LL  K+SI  DP+GS+S+WN  D+ PCSWNG+TC D
Sbjct  6    LLFLVLLIWNFNGELNALNDEGYALLTLKRSISRDPDGSLSNWNSEDQDPCSWNGVTCDD  65

Query  455  QR-VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
             + VVSLSIP+KKL G+L SSLG L+ LRH+NLRSN L+G+LP  LF+A GL+SLVLY N
Sbjct  66   HKVVVSLSIPRKKLVGYLPSSLGVLTNLRHLNLRSNELSGNLPAELFKAQGLQSLVLYGN  125

Query  632  YLSGPLP  652
             LSG +P
Sbjct  126  LLSGSIP  132



>gb|EPS65629.1| hypothetical protein M569_09144 [Genlisea aurea]
Length=719

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            +S+LN+EG +LL FK SI +DP+GS+++WN SDE PC+WNG+TC DQ VVS+SIP+K+L 
Sbjct  19   VSTLNDEGIALLSFKASITEDPQGSLNNWNSSDEIPCAWNGVTCSDQSVVSVSIPRKELL  78

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            GFL SS+GSLSQLRHVNLR+N+L G LP  LF A GL+SLVLY N LSG LP
Sbjct  79   GFLPSSIGSLSQLRHVNLRNNKLFGGLPSDLFNAQGLQSLVLYGNSLSGLLP  130



>ref|NP_564228.1| leucine-rich repeat-containing protein kinase [Arabidopsis thaliana]
 gb|AAG28814.1|AC079374_17 unknown protein [Arabidopsis thaliana]
 gb|AAL08297.1| At1g25320/F4F7_17 [Arabidopsis thaliana]
 gb|AAQ65094.1| At1g25320/F4F7_17 [Arabidopsis thaliana]
 gb|ACN59233.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30606.1| leucine-rich repeat-containing protein kinase [Arabidopsis thaliana]
Length=702

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +L +F+LI+ N    L++LN+EG +LL  K+SI  DP+GS+S+WN  ++ PCSWNG+TC 
Sbjct  6    LLFMFLLIW-NFNGELNALNDEGFALLTLKQSISKDPDGSLSNWNSENQNPCSWNGVTCD  64

Query  452  DQR-VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
            D + VVSLSIPKKKL G+L SSLG LS LRH+NLRSN L+G+LP  LF+A GL+SLVLY 
Sbjct  65   DNKVVVSLSIPKKKLLGYLPSSLGLLSNLRHLNLRSNELSGNLPVELFKAQGLQSLVLYG  124

Query  629  NYLSGPLP  652
            N+LSG +P
Sbjct  125  NFLSGSIP  132



>ref|XP_010424856.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=720

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 94/132 (71%), Gaps = 4/132 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAV----LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSW  433
            + +L + + + CN   +    +S LN+EG +LL FK+S+ DDP GS+S+WN SDE  CSW
Sbjct  2    LALLIIIVALLCNYNYIPLVTVSGLNDEGFALLTFKQSVHDDPSGSLSNWNSSDEDACSW  61

Query  434  NGITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
            NG+TCK+ RVVSLSIP+K L G L SSLG LS LRH+NLRSNR  GSLP  LF+  GL+S
Sbjct  62   NGVTCKELRVVSLSIPRKSLYGSLPSSLGFLSSLRHLNLRSNRFYGSLPVQLFQLQGLQS  121

Query  614  LVLYENYLSGPL  649
            LVLY N   G L
Sbjct  122  LVLYGNSFDGSL  133



>ref|XP_010066684.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
 gb|KCW64657.1| hypothetical protein EUGRSUZ_G02237 [Eucalyptus grandis]
Length=714

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgfls  508
            N EG +LL FK+S+  DPEGS+ +WN SDE+PCSWNG+TCK+ +VVS+SIPKK+L G L 
Sbjct  22   NPEGSALLSFKQSVYRDPEGSLGNWNASDESPCSWNGVTCKEGKVVSVSIPKKRLYGLLP  81

Query  509  sslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            S+LGSL  LRHVNLR+N+  GSLP  LFRA GL+SLVLY N LSG LP
Sbjct  82   SALGSLPDLRHVNLRNNKFFGSLPLELFRAGGLQSLVLYGNSLSGSLP  129



>ref|XP_009413652.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=674

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgfls  508
            NEEG +LL FK ++ +DP+GSM++WN S   PCSWNGITC++ RVVS+S+PKK+L G L 
Sbjct  24   NEEGLALLSFKSAVQEDPDGSMANWNSSGADPCSWNGITCEEGRVVSISLPKKRLLGSLP  83

Query  509  sslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            SSLGS S LRH+NLRSNRL+GSLP GLF A  L+SLVLY N  SGP+P
Sbjct  84   SSLGSFSSLRHINLRSNRLHGSLPSGLFAAGRLQSLVLYGNSFSGPVP  131



>ref|XP_010502083.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=720

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  266  MVILALFILIFCN----SQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSW  433
            + +L + + + CN        +S LN+EG +LL FK+S+ DDP GS+S+WN SDE  CSW
Sbjct  2    LALLIIIVALLCNYNYIPHVTVSGLNDEGFALLTFKQSVHDDPTGSLSNWNSSDEDACSW  61

Query  434  NGITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
            NG+TCK+ RVVSLSIP+K L G L SSLG LS LRH+NLRSNR  GSLP  LF   GL+S
Sbjct  62   NGVTCKELRVVSLSIPRKSLYGSLPSSLGFLSSLRHLNLRSNRFYGSLPVQLFELQGLQS  121

Query  614  LVLYENYLSGPL  649
            LVLY N   G L
Sbjct  122  LVLYGNSFDGSL  133



>gb|KFK33342.1| hypothetical protein AALP_AA5G001600 [Arabis alpina]
Length=708

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L +F  + CN    +++LN+EG +LL FK+S+ DDP GS+S+WN SD  PCSWNG+TCK+
Sbjct  5    LLIFFALLCN----VTALNDEGFALLTFKQSVHDDPTGSLSNWNSSDGDPCSWNGVTCKE  60

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             RVVSLSIP+K+L   L SSLG LS LRH+NLRSNR  GSLP  LF   GL+SLVLY N 
Sbjct  61   LRVVSLSIPRKRLYSSLPSSLGFLSSLRHLNLRSNRFYGSLPIQLFNLQGLQSLVLYGNS  120

Query  635  LSG  643
              G
Sbjct  121  FDG  123



>ref|XP_008229314.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Prunus mume]
Length=729

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +2

Query  266  MVILALF-ILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            MV+  L+ + + CNS A +S +NEEG +LL FK+S++  PEGS+S+WN SD+TPCSW G+
Sbjct  1    MVLQVLYLVFLVCNSLAFISCVNEEGLALLSFKESLMHYPEGSLSNWNSSDQTPCSWTGV  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TC+  +VVSLSIP + L G  S +LG+LS +RH+NLRSN L GSLP  LF A  L+SLVL
Sbjct  61   TCRQDKVVSLSIPSRNLYGIFSPALGNLSAIRHLNLRSNELFGSLPYELFNAKELQSLVL  120

Query  623  YENYLSGPLP  652
              N LSG +P
Sbjct  121  SGNSLSGSVP  130



>ref|XP_006843749.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Amborella trichopoda]
Length=711

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgf  502
            S+N++G +LL FK++I +DPE ++++WN SDETPCSWNGI CKD  VVSLSIPKK+L G 
Sbjct  27   SVNKDGIALLSFKEAIKEDPENALANWNTSDETPCSWNGIACKDNSVVSLSIPKKRLLGI  86

Query  503  lssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            L S LGS+  LRH+NLR+NRLNGS+PP LF+A  L+S+V   N LSG LP
Sbjct  87   LPSVLGSIFSLRHLNLRNNRLNGSIPPDLFKAESLQSIVFIGNSLSGSLP  136



>ref|XP_010460394.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
 ref|XP_010460395.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=703

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = +2

Query  257  VGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWN  436
            VG ++ L L I  F      L++LN+EG +LL  K+SI  DP+GS+S+WN  D+ PCSWN
Sbjct  3    VGSLLFLVLLIWNF---NGELNALNDEGYALLTLKRSISRDPDGSLSNWNSEDQDPCSWN  59

Query  437  GITCKDQR-VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
            G+TC + + VVSLSIP+KKL G+L SSLG L+ LRH+NLRSN L+G+LP  LF+A GL+S
Sbjct  60   GVTCDNHKLVVSLSIPRKKLVGYLPSSLGVLTNLRHLNLRSNELSGNLPAELFKAQGLQS  119

Query  614  LVLYENYLSGPLP  652
            LVLY N LSG +P
Sbjct  120  LVLYGNLLSGSIP  132



>ref|XP_011623083.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Amborella trichopoda]
 gb|ERN05424.1| hypothetical protein AMTR_s00007p00232420 [Amborella trichopoda]
Length=705

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgf  502
            S+N++G +LL FK++I +DPE ++++WN SDETPCSWNGI CKD  VVSLSIPKK+L G 
Sbjct  21   SVNKDGIALLSFKEAIKEDPENALANWNTSDETPCSWNGIACKDNSVVSLSIPKKRLLGI  80

Query  503  lssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            L S LGS+  LRH+NLR+NRLNGS+PP LF+A  L+S+V   N LSG LP
Sbjct  81   LPSVLGSIFSLRHLNLRNNRLNGSIPPDLFKAESLQSIVFIGNSLSGSLP  130



>ref|XP_007142963.1| hypothetical protein PHAVU_007G032100g [Phaseolus vulgaris]
 gb|ESW14957.1| hypothetical protein PHAVU_007G032100g [Phaseolus vulgaris]
Length=713

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = +2

Query  299  CNSQA-VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLS  475
            CNS A ++ SLN EG  LL  K+S+ D P+GSMS+WN SDE PCSWNGITCKDQ VV++S
Sbjct  15   CNSIAPLVHSLNAEGSVLLTLKQSLTD-PQGSMSNWNFSDENPCSWNGITCKDQNVVAIS  73

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            IPK+KL G L SSLGSLSQLRHVN R+N+L G+LP  LF+A GL+SLVLY N  SG
Sbjct  74   IPKRKLYGSLPSSLGSLSQLRHVNFRNNKLFGNLPAQLFQAQGLQSLVLYGNSFSG  129



>ref|XP_010513827.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=722

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  266  MVILALFILIFCN----SQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSW  433
            + +L + + + CN        +S LN+EG +LL FK+ + DDP GS+S+WN SDE  CSW
Sbjct  2    LALLIIIVALLCNYNYIPHVTVSGLNDEGFALLTFKQGVHDDPSGSLSNWNSSDEDACSW  61

Query  434  NGITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
            NG+TCK+ RVVSLSIP+K L G L SSLG LS LRH+NLRSNR  GSLP  LF+  GL+S
Sbjct  62   NGVTCKELRVVSLSIPRKSLYGSLPSSLGFLSSLRHLNLRSNRFYGSLPVQLFQLQGLQS  121

Query  614  LVLYENYLSGPL  649
            LVLY N   G L
Sbjct  122  LVLYGNSFDGSL  133



>ref|XP_010527771.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Tarenaya hassleriana]
Length=669

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            +V L +   + CN    +S LN+EG +L+ FK+ + +DP GS+S+WN SD  PCSWNG+T
Sbjct  2    LVSLIVSAALLCNCNIWVSGLNDEGFALMSFKQGVREDPTGSLSNWNSSDSDPCSWNGVT  61

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            CK+ +VVSLSIP+KKL G L  SLG LS LRH+NLR+NR +GSLP  LF    L+SLVLY
Sbjct  62   CKELKVVSLSIPRKKLYGSLPPSLGLLSSLRHLNLRNNRFHGSLPVQLFELQDLQSLVLY  121

Query  626  ENYLSGPLP  652
            +N  SG LP
Sbjct  122  DNSFSGWLP  130



>ref|XP_007216807.1| hypothetical protein PRUPE_ppa023239mg [Prunus persica]
 gb|EMJ18006.1| hypothetical protein PRUPE_ppa023239mg [Prunus persica]
Length=708

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  266  MVILALF-ILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            MV+  L+ + + CNS A +S +NEEG +LL FK+S+   PEGS+S+WN SD+TPCSW G+
Sbjct  1    MVLQVLYLVFLLCNSLAFISCVNEEGLALLSFKESLTHYPEGSLSNWNSSDQTPCSWTGV  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
             C+  +VVSLSIP + L G  S +LG+LS +RH+NLRSN L GSLP  LF A  L+SLVL
Sbjct  61   ACRQDKVVSLSIPSRNLYGIFSPALGNLSAIRHLNLRSNELFGSLPCELFNAKDLQSLVL  120

Query  623  YENYLSGPLP  652
              N LSG +P
Sbjct  121  SGNSLSGSVP  130



>ref|XP_006415859.1| hypothetical protein EUTSA_v10006964mg [Eutrema salsugineum]
 gb|ESQ34212.1| hypothetical protein EUTSA_v10006964mg [Eutrema salsugineum]
Length=701

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L   IL+  N    L++LN+EG +LL  K+SI  DP GS+S+WN  ++ PCSWNG+TC D
Sbjct  6    LLFLILLIWNFNGELNALNDEGYALLTLKQSISRDPNGSLSNWNSKNQNPCSWNGVTCDD  65

Query  455  QR-VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
            Q+ VVSLSIPKKKL G L SSLG LS LRH+NLRSN L+GSLP  LF A  L+SLVLY N
Sbjct  66   QKVVVSLSIPKKKLVGHLPSSLGLLSNLRHLNLRSNELSGSLPVELFHAQRLQSLVLYGN  125

Query  632  YLSGPLP  652
             LSG +P
Sbjct  126  SLSGSIP  132



>ref|XP_010554434.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Tarenaya hassleriana]
Length=699

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +2

Query  266  MVILALFILIFCNSQAV-LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            +V L + + + CN     +S LN+EG +LL FK+S+ +DP GS+S+WN SD  PCSWNG+
Sbjct  2    LVSLIISVALLCNFNTTWVSGLNDEGFALLSFKQSVREDPSGSLSNWNSSDNDPCSWNGV  61

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TCK+ +VVSLSIP+KKL G L+SSLG LS LRH+NLRSNR  G LP  L    GL+SLVL
Sbjct  62   TCKELKVVSLSIPRKKLYGPLASSLGFLSSLRHLNLRSNRFYGYLPIQLLELQGLQSLVL  121

Query  623  YENYLSGPLP  652
            Y+N  SG LP
Sbjct  122  YDNSFSGWLP  131



>ref|XP_004497046.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Cicer arietinum]
Length=711

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = +2

Query  299  CN--SQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSL  472
            CN  S  V++SLN EG  LL  K+  ++DP+ SMS+WN SDE PCSWNGITCKDQ VVS+
Sbjct  15   CNILSPLVVNSLNSEGYVLLTLKQ-FINDPQNSMSNWNSSDENPCSWNGITCKDQTVVSI  73

Query  473  SIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            SIPK+KL G L SSLGSLSQLRHVN R+N L G+LP  LF+A GL+SLVLY N  SG +P
Sbjct  74   SIPKRKLHGSLPSSLGSLSQLRHVNFRNNELFGTLPQQLFQAQGLQSLVLYGNSFSGSVP  133



>ref|XP_008343005.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Malus domestica]
Length=699

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +L L  L+ CNS +++S +NEEG +LL FK+S+  +PE S+S WN SD+TPCSW G+TC+
Sbjct  5    VLCLAFLV-CNSLSLVSCINEEGLALLSFKESLTKNPESSLSTWNSSDQTPCSWXGVTCR  63

Query  452  DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
            +++VVSLSIP K+LSG    +LG+LS LRH+NLR N+L+GSLP  LF A  L+SLVL  N
Sbjct  64   EEKVVSLSIPNKQLSGIFPRALGNLSALRHLNLRENKLSGSLPSELFNAKXLQSLVLSGN  123

Query  632  YLSGPLP  652
             LSG +P
Sbjct  124  SLSGSVP  130



>emb|CDY42116.1| BnaA09g28440D [Brassica napus]
Length=696

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQR-VVSLSI  478
            N    L++LN+EG +LL  K+SI  DP+GS+++W+  ++TPCSWNG+TC D   VVSLSI
Sbjct  15   NFNGELNALNDEGYALLALKQSISRDPDGSLTNWDSENQTPCSWNGVTCDDHSLVVSLSI  74

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKLSG L SSLGSLS LRH+NLRSN L GSLP  LFRA  L+SLVLY N LSGP+P
Sbjct  75   PKKKLSGHLPSSLGSLSNLRHLNLRSNDLTGSLPLELFRAQRLQSLVLYGNSLSGPIP  132



>emb|CDY17688.1| BnaA06g35070D [Brassica napus]
Length=778

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 104/152 (68%), Gaps = 7/152 (5%)
 Frame = +2

Query  188  ICTKVSSLALYHLPYPP*FLQERVGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKS  367
            +CTK+++L+L  L          +  +  L +F  + C    V ++LN+EG +LL FK+S
Sbjct  50   LCTKLNTLSLSVLGVI------HLKMLTSLLIFFTLLCIYIPV-NALNDEGFALLTFKQS  102

Query  368  IVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVN  547
            + +DP GS+++WN SDE  CSWNG+TCK+ +VVSLSIP+K L G L SSLG LS LRH+N
Sbjct  103  VNEDPTGSLTNWNSSDEDACSWNGVTCKELKVVSLSIPRKNLYGSLPSSLGFLSSLRHLN  162

Query  548  LRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            LRSNRL+GSLP  LF   GL+SLVLY N   G
Sbjct  163  LRSNRLHGSLPTQLFELQGLQSLVLYGNSFDG  194



>gb|KJB61249.1| hypothetical protein B456_009G348000 [Gossypium raimondii]
Length=656

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            + +L + + C    V++ LN EG +LL FK SI +DPEGS+S+WN S + PCSWNGI CK
Sbjct  1    MFSLVLALLCFHGVVVTCLNNEGYALLSFKNSIYEDPEGSLSNWNSSHDNPCSWNGIACK  60

Query  452  DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
            +QRVVS+SIP  KL GFL S+LGSL  LRH+NLR+N+L G+ P  L    GL+SLVLY N
Sbjct  61   EQRVVSISIPNNKLRGFLPSALGSLFDLRHLNLRNNKLFGAFPVELLEVEGLQSLVLYGN  120

Query  632  YLSGPLP  652
             +S  LP
Sbjct  121  SMSEALP  127



>ref|XP_009394442.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=712

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  314  VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKl  493
            V++ LN EG +LL FK  I +DP GS++ WN SD+ PCSWNGITC+   VV+LS+PKKKL
Sbjct  25   VVNGLNGEGAALLSFKAGIREDPSGSLASWNSSDQDPCSWNGITCRGVSVVALSLPKKKL  84

Query  494  sgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             G+L S+LGSL  LRHVNLR+NRL G+L  GLF A  L+SLVLY N+LSG LP
Sbjct  85   VGYLPSALGSLRSLRHVNLRNNRLFGNLSAGLFAARALQSLVLYGNFLSGSLP  137



>ref|XP_009393570.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=715

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgf  502
            +LNEEG +LL FK S+ +DP  S+++WN S + PCSWNGI+CK+ +VVS+S+PK +L G 
Sbjct  30   ALNEEGLALLSFKASMQEDPGASLANWNSSGDDPCSWNGISCKEGKVVSISLPKNRLLGS  89

Query  503  lssslgslsqlRHVNLRSNRLNGSLPPGLFRAL-GLESLVLYENYLSGPLP  652
            L SSLGSLS LRH+NLRSNRL GSLP GLF A  GL+SLVLY N  SGP+P
Sbjct  90   LPSSLGSLSSLRHINLRSNRLQGSLPSGLFAAAGGLQSLVLYGNSFSGPIP  140



>ref|XP_006398506.1| hypothetical protein EUTSA_v10000800mg [Eutrema salsugineum]
 gb|ESQ39959.1| hypothetical protein EUTSA_v10000800mg [Eutrema salsugineum]
Length=714

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +2

Query  275  LALFILIFCN--SQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            L +F+ + CN     ++S LN+EG +LL FK+SI +DP GS+S+WN SD   CSWNG+TC
Sbjct  5    LIIFVALLCNYVPHVLVSGLNDEGFALLTFKQSIYEDPTGSLSNWNSSDNDACSWNGVTC  64

Query  449  KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
             + +VVSLSIP+K L G L SSLG LS LRH+NLRSNR  GSLP  LF   GL+SLVLY 
Sbjct  65   NELKVVSLSIPRKNLYGTLPSSLGFLSSLRHLNLRSNRFYGSLPIQLFELQGLQSLVLYG  124

Query  629  NYLSG  643
            N   G
Sbjct  125  NSFDG  129



>ref|XP_006290656.1| hypothetical protein CARUB_v10016748mg [Capsella rubella]
 gb|EOA23554.1| hypothetical protein CARUB_v10016748mg [Capsella rubella]
Length=720

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 4/129 (3%)
 Frame = +2

Query  275  LALFILIFCNS----QAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            L + + + C+S       ++ LN+EG +LL FK+S+ DDP GS+S+WN SDE  CSWNG+
Sbjct  5    LIIIVALLCSSNYIPHVTVTGLNDEGFALLTFKQSVHDDPTGSLSNWNSSDEDACSWNGV  64

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TCK+ +VVSLSIP+K L G L SSLG LS LRH+NLRSNR  G LP  LF+  GL+SLVL
Sbjct  65   TCKELKVVSLSIPRKSLHGSLPSSLGFLSSLRHLNLRSNRFYGPLPIQLFQLQGLQSLVL  124

Query  623  YENYLSGPL  649
            Y N   G L
Sbjct  125  YGNSFDGSL  133



>ref|XP_010906986.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=712

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +2

Query  314  VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKl  493
            ++ SLNEEG +LL FK SI +DPEGS+ DWN SD  PCSW+GI C++  VVSLS PKK+L
Sbjct  23   LVDSLNEEGFALLSFKASIREDPEGSLRDWNSSDPNPCSWSGIICREGVVVSLSFPKKRL  82

Query  494  sgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            SGFL S+LGSL  L H+NLR+N L G LPP LF A GL+SLVLY N+LSG LP
Sbjct  83   SGFLPSALGSLPSLGHINLRNNWLYGILPPELFAARGLQSLVLYGNFLSGSLP  135



>ref|XP_010534193.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830, partial [Tarenaya hassleriana]
Length=407

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            +V LA  +   C     + +LN+EG +LL FK+S++ DP GS+S+WN SD  PCSWNG+T
Sbjct  2    VVYLAFLVACSCFFGGEVGALNDEGYALLTFKQSVLRDPFGSLSNWNSSDPNPCSWNGVT  61

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C +QRVVS+SIP+KKL GFL SSLG L  LRH+NLRSN LNGS P  LF A  L+SLVLY
Sbjct  62   CDEQRVVSVSIPRKKLVGFLPSSLGLLLYLRHLNLRSNDLNGSFPVELFEARRLQSLVLY  121

Query  626  ENYLSGPLP  652
             N LSG +P
Sbjct  122  GNSLSGSIP  130



>gb|KEH44189.1| LRR receptor-like kinase [Medicago truncatula]
Length=709

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +2

Query  299  CNSQAVLS-SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLS  475
            CN+ + L+ SLN EG  LL  K+S+  DP+GSM++WN SD+ PCSWNGITCKD+ VVS+S
Sbjct  15   CNTLSPLANSLNPEGYVLLTLKQSL-KDPQGSMNNWNSSDQNPCSWNGITCKDKTVVSIS  73

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            IPK+KL+G L SSLGSLSQLRHVN R+N L G LP  LF+A GL+SLVLY N  SG +P
Sbjct  74   IPKRKLNGSLPSSLGSLSQLRHVNFRNNELFGPLPHDLFQAQGLQSLVLYGNSFSGSVP  132



>ref|XP_010542166.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X3 [Tarenaya hassleriana]
Length=532

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            +V LA  +   C     + +LN+EG +LL FK+S++ DP GS+S+WN SD  PCSWNG+T
Sbjct  2    VVYLAFLVACSCFFGGEVGALNDEGYALLTFKQSVLRDPFGSLSNWNSSDPNPCSWNGVT  61

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C +QRVVS+SIP+KKL GFL SSLG L  LRH+NLRSN LNGS P  LF A  L+SLVLY
Sbjct  62   CDEQRVVSVSIPRKKLVGFLPSSLGLLLYLRHLNLRSNDLNGSFPVELFEARRLQSLVLY  121

Query  626  ENYLSGPLP  652
             N LSG +P
Sbjct  122  GNSLSGSIP  130



>ref|XP_009101362.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=710

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L +F+ +  N   V ++LN+EG +LL FK+S+ +DP G++++WN SDE  CSWNG+TCK+
Sbjct  5    LLIFLTLLSNYIPV-NTLNDEGFALLTFKQSVHEDPTGALTNWNSSDEDACSWNGVTCKE  63

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             +VVSLSIP+K L G L SSLG LS LRH+NLRSNRL+GSLP  LF   GL+SLVLY N 
Sbjct  64   LKVVSLSIPRKNLYGSLPSSLGFLSSLRHLNLRSNRLHGSLPTQLFELQGLQSLVLYGNS  123

Query  635  LSG  643
              G
Sbjct  124  FDG  126



>emb|CDX84980.1| BnaC05g20750D [Brassica napus]
Length=699

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQR-VVSLSI  478
            N    L++LN+EG +LL  K+SI  DP+GS+++W+  ++TPCSWNG+TC D   VVSLSI
Sbjct  15   NFNGELNALNDEGYALLALKQSISRDPDGSLTNWDSENQTPCSWNGVTCDDHSLVVSLSI  74

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKLSG L SSLGSLS LRH+NLRSN L G+LP  LFRA  L+SLVLY N LSG +P
Sbjct  75   PKKKLSGHLPSSLGSLSNLRHLNLRSNELTGTLPLELFRAQRLQSLVLYGNSLSGSIP  132



>ref|XP_010542164.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Tarenaya hassleriana]
 ref|XP_010542165.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Tarenaya hassleriana]
Length=694

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            +V LA  +   C     + +LN+EG +LL FK+S++ DP GS+S+WN SD  PCSWNG+T
Sbjct  2    VVYLAFLVACSCFFGGEVGALNDEGYALLTFKQSVLRDPFGSLSNWNSSDPNPCSWNGVT  61

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C +QRVVS+SIP+KKL GFL SSLG L  LRH+NLRSN LNGS P  LF A  L+SLVLY
Sbjct  62   CDEQRVVSVSIPRKKLVGFLPSSLGLLLYLRHLNLRSNDLNGSFPVELFEARRLQSLVLY  121

Query  626  ENYLSGPLP  652
             N LSG +P
Sbjct  122  GNSLSGSIP  130



>ref|XP_009344127.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=700

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +2

Query  266  MVILAL-FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            MV+  L   L+ CNS +++S +NEEG +LL FK+S+  + E S+S WN SD+TPCSW G+
Sbjct  1    MVLQVLCLALLVCNSLSLVSCINEEGLALLSFKESLTKNAESSLSTWNSSDQTPCSWVGV  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TC++++VVSLSIP  +LSG    +LG+LS LRH+NLR N+L+GSLP  LF A  L+SLVL
Sbjct  61   TCREEKVVSLSIPNIQLSGIFPRALGNLSALRHLNLRENKLSGSLPSELFNAKELQSLVL  120

Query  623  YENYLSGPLP  652
              N LSG +P
Sbjct  121  SGNSLSGSVP  130



>gb|KFK44531.1| hypothetical protein AALP_AA1G268700 [Arabis alpina]
Length=702

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +2

Query  296  FCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQR-VVSL  472
             CN    L++LN EG +LL  K+SI  DP GS+++WN  ++ PCSWNG+ C DQ+ VVSL
Sbjct  13   ICNFNTELNALNNEGYALLTLKQSITKDPYGSLTNWNSENQNPCSWNGVGCDDQKLVVSL  72

Query  473  SIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            SIPKK L G+L SSLG LS LRH+NLRSN L GSLP  LF+A  L+SLVLY N LSG +P
Sbjct  73   SIPKKNLVGYLPSSLGLLSNLRHLNLRSNDLTGSLPVELFQAQRLQSLVLYGNSLSGSIP  132



>ref|XP_009115301.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=696

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQR-VVSLSI  478
            N    L++LN+EG +LL  K+SI  DP+GS+++W+  ++TPCSWNG+TC D   VVSLSI
Sbjct  15   NFNGELNALNDEGYALLALKQSISRDPDGSLTNWDSENQTPCSWNGVTCDDHSLVVSLSI  74

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            PKKKLSG L SSLGSLS LRH+NLRSN L G+LP  LFRA  L+SLVLY N LSG +P
Sbjct  75   PKKKLSGHLPSSLGSLSNLRHLNLRSNDLTGTLPLELFRAQRLQSLVLYGNSLSGSIP  132



>ref|XP_009341317.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=700

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  269  VILALFILIF--CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            ++L    L F  CNS +++S +NEEG +LL FK+S+  + E S+S WN SD+TPCSW G+
Sbjct  1    MVLQFLCLAFLVCNSLSLVSCINEEGLALLSFKESLTKNAESSLSTWNSSDQTPCSWVGV  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
            TC++++VV LSIP  +LSG    +LG+LS LRH+NLR N+L+GSLP  LF A  L+SLVL
Sbjct  61   TCREEKVVYLSIPNIQLSGIFPRALGNLSALRHLNLRENKLSGSLPSELFNAKELQSLVL  120

Query  623  YENYLSGPLP  652
              N LSG +P
Sbjct  121  SGNSLSGSVP  130



>ref|XP_004147142.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis sativus]
 gb|KGN51534.1| hypothetical protein Csa_5G576760 [Cucumis sativus]
Length=717

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 96/130 (74%), Gaps = 2/130 (2%)
 Frame = +2

Query  269  VILALFILIFCNSQ--AVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            +++ LF+++ C S    ++SSLN+EG  LL  K+SI  DP+G+ S W+ S+ETPCSWNG+
Sbjct  1    MLVGLFLILLCCSDCLVLVSSLNDEGFVLLTLKQSISLDPDGAFSYWDSSNETPCSWNGV  60

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
             C +  VVS++IPK+ L GFL SSLG+LS LRH+NLR+NRL GSLP  LF A  L+SLVL
Sbjct  61   GCLNDIVVSVTIPKRNLYGFLPSSLGALSGLRHLNLRNNRLFGSLPFQLFSAQALQSLVL  120

Query  623  YENYLSGPLP  652
            Y N  SG +P
Sbjct  121  YGNSFSGFVP  130



>emb|CDX77808.1| BnaC07g20620D [Brassica napus]
Length=705

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            L S    G +LL FK+S+ +DP GS+++WN SDE  CSWNG+TCK+ +VVSLSIP+K L 
Sbjct  15   LFSFTLYGFALLTFKQSVNEDPTGSLTNWNSSDEDACSWNGVTCKELKVVSLSIPRKNLY  74

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            G L SSLG LS LRH+NLRSNR +GSLP  LF   GL+SLVLY N   G
Sbjct  75   GSLPSSLGFLSSLRHLNLRSNRFHGSLPTQLFELQGLQSLVLYGNSFDG  123



>gb|EPS72631.1| hypothetical protein M569_02128 [Genlisea aurea]
Length=648

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +2

Query  263  KMVILALFILI-FCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNG  439
            K+   ALF+++ +C+    +S LN+EG +LL FKKSI +DP  ++ +WN SD TPCSW+G
Sbjct  3    KVADYALFLMLGYCSFWMNVSCLNDEGMALLSFKKSIEEDPRAALVNWNPSDSTPCSWDG  62

Query  440  ITCKDQRVVSLSIPKKKlsg-flssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESL  616
            + C++Q V+S+ IP K LSG   ++SLGSLS LRH+N+RSNR +G   P +FRA  L SL
Sbjct  63   VKCENQTVISIRIPLKNLSGPLPAASLGSLSNLRHLNIRSNRFSGEFSPEIFRARKLRSL  122

Query  617  VLYENYLSGPLP  652
            VL  N LSG LP
Sbjct  123  VLSRNSLSGILP  134



>ref|XP_008467183.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=716

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            +SSLN+EG  LL  K+SI  DP+G+ S+W+ S+ETPCSWNG+ C ++ VVS++IPK+ L 
Sbjct  19   VSSLNDEGFVLLTLKQSISLDPDGAFSNWDSSNETPCSWNGVGCINEIVVSVTIPKRNLY  78

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            GFL SSLG+LS LRH+NLR+NRL GSLP  LF A  L+SLVLY N  SG +P
Sbjct  79   GFLPSSLGALSGLRHLNLRNNRLFGSLPFQLFSAQALQSLVLYGNSFSGFVP  130



>gb|KHN42429.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=667

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  392  MSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNG  571
            MS+WN SDE PCSWNGITCKDQ VVS+SIPK+KL G L+SSLGSLSQLRHVN R+N+L G
Sbjct  1    MSNWNSSDENPCSWNGITCKDQTVVSISIPKRKLYGSLTSSLGSLSQLRHVNFRNNKLFG  60

Query  572  SLPPGLFRALGLESLVLYENYLSGPLP  652
            +LPP LF+A GL+SLVLY N LSG +P
Sbjct  61   NLPPQLFQAQGLQSLVLYGNSLSGSVP  87



>ref|XP_010108889.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC20529.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=706

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            N  A + SLNEEG +LL FK S+ + PE   + WN SDETPCSW G+ CK QRV SLSIP
Sbjct  15   NCPAFVDSLNEEGLALLSFKGSLKEFPESFFTSWNSSDETPCSWLGVACKQQRVSSLSIP  74

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             + LSG LSS LG LS +RH+NL  N L GSLP  LF A  L SL L  N LSGPLP
Sbjct  75   NRALSGTLSSDLGKLSAIRHLNLPGNILFGSLPSDLFNATELRSLNLTGNSLSGPLP  131



>gb|KHN06695.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=668

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  392  MSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNG  571
            MS+WN  DE PCSWNGITCKDQ VVS+S PK+KL G L SSLGSLSQLRH+N R+N+L G
Sbjct  1    MSNWNSFDENPCSWNGITCKDQTVVSISFPKRKLYGSLPSSLGSLSQLRHINFRNNKLFG  60

Query  572  SLPPGLFRALGLESLVLYENYLSGPLP  652
            +LPP LF+A GL+SLVLY N LSG +P
Sbjct  61   NLPPRLFQAQGLQSLVLYGNSLSGSVP  87



>dbj|BAJ89657.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 7/112 (6%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD-----QRVVSLSIPKKKlsg  499
            +G++LL F+ +++ DP G+++DWN SD  PCSWNG+ C       +RVV+LS+P+K    
Sbjct  26   DGQALLSFRAAVLQDPTGALADWNASDADPCSWNGVACDGAGTGTRRVVALSLPRKG-LV  84

Query  500  flssslgslsqlRHVNLRSNRLNGSLPPGLFR-ALGLESLVLYENYLSGPLP  652
                +    + LRH+NLRSNRL G+LPP L   A GL+SLVLY N L GP+P
Sbjct  85   AALPASALPASLRHLNLRSNRLYGALPPALLAGAAGLQSLVLYGNELYGPVP  136



>ref|XP_007033179.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY04105.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=708

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGITCKDQRVVSLS  475
            CN  A L +LN+EG++LL FK+SI +  EG  +++WN SD  PCSW+G+TC+ ++V +L 
Sbjct  13   CNYTAHLGALNDEGRALLSFKQSIENSTEGYYLTNWNSSDVNPCSWHGVTCRKEKVTALI  72

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            IP   ++GFLS +L +L  +RHVNL++N   GSLP  LF A  L+SLVL  N LSG LP
Sbjct  73   IPNMGVAGFLSPALANLPAIRHVNLKNNSFRGSLPIQLFTATRLKSLVLSGNSLSGALP  131



>ref|XP_006430721.1| hypothetical protein CICLE_v10013476mg [Citrus clementina]
 gb|ESR43961.1| hypothetical protein CICLE_v10013476mg [Citrus clementina]
Length=712

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRV  463
             + +  +  A++ S N+EG +LL FK++I + PEG+  +WN S+E PCSWNGITC++ +V
Sbjct  9    LVFLILSYIALMGSANDEGLALLSFKQAIRNFPEGN--NWNNSNEDPCSWNGITCREGQV  66

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
             SL IP KKL+GF+ + LGSLS +R VNLR+N  +GSLP  LF A  L+SL+L  N  SG
Sbjct  67   FSLIIPNKKLTGFIPADLGSLSAIRRVNLRNNNFSGSLPVELFNASNLQSLILSGNSFSG  126

Query  644  PLPF  655
            P+P 
Sbjct  127  PVPM  130



>ref|XP_011035107.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Populus euphratica]
Length=699

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 3/132 (2%)
 Frame = +2

Query  257  VGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWN  436
            V + V L  FI+ +        S+N+EG +LL FK+S+VD    S+ +WN SD  PCSW 
Sbjct  2    VLQFVSLVFFIVHYI---TFAGSVNDEGLALLSFKQSLVDSTTRSLDNWNSSDANPCSWY  58

Query  437  GITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESL  616
            G+TC++++V  L +P K L+G L    G L  L HVNLRSN L+GSLP  LF A GL+SL
Sbjct  59   GVTCREEKVFFLRLPNKGLAGMLQLDTGKLVTLSHVNLRSNYLSGSLPVELFNAAGLKSL  118

Query  617  VLYENYLSGPLP  652
            +L  N  SG +P
Sbjct  119  ILSGNSFSGTVP  130



>gb|KDO63201.1| hypothetical protein CISIN_1g042348mg, partial [Citrus sinensis]
Length=686

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRV  463
             +L+  +  A++ S N+EG +LL FK++I + PEG+  +WN S+E PCSWNGITC++ +V
Sbjct  2    LVLLILSYIALMGSANDEGLALLSFKQAIRNFPEGN--NWNNSNEDPCSWNGITCREGQV  59

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
             SL IP KKL+GF+ + LGSLS +  VNLR+N  +GSLP  LF A  L+SL+L  N  SG
Sbjct  60   FSLIIPNKKLTGFIPADLGSLSAIGRVNLRNNNFSGSLPVELFNASNLQSLILSGNSFSG  119

Query  644  PLPF  655
            P+P 
Sbjct  120  PVPM  123



>ref|XP_008441289.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=753

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +2

Query  287  ILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVV  466
            + I  N  + +SSLNEEG +LL FK S  D  +G + +WN SD TPCSWNGITC +QRVV
Sbjct  117  VFIVSNHFSFVSSLNEEGLALLSFKSSTFDS-QGFLQNWNLSDATPCSWNGITCSEQRVV  175

Query  467  SLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGP  646
            SLSI  KKLSG L  +LG L  L H++L++N L GS P  L+  + L+SL L +N  +G 
Sbjct  176  SLSIVDKKLSGTLHPALGKLGSLHHLSLQNNNLFGSFPTELYNLVELQSLDLSQNLFNGS  235

Query  647  LP  652
            +P
Sbjct  236  IP  237



>ref|XP_004309737.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
 ref|XP_011471029.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Fragaria vesca subsp. vesca]
Length=688

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +2

Query  302  NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIP  481
            NS A +S +NEEG +L+ FK+S+ +  EGS+  WN SD+TPCSWNG+TC   +VVSLS+P
Sbjct  15   NSPAFVSCVNEEGLALISFKESLTEYAEGSLRSWNSSDQTPCSWNGVTCTQDKVVSLSLP  74

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             K LSG    +LG+LS L  +NLR+N L G LP   F A  L+S+VL  N LSG +P
Sbjct  75   YKNLSGIFPPALGNLSALCRLNLRNNGLFGRLPLEFFNAKELQSVVLSGNSLSGSVP  131



>ref|XP_002305177.1| hypothetical protein POPTR_0004s09480g [Populus trichocarpa]
 gb|EEE85688.1| hypothetical protein POPTR_0004s09480g [Populus trichocarpa]
Length=699

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgf  502
            S+N+EG +LL FK+SI D    S+ +WN SD  PCSW G+TC++++V  L +P K L+G 
Sbjct  21   SVNDEGLALLSFKQSIEDSTARSLDNWNSSDANPCSWYGVTCREEKVFFLRLPNKGLAGM  80

Query  503  lssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            L    G L  L HVNLRSN L+GSLP  LF A GL+SL+L  N  SG +P
Sbjct  81   LQLDTGKLVALSHVNLRSNYLSGSLPVELFNAAGLKSLILSGNSFSGTVP  130



>ref|XP_006482200.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Citrus sinensis]
Length=712

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +2

Query  311  AVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKK  490
            A++ S N+EG +LL FK++I + PEG+  +WN S+E PCSWNGITC++ +V SL IP KK
Sbjct  18   ALMGSANDEGLALLSFKQAIRNFPEGN--NWNNSNEDPCSWNGITCREGQVFSLIIPNKK  75

Query  491  lsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLPF  655
            L+GF+ + LGSLS +  VNLR+N  +GSLP  LF A  L+SL+L  N  SGP+P 
Sbjct  76   LTGFIPADLGSLSAIGRVNLRNNNFSGSLPVELFNASNLQSLILSGNSFSGPVPM  130



>ref|XP_003567755.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brachypodium distachyon]
Length=694

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 75/113 (66%), Gaps = 4/113 (4%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK--DQRVVSLSIPKKKls  496
            +L  +G++LL FK +++ DP G+++DWN S + PCSWNG+ C    +RVV+LS+P+K   
Sbjct  18   ALTADGQALLAFKAAVLRDPTGALADWNNSTDDPCSWNGVACDRGTRRVVALSLPRKG-L  76

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFR-ALGLESLVLYENYLSGPLP  652
                 +      LRH+NLRSNRL G+LPP L   A+GL+SLVL  N L G +P
Sbjct  77   VAALPASALPDSLRHLNLRSNRLFGALPPALVAGAVGLQSLVLSGNQLYGLVP  129



>ref|XP_002989681.1| hypothetical protein SELMODRAFT_41472, partial [Selaginella moellendorffii]
 gb|EFJ09158.1| hypothetical protein SELMODRAFT_41472, partial [Selaginella moellendorffii]
Length=710

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 79/116 (68%), Gaps = 6/116 (5%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK------DQRVVSLSIPK  484
            +LN +G SL+ FK+ I  DPE ++SDW+ SD TPC W+GI+C       + RV  + + K
Sbjct  1    ALNSDGLSLVAFKRGIFSDPERALSDWDESDATPCRWSGISCTSIRGESEPRVQGVMLAK  60

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K+L G +S  LGSLS L H+NLR N+L G LPP LF A  L++L+L +N LSGPLP
Sbjct  61   KQLVGSMSPDLGSLSYLEHLNLRQNQLIGGLPPALFNASALQTLLLSDNDLSGPLP  116



>ref|XP_002991799.1| hypothetical protein SELMODRAFT_41473, partial [Selaginella moellendorffii]
 gb|EFJ07203.1| hypothetical protein SELMODRAFT_41473, partial [Selaginella moellendorffii]
Length=710

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 79/116 (68%), Gaps = 6/116 (5%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK------DQRVVSLSIPK  484
            +LN +G SL+ FK+ I  DPE ++SDW+ SD TPC W+GI+C       + RV  + + K
Sbjct  1    ALNSDGLSLVAFKRGIFSDPERALSDWDESDATPCRWSGISCASIRGESEPRVQGVMLAK  60

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K+L G +S  LGSLS L H+NLR N+L G LPP LF A  L++L+L +N LSGPLP
Sbjct  61   KQLVGSMSPDLGSLSYLEHLNLRQNQLIGGLPPALFNASALQTLLLSDNDLSGPLP  116



>ref|XP_010474154.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=708

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-  457
            +F  I  +  A+ +SLN++G +LL FK+S+ +      ++WN SD  PCSW GITC D  
Sbjct  7    IFCFILTHFIAIATSLNDQGFALLSFKQSLQNQNNSVFTNWNSSDPNPCSWQGITCNDDL  66

Query  458  RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYL  637
            RVVS+ +P K+LSG L  S+GSL  LRH+NLR N   G+LP  LF   GL+SLVL  N  
Sbjct  67   RVVSIRLPNKRLSGSLHPSIGSLLSLRHINLRDNEFQGNLPVELFAPKGLQSLVLSGNSF  126

Query  638  SGPLP  652
            SG +P
Sbjct  127  SGSVP  131



>ref|XP_002528076.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF34326.1| ATP binding protein, putative [Ricinus communis]
Length=692

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgf  502
            SLN+EG +LL F++SI +   G + +WN SD+ PCSW+G+ C+ + VVSL IP K LSG 
Sbjct  18   SLNDEGLALLSFRQSIENSTAGYLDNWNSSDDNPCSWHGVECRGETVVSLRIPHKGLSGL  77

Query  503  lssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
                   L  LR VNLR+N   GSLP  LFRA GL +LVL  N  SG +P
Sbjct  78   FHLDATKLLALRQVNLRNNYFFGSLPVELFRARGLTNLVLSGNSFSGSVP  127



>ref|XP_011021296.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Populus euphratica]
Length=693

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +2

Query  311  AVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKK  490
            A + S+N+EG +LL FK+SI D     + +WN SD  PCSW+G+ C++++V SL +P K 
Sbjct  17   AFVGSVNDEGLALLFFKQSIEDSTAHYIDNWNSSDANPCSWHGVMCREEKVXSLRLPNKG  76

Query  491  lsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            L+G L    G L  L HV+LR+N L+GS P  LF A  L+SL L  N  SGP+P
Sbjct  77   LAGNLQLDAGKLVALSHVDLRNNHLSGSFPTELFNATELKSLTLSGNSYSGPVP  130



>ref|XP_010032651.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Eucalyptus grandis]
Length=740

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 95/161 (59%), Gaps = 10/161 (6%)
 Frame = +2

Query  200  VSSLALYHL-PYPP*FLQERVGKMVILALFILIFCNSQAVL---------SSLNEEGKSL  349
            +S +AL  L  YP  F   R   + +L   + +FC+   +L          SLN E  +L
Sbjct  5    ISFIALSQLLNYPFQFFDNRSSSLRVLLHKMALFCSLVILLMTNLFYMPVQSLNNESVAL  64

Query  350  LIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgflssslgsls  529
               K+SI +DP   + +W+ SDETPC+W G+ C   RVVSLS+  K L+G L S  G+LS
Sbjct  65   WYLKRSIREDPSRFLKNWSLSDETPCNWKGVECIRDRVVSLSLSNKNLTGLLPSIFGNLS  124

Query  530  qlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             L+H++LR+N L+GSLP  LF A GL+SLVL  N  SG +P
Sbjct  125  ALQHIDLRNNNLSGSLPVTLFDANGLQSLVLSGNSFSGMIP  165



>ref|XP_004138802.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X1 [Cucumis sativus]
 gb|KGN63140.1| hypothetical protein Csa_2G404910 [Cucumis sativus]
Length=645

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRV  463
             + I  N  ++ SSLNEEG +LL FK S  D  +G + +WN SD TPCSWNGITC +QRV
Sbjct  8    LVFIVSNYFSLASSLNEEGLALLSFKSSTFDS-QGFLQNWNLSDATPCSWNGITCAEQRV  66

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            VSLSI  KKLSG L  +LG L  L H++L++N L GS P  L+  + L+SL L +N  + 
Sbjct  67   VSLSIVDKKLSGTLHPALGKLGSLHHLSLQNNNLFGSFPTELYNLVELQSLDLSQNLFNV  126

Query  644  PLP  652
             +P
Sbjct  127  SIP  129



>ref|XP_011649930.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Cucumis sativus]
Length=610

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRV  463
             + I  N  ++ SSLNEEG +LL FK S  D  +G + +WN SD TPCSWNGITC +QRV
Sbjct  8    LVFIVSNYFSLASSLNEEGLALLSFKSSTFDS-QGFLQNWNLSDATPCSWNGITCAEQRV  66

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            VSLSI  KKLSG L  +LG L  L H++L++N L GS P  L+  + L+SL L +N  + 
Sbjct  67   VSLSIVDKKLSGTLHPALGKLGSLHHLSLQNNNLFGSFPTELYNLVELQSLDLSQNLFNV  126

Query  644  PLP  652
             +P
Sbjct  127  SIP  129



>ref|NP_176855.1| probable inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9C9N5.1|Y1668_ARATH RecName: Full=Probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG60082.1|AC013288_16 receptor protein kinase, putative [Arabidopsis thaliana]
 gb|ACN59265.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE34560.1| probable inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=685

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +  +   I  +  A+ +SLN++G +LL FK+SI +  +   ++WN SD  PCSW G+TC 
Sbjct  4    LFLILCFILTHFFAIATSLNDQGLALLSFKQSIQNQSDSVFTNWNSSDSNPCSWQGVTCN  63

Query  452  -DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
             D RVVS+ +P K+LSG L  S+GSL  LRH+NLR N   G LP  LF   GL+SLVL  
Sbjct  64   YDMRVVSIRLPNKRLSGSLDPSIGSLLSLRHINLRDNDFQGKLPVELFGLKGLQSLVLSG  123

Query  629  NYLSGPLP  652
            N  SG +P
Sbjct  124  NSFSGFVP  131



>dbj|BAF01034.1| hypothetical protein [Arabidopsis thaliana]
Length=685

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +  +   I  +  A+ +SLN++G +LL FK+SI +  +   ++WN SD  PCSW G+TC 
Sbjct  4    LFLILCFILTHFFAIATSLNDQGLALLSFKQSIQNQSDSVFTNWNSSDSNPCSWQGVTCN  63

Query  452  -DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
             D RVVS+ +P K+LSG L  S+GSL  LRH+NLR N   G LP  LF   GL+SLVL  
Sbjct  64   YDMRVVSIRLPNKRLSGSLDPSIGSLLSLRHINLRDNDFQGKLPVELFGLKGLQSLVLSG  123

Query  629  NYLSGPLP  652
            N  SG +P
Sbjct  124  NSFSGFVP  131



>ref|XP_002462033.1| hypothetical protein SORBIDRAFT_02g013100 [Sorghum bicolor]
 gb|EER98554.1| hypothetical protein SORBIDRAFT_02g013100 [Sorghum bicolor]
Length=844

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = +2

Query  320  SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK-DQRVVSLSIPKKKls  496
            S+LN++G  LL FK+S+  DP GS+S W  +D TPC+WNG+ C  D RVVS+ +P  +L 
Sbjct  53   SALNQDGIQLLSFKQSLASDPLGSLSGWGYADATPCAWNGVVCSPDSRVVSVVLPNAQLV  112

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G ++  LG +  LRH++L  N LNG++PP L RA  L  L L  N ++G LP
Sbjct  113  GPVARELGLIEHLRHLDLSGNALNGTIPPDLLRAPELRVLSLAGNGITGDLP  164



>ref|XP_004968837.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Setaria italica]
Length=709

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 10/115 (9%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC--------KDQRVVSLSIPKKK  490
            +G++LL FK ++V DP G++++W+ +   PC+WNG+ C        + +RVV+LS+PKK+
Sbjct  20   DGQALLAFKAAVVQDPTGALANWDATAADPCAWNGVACSSSSTDATQPRRVVALSLPKKR  79

Query  491  lsgflssslgslsqlRHVNLRSNRLNGSLPPGLFR-ALGLESLVLYENYLSGPLP  652
                   +    S LRH+NLRSNRL G +PP L   A  L+SLVLY N L+GPLP
Sbjct  80   -LVAALPAAPLPSSLRHLNLRSNRLFGPVPPELVSGAPALQSLVLYGNALNGPLP  133



>gb|KJB43117.1| hypothetical protein B456_007G184800 [Gossypium raimondii]
Length=691

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = +2

Query  299  CNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSI  478
            CN    LS+LN+E  +LL FK+S+ +D    + +WN SD  PCSW+G++C++Q+V +L +
Sbjct  13   CNRNPRLSALNDEALALLSFKQSLENDTGAYLINWNSSDPNPCSWHGVSCRNQKVHALIV  72

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            P   LSG+LS +L +LS +RHVNL +N   G+LP  LF A  L+SLV+  N L GPLP
Sbjct  73   PNIGLSGYLSPALANLSSIRHVNLENNSFRGTLPTELFGATRLKSLVVSGNSLYGPLP  130



>ref|XP_012078013.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Jatropha curcas]
 gb|KDP33010.1| hypothetical protein JCGZ_13041 [Jatropha curcas]
Length=689

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 83/127 (65%), Gaps = 5/127 (4%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +LA FI  +       +SLNEEG +LL FK+SI +    ++++WN SD +PC W+G+ C 
Sbjct  4    LLAFFIFHYV---IPATSLNEEGVALLSFKQSIQNST--ALNNWNSSDISPCRWSGVQCS  58

Query  452  DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
            D++V S+SIP  +LSGFLS   G  + LRHVNLR+N   GSLP  LF A GL +LVL  N
Sbjct  59   DEKVTSISIPNSRLSGFLSLDTGKFTSLRHVNLRNNFFYGSLPVELFAATGLTNLVLSGN  118

Query  632  YLSGPLP  652
              SG +P
Sbjct  119  SFSGLVP  125



>ref|XP_006300314.1| hypothetical protein CARUB_v10019896mg [Capsella rubella]
 gb|EOA33212.1| hypothetical protein CARUB_v10019896mg [Capsella rubella]
Length=686

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 7/128 (5%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            IL  FIL       + +SLN++G +LL FK+S+ +  +   ++WN SD  PCSW GITC 
Sbjct  11   ILTHFIL------GIATSLNDQGLALLSFKQSLQNKNDSVFTNWNSSDSNPCSWQGITCN  64

Query  452  DQ-RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
            D  RVVS+ +P K+LSG L  S+GSL  LRH+NLR N   G+LP  LF   GL+SLVL  
Sbjct  65   DDMRVVSIRLPNKRLSGSLHPSIGSLLSLRHINLRDNEFQGNLPVELFVPKGLQSLVLSG  124

Query  629  NYLSGPLP  652
            N  SG +P
Sbjct  125  NSFSGLVP  132



>ref|XP_006391437.1| hypothetical protein EUTSA_v10018224mg [Eutrema salsugineum]
 gb|ESQ28723.1| hypothetical protein EUTSA_v10018224mg [Eutrema salsugineum]
Length=682

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +  +   +  +  A+ +SLN++G +LL FK+S  +  +   ++WN SD  PC W GITC 
Sbjct  4    LFPILFFVLTHFFAISTSLNDQGLALLSFKQSFQNQKDSVFTNWNSSDSNPCFWQGITCN  63

Query  452  DQ-RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYE  628
            D  RVVS+ +P K+LSG L+ S+G+L  LRH+NLR N L G LP  LF   GL+SLVL  
Sbjct  64   DDLRVVSIRLPNKRLSGSLNPSIGTLLSLRHINLRDNELQGKLPVELFGPKGLQSLVLSR  123

Query  629  NYLSGPLP  652
            N  SG +P
Sbjct  124  NSFSGLVP  131



>ref|XP_008674174.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Zea mays]
 tpg|DAA54864.1| TPA: putative leucine-rich repat protein kinase family protein 
[Zea mays]
Length=709

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 10/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC--------KDQRVVSLSI  478
            +L  +G++LL FK +++ DP G++++W  +   PCSWNG+TC        + +RVV+LS+
Sbjct  18   ALTPDGQALLAFKAAVLQDPTGALANWVATAADPCSWNGVTCSSPDPGSAQHRRVVALSL  77

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFR-ALGLESLVLYENYLSGPLP  652
            PKK+            S LRH+NLRSNRL G +PP L   A  L+SLVLY N L G LP
Sbjct  78   PKKR-LVAELPRAPLPSSLRHLNLRSNRLFGPIPPALVAGAPALQSLVLYGNALDGQLP  135



>ref|XP_010511585.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Camelina sativa]
Length=680

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-  457
            +   I  +  A+ +SLN++G +LL FK+S+ +      ++WN SD  PCSW GITC D  
Sbjct  7    ILCFILTHFIAIATSLNDQGLALLSFKQSLQNQNNSVFANWNSSDPNPCSWQGITCNDDL  66

Query  458  RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYL  637
            RVVS+ +P K+L G L  S+GSL  LRH+NLR N  +G LP  LF   G++SLVL  N  
Sbjct  67   RVVSIRLPNKRLLGSLHPSIGSLLSLRHINLRDNEFHGKLPVELFGPKGIQSLVLSGNSF  126

Query  638  SGPLP  652
            +G +P
Sbjct  127  TGSVP  131



>ref|XP_010528994.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Tarenaya hassleriana]
Length=657

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = +2

Query  320  SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-RVVSLSIPKKKls  496
            SS+N+EG +LL FKKS+ +  +  ++DWN SD  PCSW G++C ++ RVVSLS+P K+LS
Sbjct  3    SSINQEGIALLSFKKSLENHSDSVLTDWNSSDSDPCSWKGVSCNNELRVVSLSLPNKRLS  62

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G L  S+G+L  LR VNLR+N  +G+LP  LF A  L+SLVL  N  SG +P
Sbjct  63   GSLHPSIGTLLSLRRVNLRNNLFHGTLPVELFEAERLKSLVLSGNSFSGFVP  114



>ref|NP_001043190.1| Os01g0514700 [Oryza sativa Japonica Group]
 dbj|BAB92230.1| CLV1 receptor kinase-like protein [Oryza sativa Japonica Group]
 dbj|BAF05104.1| Os01g0514700 [Oryza sativa Japonica Group]
Length=705

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 76/116 (66%), Gaps = 11/116 (9%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDET-PCSWNGITC--------KDQRVVSLSIPKK  487
            +G++LL FK +++ DPEG+++DW+ S    PC+WNG++C         D+RVV+LS+P+K
Sbjct  21   DGQALLAFKAAVLRDPEGALADWDASTAADPCAWNGVSCGAGSGAGGADRRVVALSLPRK  80

Query  488  KlsgflssslgslsqlRHVNLRSNRLNGSLP-PGLFRALGLESLVLYENYLSGPLP  652
                    +    + LRH+NLRSNRL G LP P L  A GL+S+VLY N L GP+P
Sbjct  81   G-LVGSLPASPLPASLRHLNLRSNRLFGELPAPLLSAAAGLQSVVLYGNELYGPIP  135



>gb|EAY74284.1| hypothetical protein OsI_02173 [Oryza sativa Indica Group]
Length=708

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 76/116 (66%), Gaps = 11/116 (9%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDET-PCSWNGITC--------KDQRVVSLSIPKK  487
            +G++LL FK +++ DPEG+++DW+ S    PC+WNG++C         D+RVV+LS+P+K
Sbjct  21   DGQALLAFKAAVLRDPEGALADWDASTAADPCAWNGVSCGAGSGAGGADRRVVALSLPRK  80

Query  488  KlsgflssslgslsqlRHVNLRSNRLNGSLP-PGLFRALGLESLVLYENYLSGPLP  652
                    +    + LRH+NLRSNRL G LP P L  A GL+S+VLY N L GP+P
Sbjct  81   G-LVGSLPASPLPASLRHLNLRSNRLFGELPAPLLSAAAGLQSVVLYGNELYGPIP  135



>ref|XP_009406412.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
 ref|XP_009406413.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=715

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 11/135 (8%)
 Frame = +2

Query  281  LFILIFCNSQAV-----LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            LF +IF     +       +L+ +G SLL FK ++ DDP   ++ WN  DE PC W G++
Sbjct  7    LFTVIFWVVHIIHVARRCPALSSDGVSLLAFKAAVSDDPWAFLAGWNEEDEDPCRWPGVS  66

Query  446  CKD------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
            C +       RVV +S+  K L+G++   LG+L  LR +NL  NRL+G++PP LF A  L
Sbjct  67   CVNFTGFIHPRVVGVSVSGKNLTGYIPPELGALPFLRRLNLHGNRLSGAIPPQLFNAYSL  126

Query  608  ESLVLYENYLSGPLP  652
             SL LY+N+LSGP P
Sbjct  127  RSLFLYDNFLSGPFP  141



>emb|CDX96123.1| BnaA07g26080D [Brassica napus]
Length=393

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGI  442
             +IL  F+ +F    ++ +SLN++G +LL FK+++++  + S ++ WN SD  PC W GI
Sbjct  5    FLILCFFLTLFI---SMATSLNDQGLALLSFKQALLNQKDYSVLTTWNSSDSNPCFWLGI  61

Query  443  TC-KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
             C KD RVVS+ +P K LSG L  S+G+L  LRH+NLR N   G LP  LF  +GL+SLV
Sbjct  62   ACDKDLRVVSIRLPNKNLSGSLHPSIGTLLSLRHINLRDNEFQGKLPVELFAPIGLQSLV  121

Query  620  LYENYLSGPLP  652
            L  N  SG +P
Sbjct  122  LSGNSFSGFVP  132



>gb|KCW52086.1| hypothetical protein EUGRSUZ_J01521 [Eucalyptus grandis]
Length=284

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +2

Query  263  KMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
             +VIL +  L +   Q    SLN EG +L   K+SI  DP   + +W+ SDETPC W G+
Sbjct  6    SLVILLMTNLFYMPVQ----SLNNEGIALWSLKQSIRQDPSRFLKNWSLSDETPCKWKGV  61

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
             C   RVVSLS+  K L+GFL    G+LS LRH+ LR+N L+GSLP  LF   GL+SLVL
Sbjct  62   ECITDRVVSLSLSNKNLTGFLPPIFGNLSALRHIYLRNNNLSGSLPVTLFDLNGLQSLVL  121

Query  623  YENYLSGPLP  652
              N  SG +P
Sbjct  122  SGNSFSGMIP  131



>ref|XP_010034448.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
Length=317

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +2

Query  263  KMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
             +VIL +  L +   Q    SLN EG +L   K+SI  DP   + +W+ SDETPC W G+
Sbjct  6    SLVILLMTNLFYMPVQ----SLNNEGIALWSLKQSIRQDPSRFLKNWSLSDETPCKWKGV  61

Query  443  TCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
             C   RVVSLS+  K L+GFL    G+LS LRH+ LR+N L+GSLP  LF   GL+SLVL
Sbjct  62   ECITDRVVSLSLSNKNLTGFLPPIFGNLSALRHIYLRNNNLSGSLPVTLFDLNGLQSLVL  121

Query  623  YENYLSGPLP  652
              N  SG +P
Sbjct  122  SGNSFSGMIP  131



>gb|EEC68048.1| hypothetical protein OsI_35883 [Oryza sativa Indica Group]
Length=538

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 5/116 (4%)
 Frame = +2

Query  320  SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-----RVVSLSIPK  484
            ++L+ +G +LL FK ++ DDP G++S W+ +D+ PC W G+TC +      RVV +++  
Sbjct  21   AALSADGVALLAFKTAVTDDPSGALSSWSDADDDPCRWAGVTCANTSSSGPRVVGVAVAG  80

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K LSG++ S LGSL+ LR +NL  NRL+G++PP L  A  L SL LY N L+G LP
Sbjct  81   KNLSGYVPSVLGSLALLRRLNLHGNRLSGTVPPALANATSLHSLFLYGNSLTGGLP  136



>ref|XP_006383406.1| hypothetical protein POPTR_0005s15180g [Populus trichocarpa]
 gb|ERP61203.1| hypothetical protein POPTR_0005s15180g [Populus trichocarpa]
Length=697

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
             A  +    +  A + S+N+EG +LL FK+SI       + +WN SD  PCSW+G+ C++
Sbjct  5    FASLLFFIVHYSAFVGSVNDEGLALLSFKQSIEYSTAHYIDNWNSSDANPCSWHGVMCRE  64

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
            ++V SL +P K L+G L    G L  L HV+LR+N  +GS P  LF A  L SL+L  N 
Sbjct  65   EKVFSLRLPNKGLAGNLQLDAGKLVALSHVDLRNNHFSGSFPVELFNATELISLILSGNS  124

Query  635  LSGPLP  652
             SGP+P
Sbjct  125  FSGPVP  130



>ref|NP_001067730.1| Os11g0300600 [Oryza sativa Japonica Group]
 gb|AAX96428.1| Similar to protein kinase homolog T1F15.2 - Arabidopsis thaliana 
[Oryza sativa Japonica Group]
 gb|ABA92923.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28093.1| Os11g0300600 [Oryza sativa Japonica Group]
 gb|EAZ18159.1| hypothetical protein OsJ_33708 [Oryza sativa Japonica Group]
 dbj|BAG87468.1| unnamed protein product [Oryza sativa Japonica Group]
Length=557

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 5/116 (4%)
 Frame = +2

Query  320  SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-----RVVSLSIPK  484
            ++L+ +G +LL FK ++ DDP G++S W+ +D+ PC W G+TC +      RVV +++  
Sbjct  21   AALSADGVALLAFKTAVTDDPSGALSSWSDADDDPCRWAGVTCANTSSSGPRVVGVAVAG  80

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K LSG++ S LGSL+ LR +NL  NRL+G++PP L  A  L SL LY N L+G LP
Sbjct  81   KNLSGYVPSVLGSLALLRRLNLHGNRLSGTVPPALANATSLHSLFLYGNSLTGGLP  136



>ref|XP_010032652.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Eucalyptus grandis]
 gb|KCW52084.1| hypothetical protein EUGRSUZ_J01519 [Eucalyptus grandis]
Length=706

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 83/129 (64%), Gaps = 4/129 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            +VIL +  L +   Q    SLN E  +L   K+SI +DP   + +W+ SDETPC+W G+ 
Sbjct  7    LVILLMTNLFYMPVQ----SLNNESVALWYLKRSIREDPSRFLKNWSLSDETPCNWKGVE  62

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C   RVVSLS+  K L+G L S  G+LS L+H++LR+N L+GSLP  LF A GL+SLVL 
Sbjct  63   CIRDRVVSLSLSNKNLTGLLPSIFGNLSALQHIDLRNNNLSGSLPVTLFDANGLQSLVLS  122

Query  626  ENYLSGPLP  652
             N  SG +P
Sbjct  123  GNSFSGMIP  131



>ref|XP_002457921.1| hypothetical protein SORBIDRAFT_03g021850 [Sorghum bicolor]
 gb|EES03041.1| hypothetical protein SORBIDRAFT_03g021850 [Sorghum bicolor]
Length=712

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 12/125 (10%)
 Frame = +2

Query  311  AVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC----------KDQR  460
            A   +L  +G++LL FK +++ DP G++++W+ +   PC+WNG+ C          + +R
Sbjct  15   AAADALTPDGQALLAFKAAVLQDPTGALANWDATAADPCAWNGVACSSPDPGSGSAQPRR  74

Query  461  VVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFR-ALGLESLVLYENYL  637
            VV+LS+P KKL           S LRH+NLRSNRL G +PP L   A  L+SLVLY N L
Sbjct  75   VVALSLP-KKLLVAALPRSPLPSSLRHLNLRSNRLFGPVPPELVAGAPALQSLVLYGNAL  133

Query  638  SGPLP  652
             G LP
Sbjct  134  DGQLP  138



>gb|EAZ12114.1| hypothetical protein OsJ_01996 [Oryza sativa Japonica Group]
Length=690

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 74/116 (64%), Gaps = 11/116 (9%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDET-PCSWNGITC--------KDQRVVSLSIPKK  487
            +G++LL FK +++ DPEG+++DW+ S    PC+WNG++C         D+RVV+LS+P+K
Sbjct  21   DGQALLAFKAAVLRDPEGALADWDASTAADPCAWNGVSCGAGSGAGGADRRVVALSLPRK  80

Query  488  KlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALG-LESLVLYENYLSGPLP  652
                    +    + LRH+NLRSNRL G LP  L  A   L+S+VLY N L GP+P
Sbjct  81   G-LVGSLPASPLPASLRHLNLRSNRLFGELPAPLLSAAAWLQSVVLYGNELYGPIP  135



>ref|XP_010239182.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Brachypodium distachyon]
Length=552

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 86/142 (61%), Gaps = 8/142 (6%)
 Frame = +2

Query  242  FLQERVGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDET  421
             L   +G +++ +L +L    S    +SL+ +G +LL FK ++  DP  ++S W+ +D  
Sbjct  4    LLHSSLGTLILASLLVLA---SSPAATSLSADGLALLAFKSAVTVDPSSALSSWSANDTD  60

Query  422  PCSWNGITC-----KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPG  586
            PC W G++C      + RV SL++  K LSG+L S LGSLS LR +NL  NRL+G++PP 
Sbjct  61   PCRWPGVSCLNTSSTETRVTSLAVAGKNLSGYLPSELGSLSFLRRLNLHGNRLSGAVPPA  120

Query  587  LFRALGLESLVLYENYLSGPLP  652
            L  A  L S+ LY+N L+G  P
Sbjct  121  LSNATALRSIFLYDNNLTGAFP  142



>ref|XP_010032653.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
 gb|KCW52085.1| hypothetical protein EUGRSUZ_J01520 [Eucalyptus grandis]
Length=706

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            +VIL +  L +   Q    SLN EG +L   K+SI  DP   + +W+ SDETPC W G+ 
Sbjct  7    LVILLMTNLFYMPVQ----SLNNEGIALWSLKQSIRQDPSRFLKNWSLSDETPCKWKGVE  62

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C   RVVSLS+  K L+GFL    G+LS LRH+ LR+N L+GSLP  LF   GL+SLVL 
Sbjct  63   CITDRVVSLSLSNKNLTGFLPPIFGNLSALRHIYLRNNNLSGSLPVTLFDLNGLQSLVLS  122

Query  626  ENYLSGPLP  652
             N  SG +P
Sbjct  123  GNSFSGMIP  131



>ref|XP_002463642.1| hypothetical protein SORBIDRAFT_01g003440 [Sorghum bicolor]
 gb|EER90640.1| hypothetical protein SORBIDRAFT_01g003440 [Sorghum bicolor]
Length=772

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 9/123 (7%)
 Frame = +2

Query  311  AVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RV  463
            AV+++L+ +G SLL FK ++ DDP  ++S W+ +D  PC W G+TC +          RV
Sbjct  18   AVVAALSADGLSLLAFKSAVTDDPSSALSSWSDADADPCRWLGVTCVNTSSSSGDGGLRV  77

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            V ++I  K LSG++ S LGSL+ LR +NL  NRL+G++P  L  A  L SL LY+N L+G
Sbjct  78   VGVAIAGKNLSGYIPSELGSLAFLRRLNLHGNRLSGTVPAALANATALRSLFLYDNRLTG  137

Query  644  PLP  652
            P P
Sbjct  138  PFP  140



>ref|XP_001759884.1| predicted protein [Physcomitrella patens]
 gb|EDQ75388.1| predicted protein [Physcomitrella patens]
Length=699

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 82/135 (61%), Gaps = 13/135 (10%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M++LA+ +L           LN +G +LL FKK+I  DP  ++ +WN SD TPC WNGI 
Sbjct  1    MIVLAVEVLSVI-------GLNADGIALLEFKKAITSDPHSALKNWNDSDATPCRWNGIR  53

Query  446  CK------DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
            C       ++RV+++++P K+L G LS SLG L  L  +NL +N+L G +P  LF AL L
Sbjct  54   CARIQGTMEERVLNITLPGKELGGTLSPSLGDLVHLGLLNLHTNKLTGQIPSKLFAALNL  113

Query  608  ESLVLYENYLSGPLP  652
              L L  NYL+G +P
Sbjct  114  SRLYLSNNYLTGDIP  128



>ref|XP_010930148.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Elaeis guineensis]
Length=719

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 11/134 (8%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            VI+ L +++F +S      L+ +G +LL FK ++ DDP G+++ W+  DE PC W G+TC
Sbjct  8    VIVFLILIVFRSS-----GLSPDGLALLAFKSAVSDDPGGALAGWSEDDEDPCRWLGVTC  62

Query  449  KD------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLE  610
             +       RVV +++  K LSG++ S LGSL  LR +NL  NRL+GS+P  LF A  L 
Sbjct  63   ANVSGFPYPRVVGVAVAAKNLSGYVPSELGSLIFLRRLNLHGNRLSGSIPTPLFNASSLH  122

Query  611  SLVLYENYLSGPLP  652
            SL LY+N LSG LP
Sbjct  123  SLFLYDNNLSGVLP  136



>ref|XP_008652405.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Zea mays]
 tpg|DAA60638.1| TPA: putative leucine-rich repat protein kinase family protein 
[Zea mays]
Length=826

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = +2

Query  320  SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK-DQRVVSLSIPKKKls  496
            S+LN++G  LL FK S+V DP  S+S W  +D TPC WNG+ C  D RVVS+ +P  +L 
Sbjct  56   SALNQDGTLLLSFKLSLVSDPLASLSGWGYADATPCGWNGVVCSPDSRVVSVVLPNAQLV  115

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G ++  LG +  LRH++L  N LNG++P  L RA  L  L L  N ++G LP
Sbjct  116  GPVARELGLIEHLRHLDLSGNALNGTIPSDLLRAPELRVLSLAGNGITGDLP  167



>ref|XP_008783789.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Phoenix dactylifera]
Length=719

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 82/133 (62%), Gaps = 8/133 (6%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
             LA+F LIF   ++    L+ +G +LL FK ++ DDP G+++ W   D  PC W G+TC 
Sbjct  6    FLAIFYLIFMVFRS--HGLSPDGLALLAFKSAVSDDPGGALAGWREDDADPCGWPGVTCA  63

Query  452  D------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
            +       RVV +++  + LSG++ S LGSL  LR +NL  NRL+GS+P  LF A  L S
Sbjct  64   NVSGFSYPRVVGVAVAGRNLSGYVPSELGSLIFLRRLNLHGNRLSGSIPTPLFNASSLHS  123

Query  614  LVLYENYLSGPLP  652
            L LY+N LSG LP
Sbjct  124  LFLYDNNLSGVLP  136



>ref|NP_001169585.1| uncharacterized protein LOC100383466 [Zea mays]
 gb|ACN34186.1| unknown [Zea mays]
Length=819

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK-DQRVVSLSIPKKKlsgfl  505
            N++G  LL FK+S+  DP GS+S W  +D TPC+WNG+ C  D RVVS+ +P  +L G +
Sbjct  43   NQDGILLLSFKQSLASDPLGSLSGWGYADVTPCAWNGVVCSPDSRVVSVVLPNAQLVGPV  102

Query  506  ssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +  L  +  LRH++L  N L G++PP L RA  L  L L  N ++G LP
Sbjct  103  ARELALIENLRHLDLSGNALTGTIPPDLLRAPELRVLSLAGNGITGGLP  151



>tpg|DAA39565.1| TPA: putative leucine-rich repat protein kinase family protein 
[Zea mays]
Length=829

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK-DQRVVSLSIPKKKlsgfl  505
            N++G  LL FK+S+  DP GS+S W  +D TPC+WNG+ C  D RVVS+ +P  +L G +
Sbjct  53   NQDGILLLSFKQSLASDPLGSLSGWGYADVTPCAWNGVVCSPDSRVVSVVLPNAQLVGPV  112

Query  506  ssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +  L  +  LRH++L  N L G++PP L RA  L  L L  N ++G LP
Sbjct  113  ARELALIENLRHLDLSGNALTGTIPPDLLRAPELRVLSLAGNGITGGLP  161



>emb|CDY52887.1| BnaC06g27800D [Brassica napus]
Length=687

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = +2

Query  257  VGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSW  433
            + ++ ++  F+L    S A  +SLN++G +LL FK+++++  + S ++ WN SD  PC W
Sbjct  1    MAQLFLILCFLLTLFISMA--TSLNDQGLALLSFKQALLNQKDYSVLTTWNSSDSNPCFW  58

Query  434  NGITC-KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLE  610
             GITC KD RV+S+ +P K LSG L  S+G+L  LRH+NL++N   G LP  LF   GL+
Sbjct  59   LGITCNKDLRVISIRLPNKNLSGSLHPSIGTLLSLRHINLKNNEFQGKLPTELFAPEGLQ  118

Query  611  SLVLYENYLSGPLP  652
            SLVL  N  SG +P
Sbjct  119  SLVLSGNSFSGFVP  132



>ref|XP_002888549.1| hypothetical protein ARALYDRAFT_475779 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64808.1| hypothetical protein ARALYDRAFT_475779 [Arabidopsis lyrata subsp. 
lyrata]
Length=681

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +2

Query  290  LIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSM-SDWNRSDETPCSWNGITCKDQ-RV  463
            LI  +  A+ +SLN++G +LL FK+S+ +    S+ ++WN SD  PC W G+TC D+ RV
Sbjct  10   LILTHFFAMATSLNDQGLALLSFKQSLQNQSSDSVFTNWNSSDSNPCLWQGVTCNDELRV  69

Query  464  VSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSG  643
            VS+ +P K+LSGFL  S+GSL  LRHVNLR N   G LP  L+   GL+SL L  N  SG
Sbjct  70   VSIRLPNKRLSGFLHPSIGSLLSLRHVNLRDNEFQGELPVELYGLKGLQSLGLSGNSFSG  129

Query  644  PLP  652
             +P
Sbjct  130  LVP  132



>ref|XP_009105234.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brassica rapa]
Length=686

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = +2

Query  257  VGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSW  433
            + ++ ++  F+L    S A  +SLN++G +LL FK+++++  + S ++ WN SD  PC W
Sbjct  1    MAQLFLILCFLLTLFISMA--TSLNDQGLALLSFKQALLNQKDYSVLTTWNSSDSNPCFW  58

Query  434  NGITC-KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLE  610
             GITC KD RVVS+ +P K LSG L  S+G+L  LRH+NL++N+  G LP  LF    L+
Sbjct  59   LGITCNKDLRVVSIRLPNKNLSGSLHPSIGTLLSLRHINLKNNKFQGKLPAELFAPEELQ  118

Query  611  SLVLYENYLSGPLP  652
            SLVL  N  SG +P
Sbjct  119  SLVLSGNSFSGFVP  132



>ref|XP_009403214.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=749

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (59%), Gaps = 11/134 (8%)
 Frame = +2

Query  284  FILIFCNSQAV-----LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
             I   C   A+       +L+ +G SLL FK ++ +DP  S++ W+  DE PC W G++C
Sbjct  11   IIFFLCIVYAIALARRCGALSPDGLSLLAFKAAVSEDPSSSLAGWSEGDEDPCRWPGVSC  70

Query  449  KD------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLE  610
             +       R+V +++  K LSG++ S LG+L  LR +NL SNRL+G +P  LF A  L 
Sbjct  71   ANITGFAYPRMVGIAVSGKNLSGYIPSELGTLLFLRRLNLHSNRLSGPIPAQLFNASSLH  130

Query  611  SLVLYENYLSGPLP  652
            SL LY+N LSGP P
Sbjct  131  SLFLYDNLLSGPFP  144



>ref|XP_004979190.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Setaria italica]
Length=761

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-----RVVSLSIPKKKlsg  499
            +G +LL  K ++ DDP  ++S W+ +D  PC W G+TC +      RVV +++  K LSG
Sbjct  29   DGLALLALKSAVTDDPSSTLSTWSDADADPCRWVGVTCANTSSSGPRVVGVAVAAKNLSG  88

Query  500  flssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             L S LGSL  LR +NL  NRL+G++PP L  A  L SL LY+N L+GPLP
Sbjct  89   HLPSELGSLPFLRRLNLHGNRLSGAVPPALANATSLRSLFLYDNRLTGPLP  139



>ref|XP_006425984.1| hypothetical protein CICLE_v100249621mg, partial [Citrus clementina]
 gb|ESR39224.1| hypothetical protein CICLE_v100249621mg, partial [Citrus clementina]
Length=399

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 8/133 (6%)
 Frame = +2

Query  278  ALFILIFCNSQAVLS-SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC--  448
             L +L+F     V S  LN +G  LL FK S++ DP G +  WN +DE PCSWNG+TC  
Sbjct  14   VLVVLVFICGVVVQSLGLNTDGVLLLSFKYSVLSDPLGVLGSWNYNDENPCSWNGVTCAS  73

Query  449  -----KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
                  D RV+ L++P  +L G + + LG +  L++++L +N LNGSL   LF A  L +
Sbjct  74   PGEGNNDSRVIGLALPNSQLLGSIPADLGMIEFLQYLDLSNNSLNGSLSFSLFNASQLRN  133

Query  614  LVLYENYLSGPLP  652
            L L  N +SG LP
Sbjct  134  LDLSNNLISGHLP  146



>ref|XP_006845210.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Amborella trichopoda]
 gb|ERN06885.1| hypothetical protein AMTR_s00005p00251950 [Amborella trichopoda]
Length=720

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 6/116 (5%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC------KDQRVVSLSIPK  484
            SL  +G SLL  K ++  DP  + SDWN +D TPC W+G++C       D RVV ++I  
Sbjct  22   SLTPDGLSLLALKSAVDSDPNQAFSDWNENDTTPCHWSGVSCMAILGNSDPRVVGITISN  81

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K L G++ S LG+L  LR +NL  N   GSLP  LF A  L SL+LY+N  +G LP
Sbjct  82   KGLHGYIPSELGALVYLRRLNLHGNHFAGSLPSQLFNASSLHSLILYDNNFTGSLP  137



>ref|XP_002867127.1| hypothetical protein ARALYDRAFT_491249 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43386.1| hypothetical protein ARALYDRAFT_491249 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L LF L+F  +Q  L +LN +G  LL FK SI+ DP   +S+WN  D TPC W G+TC +
Sbjct  12   LVLFYLLFVPTQ--LQALNTDGVLLLTFKYSILSDPLSVLSNWNYDDATPCLWTGVTCTE  69

Query  455  Q---------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
                      RV SL +P K L G ++  L S+  LR ++L SN  NGSLP  +F A  L
Sbjct  70   LGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPHLRILDLSSNFFNGSLPDSVFNATEL  129

Query  608  ESLVLYENYLSGPLP  652
            + + L  N LSG LP
Sbjct  130  QVISLGSNNLSGDLP  144



>ref|XP_010105787.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC06140.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=721

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (59%), Gaps = 7/136 (5%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGI  442
            ++IL  F++ F    +   SL  +G SLL  K ++  D  GS  SDWN  + TPC W+GI
Sbjct  10   LMILIFFLVQFQILLSFTFSLTPDGLSLLSLKSAVDQDSAGSAFSDWNEDEATPCRWSGI  69

Query  443  TC------KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALG  604
            +C       D RVV ++I  K L G++ S LG+L  LR +NL SN  +GS+P  LF A  
Sbjct  70   SCMNITGYPDPRVVGIAISGKNLRGYIPSELGTLLFLRRLNLHSNNFHGSIPSQLFNATS  129

Query  605  LESLVLYENYLSGPLP  652
            L S+ LY N LSGP+P
Sbjct  130  LHSIFLYGNNLSGPVP  145



>ref|XP_006589635.1| PREDICTED: receptor protein kinase-like protein At4g34220-like 
[Glycine max]
Length=780

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 80/139 (58%), Gaps = 13/139 (9%)
 Frame = +2

Query  275  LALFILIFCNSQA----VLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            L+ F+L+   S        +SLN +G  LL FK SI++DP   + +WN  D TPCSW+G+
Sbjct  14   LSSFLLLLVQSVTSQFVAFTSLNSDGIHLLKFKYSILNDPLSVLENWNYEDATPCSWHGV  73

Query  443  TCKDQ---------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFR  595
             C +          RV SL++P  +L G +S  LG +  LRH++L +N LNGSLP  +F 
Sbjct  74   ACSEIGAPGTPDFFRVTSLALPNSQLLGSVSEDLGLIQYLRHIDLSNNFLNGSLPNTIFN  133

Query  596  ALGLESLVLYENYLSGPLP  652
            +  L+ L L  N +SG LP
Sbjct  134  SSQLQVLSLSNNVISGKLP  152



>ref|XP_002865012.1| hypothetical protein ARALYDRAFT_496872 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41271.1| hypothetical protein ARALYDRAFT_496872 [Arabidopsis lyrata subsp. 
lyrata]
Length=750

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            + ++ +   +FC+  A+  +LN +G  LL F+ SIVDDP   +  W   DETPCSW G+T
Sbjct  12   LSVITVLSFLFCDQSAL--ALNTDGVLLLSFRYSIVDDPLSVLRSWRLEDETPCSWRGVT  69

Query  446  CKD--QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            C +  + V +LS+P   L+G L S+LGSL+ L+ ++L +N +NGS P  L  A  L  L 
Sbjct  70   CDESSRHVTALSLPSSNLTGTLPSNLGSLNSLQRLDLSNNSINGSFPVSLLNATELRFLD  129

Query  620  LYENYLSGPLP  652
            L +N++SG LP
Sbjct  130  LSDNHISGELP  140



>ref|XP_006466547.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250-like [Citrus sinensis]
Length=791

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 8/132 (6%)
 Frame = +2

Query  281  LFILIFCNSQAVLS-SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK--  451
            L +L+F     V S  LN +G  LL FK S++ DP G +  WN +DE PCSWNG+TC   
Sbjct  15   LVVLVFICGVVVQSLGLNTDGVLLLSFKYSVLSDPLGVLGSWNYNDENPCSWNGVTCASP  74

Query  452  -----DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESL  616
                 D RV+ L++P  +L G + + LG +  L++++L +N LNGSL   LF A  L +L
Sbjct  75   GEGNNDSRVIGLALPNSQLLGSIPADLGMIEFLQYLDLSNNSLNGSLSFSLFNASQLRNL  134

Query  617  VLYENYLSGPLP  652
             L  N +SG LP
Sbjct  135  DLSNNLISGHLP  146



>gb|KDO79072.1| hypothetical protein CISIN_1g003847mg [Citrus sinensis]
Length=791

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 8/132 (6%)
 Frame = +2

Query  281  LFILIFCNSQAVLS-SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK--  451
            L +L+F     V S  LN +G  LL FK S++ DP G +  WN +DE PCSWNG+TC   
Sbjct  15   LVVLVFICGVVVQSLGLNTDGVLLLSFKYSVLSDPLGVLGSWNYNDENPCSWNGVTCASP  74

Query  452  -----DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESL  616
                 D RV+ L++P  +L G + + LG +  L++++L +N LNGSL   LF A  L +L
Sbjct  75   GEGNNDSRVIGLALPNSQLLGSIPADLGMIEFLQYLDLSNNSLNGSLSFSLFNASQLRNL  134

Query  617  VLYENYLSGPLP  652
             L  N +SG LP
Sbjct  135  DLSNNLISGHLP  146



>ref|NP_567961.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q94C77.1|RPKL_ARATH RecName: Full=Receptor protein kinase-like protein At4g34220; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59614.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAM44951.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59356.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE86343.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=757

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L LF  +F  +Q  L +LN +G  LL FK SI+ DP   + +WN  D TPC W G+TC +
Sbjct  12   LVLFHFLFVPTQ--LQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTE  69

Query  455  Q---------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
                      RV SL +P K L G ++  L S+  LR ++L SN  NGSLP  +F A  L
Sbjct  70   LGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATEL  129

Query  608  ESLVLYENYLSGPLP  652
            +S+ L  N LSG LP
Sbjct  130  QSISLGSNNLSGDLP  144



>ref|XP_008669759.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Zea mays]
 tpg|DAA38853.1| TPA: putative leucine-rich repat protein kinase family protein 
[Zea mays]
Length=744

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ------RVVSLSIPKKKls  496
            +G SLL FK ++ DDP  ++S W+ +D  PC W G+TC +       RVV +++  K LS
Sbjct  25   DGLSLLAFKSAVTDDPSMALSSWSDADADPCRWLGVTCVNSSSSDGLRVVGVAVAGKNLS  84

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G++ + LGSL+ LR +NL  NRL+G++P  L  A  L SL LY+N L+GP P
Sbjct  85   GYIPAELGSLAFLRRLNLHGNRLSGTVPAALANATALHSLFLYDNRLTGPFP  136



>emb|CAA17550.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 emb|CAB80139.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=980

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 76/135 (56%), Gaps = 11/135 (8%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L LF  +F  +Q  L +LN +G  LL FK SI+ DP   + +WN  D TPC W G+TC +
Sbjct  12   LVLFHFLFVPTQ--LQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTE  69

Query  455  Q---------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
                      RV SL +P K L G ++  L S+  LR ++L SN  NGSLP  +F A  L
Sbjct  70   LGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATEL  129

Query  608  ESLVLYENYLSGPLP  652
            +S+ L  N LSG LP
Sbjct  130  QSISLGSNNLSGDLP  144



>ref|XP_004972045.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Setaria italica]
Length=171

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 78/129 (60%), Gaps = 14/129 (11%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC-----  448
             +L+F  ++A++  LN  G++LL FK ++V DP G +++W+ +   PC+WNGI C     
Sbjct  25   LLLLFSTAKALM--LN--GQALLAFKAAVVQDPTGVLANWDATVADPCAWNGIACSSSSI  80

Query  449  ---KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGL-FRALGLESL  616
               + + VV+LS+PKK+      S+    S L H++L SN L G +PP L F A  L+SL
Sbjct  81   DATQPRGVVALSLPKKR-LVARLSAALLPSSLYHLHLCSNHLFGPVPPELIFGAPVLQSL  139

Query  617  VLYENYLSG  643
            VLY N L G
Sbjct  140  VLYGNALDG  148



>ref|XP_002307286.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE94282.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=773

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 79/137 (58%), Gaps = 15/137 (11%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSS--LNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            ILAL IL+      V+ S  LN +G  LL FK SI+DDP   +  WN SD+TPCSWNG+T
Sbjct  14   ILALGILLL-----VVQSFGLNTDGVLLLSFKYSILDDPLSVLQSWNHSDQTPCSWNGVT  68

Query  446  CKD--------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRAL  601
            C           RV  LS+P  +L G + ++LG +  L++++L  N LNGSLP  L  A 
Sbjct  69   CGSPGTDNTYYSRVTGLSLPNCQLLGTIPATLGLIQHLQNLDLSDNSLNGSLPVSLLNAT  128

Query  602  GLESLVLYENYLSGPLP  652
             L  L L  N +SG LP
Sbjct  129  QLRFLDLSSNMISGQLP  145



>ref|XP_003575565.2| PREDICTED: receptor protein kinase-like protein At4g34220 [Brachypodium 
distachyon]
Length=770

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 4/119 (3%)
 Frame = +2

Query  308  QAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRS--DETPCSWNGITCK-DQRVVSLSI  478
            QA  ++LN++G  LL FK S++ DP GS++ W  S  D TPC WNGI C  DQRV  + +
Sbjct  39   QAASAALNQDGALLLAFKSSLLADPLGSLAGWGASAADATPCGWNGIVCNSDQRVAGVIL  98

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPG-LFRALGLESLVLYENYLSGPLP  652
            P ++L G +S  L  L  LRH++L  N LNG++P   L RA  L  L L  N ++G LP
Sbjct  99   PNEQLVGPVSRDLAQLEHLRHLDLSGNALNGTVPADLLLRAPELRVLSLAGNGITGALP  157



>ref|XP_004500511.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase MRH1-like [Cicer arietinum]
Length=668

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 5/129 (4%)
 Frame = +2

Query  281  LFILIFC---NSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDW--NRSDETPCSWNGIT  445
            LF++ FC    S  +  SLN+EGK+LL FK+ IV DP  ++S+W  +  +  PC+W G+ 
Sbjct  16   LFLVSFCFLLQSFGLCCSLNDEGKALLKFKQGIVSDPFDALSNWVDDEVEVDPCNWFGVE  75

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C D RVV L++    L G L+  LGSL  ++ + LR+N  +G +P G+ R  GLE L L 
Sbjct  76   CSDGRVVVLNLKDLCLEGNLAHELGSLVHIKSIVLRNNSFHGIIPKGILRLKGLEVLDLG  135

Query  626  ENYLSGPLP  652
             N  SGPLP
Sbjct  136  YNNFSGPLP  144



>gb|KHG13399.1| hypothetical protein F383_10003 [Gossypium arboreum]
Length=785

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD---------QRVVSLS  475
            +LN +G  LL FK +I+ DP   +  WNR D+TPC+W G+TC +          RV SL 
Sbjct  25   ALNTDGVLLLSFKHAILSDPLSVLQSWNRDDKTPCAWTGVTCTEIGLPGTPDRLRVTSLV  84

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P   L G +S  LG +  LRH++L SN  NG LP  +F +  L+ L L  N +SG LP
Sbjct  85   LPNSHLHGSISEDLGHIQHLRHLDLSSNNFNGILPSSIFNSTELQVLSLSANLISGSLP  143



>ref|XP_010107888.1| Receptor protein kinase-like protein [Morus notabilis]
 gb|EXC17288.1| Receptor protein kinase-like protein [Morus notabilis]
Length=756

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 72/119 (61%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK SI+ DP  ++ +WN +D TPCSWNG+TC +          RV SL 
Sbjct  33   ALNSDGIFLLSFKYSILSDPLSALENWNYNDATPCSWNGVTCSELGFPGTHNMFRVTSLV  92

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G +S  LG +  LRH++L +N  NGSLP  +F A  L+ L L  N +SG LP
Sbjct  93   LPNSQLLGSISPDLGKIEHLRHLDLSNNFFNGSLPLSIFNASELQVLSLSNNVISGQLP  151



>ref|XP_002277291.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Vitis vinifera]
Length=640

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 3/126 (2%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            LA F++ F     + SSLN +G SLL  K +IV DP G +  W+ SD  PC W GI+C  
Sbjct  10   LASFLIFFT---CLSSSLNSDGLSLLALKAAIVSDPTGVLDTWSESDLVPCHWGGISCTH  66

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             RV  + +P +  +G++ S LG+L  LR ++L +N  +  +P  LF A  L SL L  N 
Sbjct  67   GRVTGVFLPNRSFTGYIPSELGALVNLRQLSLANNNFSKPIPSRLFNATTLLSLDLSHNS  126

Query  635  LSGPLP  652
            LSGPLP
Sbjct  127  LSGPLP  132



>emb|CBI29900.3| unnamed protein product [Vitis vinifera]
Length=739

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 3/126 (2%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            LA F++ F     + SSLN +G SLL  K +IV DP G +  W+ SD  PC W GI+C  
Sbjct  109  LASFLIFFT---CLSSSLNSDGLSLLALKAAIVSDPTGVLDTWSESDLVPCHWGGISCTH  165

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             RV  + +P +  +G++ S LG+L  LR ++L +N  +  +P  LF A  L SL L  N 
Sbjct  166  GRVTGVFLPNRSFTGYIPSELGALVNLRQLSLANNNFSKPIPSRLFNATTLLSLDLSHNS  225

Query  635  LSGPLP  652
            LSGPLP
Sbjct  226  LSGPLP  231



>gb|KDO59808.1| hypothetical protein CISIN_1g043706mg [Citrus sinensis]
Length=586

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = +2

Query  245  LQERVGKMVILALFILIFCNSQAVLS-SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDET  421
            LQ R      +   +  F     V S  LN +G  LL FK SI+ DP   + +WN  D T
Sbjct  5    LQNRQSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDAT  64

Query  422  PCSWNGITCKDQ------------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRL  565
            PCSW G+TC               RV+SL +P  +L G ++  LG +  LRH++L +N  
Sbjct  65   PCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFF  124

Query  566  NGSLPPGLFRALGLESLVLYENYLSGPLP  652
            NGSLP  +F A  L+ L L  N +SG LP
Sbjct  125  NGSLPLSIFSATELQVLSLSNNAISGELP  153



>ref|XP_004135515.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis sativus]
 gb|KGN51683.1| hypothetical protein Csa_5G590000 [Cucumis sativus]
Length=714

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSM-SDWNRSDETPCSWNGITC----KDQRVVSLSIPKK  487
            +L+ +G SLL  K ++   P+ S+ SDWN +D TPC W+GI+C     D RVV +++  K
Sbjct  27   ALSPDGLSLLSLKSAVDQSPDSSVFSDWNENDSTPCQWSGISCMNVSGDSRVVGIALSGK  86

Query  488  KlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             L G++ S LGSL  LR +NL +N L GS+P  LF A  L SL LY N LSGP P
Sbjct  87   NLRGYIPSELGSLVYLRRLNLHNNNLYGSIPEQLFNATSLHSLFLYSNNLSGPFP  141



>ref|XP_008236371.1| PREDICTED: receptor protein kinase-like protein At4g34220 [Prunus 
mume]
Length=781

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 13/136 (10%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            + ++F+L+  ++ A    LN +G  LL FK SI+ DP   +  WN +DETPCSWNG+TC 
Sbjct  14   VTSIFVLLLSSTLA----LNSDGVLLLSFKYSILSDPLSVLESWNYNDETPCSWNGVTCT  69

Query  452  DQ---------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALG  604
                       RV SL +P  +L G ++S LGS+  L  ++L +N  NGSLP  LF A  
Sbjct  70   QMGNPGTPDMFRVTSLVLPNSQLLGSIASELGSIEHLHSLDLSNNFFNGSLPLTLFNASE  129

Query  605  LESLVLYENYLSGPLP  652
            L+ L L  N +SG LP
Sbjct  130  LQVLSLSNNVISGDLP  145



>ref|XP_003518066.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=644

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L L +  F  S  +   LN +G SLL FK +I  DP G+++ W  +  TPC+W G+TCK 
Sbjct  6    LHLSLFFFLISLPLTLPLNSDGLSLLAFKAAISVDPTGALATWTDTSLTPCTWAGVTCKH  65

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
              V  L++P K L+G+L S LG L+ L+ ++L  N L+ ++P  LF A  L  L L  N 
Sbjct  66   NHVTQLTLPSKALTGYLPSELGFLAHLKRLSLPHNNLSHAIPTTLFNATTLLVLDLSHNA  125

Query  635  LSGPLP  652
            L+GPLP
Sbjct  126  LTGPLP  131



>ref|XP_012075793.1| PREDICTED: receptor protein kinase-like protein At4g34220 [Jatropha 
curcas]
 gb|KDP45891.1| hypothetical protein JCGZ_15451 [Jatropha curcas]
Length=776

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 76/135 (56%), Gaps = 9/135 (7%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L+  I++    +  + +LN +G  LL FK S + DP   + +WN  DE PCSWNG+TC +
Sbjct  11   LSFIIIVVSLVKVTVFALNTDGVLLLSFKYSTLSDPLSVLENWNYDDENPCSWNGVTCTE  70

Query  455  Q---------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
                      RV SL++P  +L G +   LG +  L+H++L +N LNGSLP   F +  L
Sbjct  71   LGLQGTPDMFRVTSLALPNSQLLGSIPPDLGFVQHLKHLDLSNNFLNGSLPFSFFNSTEL  130

Query  608  ESLVLYENYLSGPLP  652
            + L L  N +SG LP
Sbjct  131  QVLSLSGNEISGELP  145



>ref|XP_003554189.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=651

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 76/129 (59%), Gaps = 0/129 (0%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M  L +  LIF  +    +SLN +G SLL  K ++  DP G +S W+ +D TPC W G++
Sbjct  6    MHHLLISFLIFSLTPTPTTSLNSDGLSLLALKAAVDSDPTGVLSSWSETDGTPCHWPGVS  65

Query  446  CKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            C   +V  +S+P K LSG++ S LG L+ L+ ++L  N  + ++PP LF A  L  L L 
Sbjct  66   CSGDKVSQVSLPNKTLSGYIPSELGFLTSLKRLSLPHNNFSNAIPPSLFNATSLIVLDLS  125

Query  626  ENYLSGPLP  652
             N LSG LP
Sbjct  126  HNSLSGSLP  134



>ref|XP_002982402.1| hypothetical protein SELMODRAFT_116152 [Selaginella moellendorffii]
 gb|EFJ16647.1| hypothetical protein SELMODRAFT_116152 [Selaginella moellendorffii]
Length=1101

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 78/131 (60%), Gaps = 3/131 (2%)
 Frame = +2

Query  266  MVILALFILIFCNS--QAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNG  439
            +++LA  +  FC     A   S   +  +L+ FK ++ +DPEG+++ W  S   PCSW G
Sbjct  4    LLLLAFLVWGFCGELVAAQGGSAQSDIAALIAFKSNL-NDPEGALAQWINSTTAPCSWRG  62

Query  440  ITCKDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            I+C + RVV L +P  +L G +S  +G+L  LR ++L SNR NG++P  +   + L SLV
Sbjct  63   ISCLNNRVVELRLPGLELRGAISDEIGNLVGLRRLSLHSNRFNGTIPASIGNLVNLRSLV  122

Query  620  LYENYLSGPLP  652
            L  N  SGP+P
Sbjct  123  LGRNLFSGPIP  133



>ref|XP_002514942.1| protein with unknown function [Ricinus communis]
 gb|EEF47496.1| protein with unknown function [Ricinus communis]
Length=810

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 72/121 (60%), Gaps = 9/121 (7%)
 Frame = +2

Query  314  VLSSLNEEGKSLLIFKKSIVDDPEGS--MSDWNRSDETPCSWNGITC------KDQRVVS  469
            ++ SL+ +G SLL  K S VD P+G    SDWN  D TPC W GI+C       D RVV 
Sbjct  26   LIVSLSPDGLSLLSLK-SAVDQPDGDNPFSDWNEDDPTPCKWTGISCMNVTGFPDPRVVG  84

Query  470  LSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPL  649
            ++I  K L G++ S LG+L  LR +NL SN   GS+P  LF A  L SL LY N LSG L
Sbjct  85   IAISGKNLRGYIPSELGTLLYLRRLNLHSNNFYGSIPADLFNATSLHSLFLYGNNLSGSL  144

Query  650  P  652
            P
Sbjct  145  P  145



>ref|XP_006422938.1| hypothetical protein CICLE_v10027853mg [Citrus clementina]
 gb|ESR36178.1| hypothetical protein CICLE_v10027853mg [Citrus clementina]
Length=792

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = +2

Query  245  LQERVGKMVILALFILIFCNSQAVLS-SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDET  421
            LQ R      +   +  F     V S  LN +G  LL FK SI+ DP   + +WN  D T
Sbjct  5    LQNRQSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDAT  64

Query  422  PCSWNGITCKDQ------------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRL  565
            PCSW G+TC               RV+SL +P  +L G ++  LG +  LRH++L +N  
Sbjct  65   PCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFF  124

Query  566  NGSLPPGLFRALGLESLVLYENYLSGPLP  652
            NGSLP  +F A  L+ L L  N +SG LP
Sbjct  125  NGSLPLSIFSATELQVLSLSNNAISGELP  153



>gb|KJB30948.1| hypothetical protein B456_005G169100 [Gossypium raimondii]
Length=716

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 9/118 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGS--MSDWNRSDETPCSWNGITCK------DQRVVSLSI  478
            SL+ +G SLL  K S VD P G    +DWN +DETPC+W+G++CK      D RVV +++
Sbjct  23   SLSPDGLSLLSLK-SAVDQPSGHSVFADWNETDETPCNWSGVSCKNISGFPDPRVVGVAV  81

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
              K L G++ S LG+L  LR +NL +N   GS+P  LF A  L SL LY N LSG LP
Sbjct  82   SAKNLRGYIPSELGNLIYLRRLNLHNNFFYGSIPDQLFNATSLHSLFLYGNNLSGSLP  139



>ref|XP_010447118.1| PREDICTED: receptor protein kinase-like protein At4g34220 [Camelina 
sativa]
Length=755

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 77/135 (57%), Gaps = 11/135 (8%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L LF L+   +Q  L SLN +G  LL FK SI+ DP   + +WN  D +PC W G+TC +
Sbjct  12   LVLFHLLLVPTQ--LQSLNTDGVLLLAFKYSILSDPLSVLRNWNYEDASPCLWTGVTCME  69

Query  455  ---------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
                      RV SL++P K LSG ++  L  L  LR ++L +N  NGSLP  LF A  L
Sbjct  70   LGKPNTPDTLRVTSLALPNKNLSGSVTPDLFFLPHLRILDLSTNFFNGSLPDSLFNATEL  129

Query  608  ESLVLYENYLSGPLP  652
            +++ L  N LSG LP
Sbjct  130  QNISLGSNNLSGDLP  144



>emb|CDP13327.1| unnamed protein product [Coffea canephora]
Length=718

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 80/142 (56%), Gaps = 14/142 (10%)
 Frame = +2

Query  266  MVILALFILIFCNS--QAVL-----SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETP  424
            M +L +F+LI  +     VL     +SL  +G SLL  K S +D    +++DWN  D TP
Sbjct  1    MPVLRIFLLIVISVVFHVVLQLKRANSLTADGLSLLSLK-SAIDGGGSALTDWNEDDATP  59

Query  425  CSWNGITC------KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPG  586
            C W GI+C       D RVV +++  K L G++ S LG+L  LR +NL  N   GS+P  
Sbjct  60   CHWTGISCMNISGSNDPRVVGITVSGKNLRGYIPSELGTLIYLRRLNLHGNNFYGSIPDQ  119

Query  587  LFRALGLESLVLYENYLSGPLP  652
            LF A  L SL LY N LSGPLP
Sbjct  120  LFNASSLHSLFLYGNNLSGPLP  141



>ref|XP_009403261.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Musa acuminata subsp. malaccensis]
Length=662

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgflsss  514
            +G +LL  K ++ DDP G+++ W  SD +PC+W G+TC+  RV  L++P + LSG++ S 
Sbjct  41   DGLALLALKSAVTDDPTGALAAWLDSDASPCAWTGVTCRRGRVADLALPNRALSGYIPSE  100

Query  515  lgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            L  LS L+ + L  NRL+G +P  L    GL  L L  N LSGP+P
Sbjct  101  LSFLSALQSLALPGNRLSGPVPAALSAVGGLAELDLSRNNLSGPIP  146



>ref|XP_007042520.1| Interleukin-1 receptor-associated kinase, putative [Theobroma 
cacao]
 gb|EOX98351.1| Interleukin-1 receptor-associated kinase, putative [Theobroma 
cacao]
Length=781

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 68/117 (58%), Gaps = 9/117 (8%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLSIP  481
            N +G  LL FK SI+ DP   +  WN  DETPC+WNG+TC +          RV SL +P
Sbjct  28   NTDGVLLLSFKYSILSDPLSILRSWNYDDETPCAWNGVTCTELGIPGTPDMFRVTSLVLP  87

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
               L G +S+ LG +  LRH++L SN  NG+LP  +F +  L+ L L  N +SG LP
Sbjct  88   NSHLLGSISADLGHIQYLRHLDLSSNLFNGTLPSSIFNSTELQVLSLSGNVISGELP  144



>ref|XP_006487009.1| PREDICTED: receptor protein kinase-like protein At4g34220-like 
[Citrus sinensis]
Length=792

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 74/146 (51%), Gaps = 16/146 (11%)
 Frame = +2

Query  251  ERVGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCS  430
            E     ++ A F L    S      LN +G  LL FK SI+ DP   + +WN  D TPCS
Sbjct  12   EGTMSFILFAFFFLHLVPSFG----LNTDGILLLSFKYSILSDPLSVLENWNYDDATPCS  67

Query  431  WNGITCKDQ------------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGS  574
            W G+TC               RV SL +P  +L G ++  LG +  LRH++L +N  NGS
Sbjct  68   WTGVTCTQIDTTTIPGSPDMFRVTSLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGS  127

Query  575  LPPGLFRALGLESLVLYENYLSGPLP  652
            LP  +F A  L+ L L  N +SG LP
Sbjct  128  LPLSIFNATELQVLSLSNNAISGELP  153



>gb|EYU37634.1| hypothetical protein MIMGU_mgv1a001644mg [Erythranthe guttata]
Length=779

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 77/139 (55%), Gaps = 10/139 (7%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            M I  LF L F    +    LN +G  LL FK SI+DDP   + +WN +D TPC W G+T
Sbjct  6    MHICTLFPLFFLVLVSPAFGLNFDGSLLLSFKYSIIDDPLSVLDNWNYNDATPCLWTGVT  65

Query  446  CKDQ----------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFR  595
            C +           RVV L++P  +L G + + LG +  L+ ++L SN LNG+LP  LF 
Sbjct  66   CAEVQNSIGVPDMFRVVGLTLPNFQLLGVIPAYLGFIPHLKKLDLSSNFLNGTLPISLFN  125

Query  596  ALGLESLVLYENYLSGPLP  652
            A  LE L L  N +SG +P
Sbjct  126  ASELEVLSLSNNAISGTIP  144



>dbj|BAJ94587.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=755

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD----QRVVSLSIPKKKls  496
             ++G +LL FK ++ DDP   +S W+ SD  PC W G+TC +     RVV L++  K ++
Sbjct  26   TDDGLALLAFKAAVTDDPASVLSKWSESDADPCRWPGVTCANISSQPRVVGLAVAGKNVA  85

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G++ S LGSL  LR +NL  NRL G +P  L  A  L S+ LY N L+G LP
Sbjct  86   GYIPSELGSLLFLRRLNLHDNRLTGGIPAALSNASSLHSIFLYNNALTGKLP  137



>ref|XP_010444672.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Camelina sativa]
Length=758

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
             +I  LF    C+  +   +L+ +G  LL F+ SIVDDP   +  W   DETPCSW G+T
Sbjct  19   FLITVLFFFFLCDRSS--HALSTDGVLLLSFRYSIVDDPLSVLRSWRFEDETPCSWRGVT  76

Query  446  C--KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            C    + V  LS+P  KLSG L S+LGSLS L+ ++L +N +NGS P  L  A  L  L 
Sbjct  77   CDVSSRHVTVLSLPSSKLSGTLPSNLGSLSSLQRLDLSNNYINGSFPVSLLNATELRFLD  136

Query  620  LYENYLSGPLP  652
            L +N++SG LP
Sbjct  137  LSDNHISGELP  147



>ref|XP_011071213.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Sesamum indicum]
Length=693

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 75/138 (54%), Gaps = 8/138 (6%)
 Frame = +2

Query  257  VGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWN  436
            V K+ + A  +L FC       SLN +G SLL  K ++  +   + SDWN  D TPC W 
Sbjct  3    VHKLHLSAFLLLNFCLHIHSGVSLNPDGLSLLSLKSAV--EEAAAFSDWNEDDATPCQWT  60

Query  437  GITCK------DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRA  598
            GI+C       D RVV +S   K L G++ S LGSL  LR +NL  N   GS+P  LF A
Sbjct  61   GISCANISGSDDPRVVGISAGGKNLRGYIPSELGSLIYLRRLNLHGNNFYGSIPDQLFNA  120

Query  599  LGLESLVLYENYLSGPLP  652
              L S+ LY N LSG LP
Sbjct  121  SSLHSIFLYGNNLSGSLP  138



>ref|XP_004239201.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Solanum lycopersicum]
Length=717

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 10/132 (8%)
 Frame = +2

Query  284  FILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS---MSDWNRSDETPCSWNGITCK-  451
            F L+  N    +S L  +G SLL  K ++ D   G+    SDWN +D+TPC+W+GI+C  
Sbjct  7    FFLVLLNFHTGIS-LTSDGLSLLSLKSAMDDGGGGTDNVFSDWNENDDTPCTWSGISCAN  65

Query  452  -----DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESL  616
                 +QRVV +++  K L G+L S LG+L  LR +NL  N + GS+P  LF A  L S+
Sbjct  66   ISGSSEQRVVGITLSGKNLRGYLPSELGTLLYLRRLNLHGNNIYGSIPDPLFNATSLHSI  125

Query  617  VLYENYLSGPLP  652
             LY+N +SG LP
Sbjct  126  YLYDNNISGTLP  137



>gb|KHG08504.1| hypothetical protein F383_35684 [Gossypium arboreum]
Length=716

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 9/118 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGS--MSDWNRSDETPCSWNGITCK------DQRVVSLSI  478
            SL+ +G SLL  K S VD P G    +DWN +DETPC+W+G++CK      D RVV +++
Sbjct  23   SLSPDGLSLLSLK-SAVDQPSGQSVFADWNENDETPCNWSGVSCKNISGFPDPRVVGVAV  81

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
              K L G++ S LG+L  LR +NL +N   GS+P  LF A  L SL LY N LSG LP
Sbjct  82   SGKNLRGYIPSELGNLIYLRRLNLHNNFFYGSIPDQLFNATSLHSLFLYGNNLSGSLP  139



>ref|XP_009800742.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana sylvestris]
Length=717

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 9/138 (7%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLS---SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWN  436
            M+ +++  L F N Q  +    SL  +G SLL  K ++ D      SDWN +D+TPC W 
Sbjct  1    MLRISVLFLCFLNFQLFMHTGVSLTSDGLSLLSLKSAMDDGGGTVFSDWNENDDTPCRWT  60

Query  437  GITCK------DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRA  598
            GI+C       + RVV +++  K L G+L S LG+L  LR +NL  N + GS+P  LF A
Sbjct  61   GISCANISGSSEPRVVGITVSGKNLRGYLPSELGTLVYLRRLNLHGNNIYGSIPDPLFNA  120

Query  599  LGLESLVLYENYLSGPLP  652
              L S+ LY+N +SG LP
Sbjct  121  TSLHSIFLYDNNISGQLP  138



>gb|KJB47371.1| hypothetical protein B456_008G023200 [Gossypium raimondii]
 gb|KJB47372.1| hypothetical protein B456_008G023200 [Gossypium raimondii]
Length=782

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 75/135 (56%), Gaps = 11/135 (8%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
             +  +L+F    ++  +LN +G  LL FK +I+ DP   +  WNR D+TPC+W G+TC +
Sbjct  11   FSFLLLVFLMVPSL--ALNTDGVLLLSFKHAILSDPLSVLQSWNRDDKTPCAWTGVTCTE  68

Query  455  ---------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
                      RV SL +P   L G +S  LG +  L H++L SN  NG+LP  +F +  L
Sbjct  69   IGLPGTPDRLRVTSLVLPNSHLHGSISEDLGHIQHLSHLDLSSNSFNGTLPSSIFNSTEL  128

Query  608  ESLVLYENYLSGPLP  652
            + L L  N +SG LP
Sbjct  129  QVLSLSGNLISGSLP  143



>ref|XP_006605973.1| PREDICTED: receptor protein kinase-like protein At4g34220-like 
[Glycine max]
Length=775

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 9/121 (7%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVS  469
            ++ LN +G  LL FK SI+ DP   + +WN  D TPCSW+G+ C +          RV S
Sbjct  30   VTPLNSDGIHLLKFKYSILSDPLSVLKNWNYDDVTPCSWHGVACSEIGAPGTPDFFRVTS  89

Query  470  LSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPL  649
            L++P  +L G +S  LG +  LRH++L +N LNGSLP  +F +  L+ L L  N +SG L
Sbjct  90   LALPNSQLLGSISEDLGLIQYLRHIDLSNNFLNGSLPNTIFNSSQLQVLSLSNNVISGEL  149

Query  650  P  652
            P
Sbjct  150  P  150



>ref|XP_009372312.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Pyrus x bretschneideri]
Length=717

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 77/135 (57%), Gaps = 9/135 (7%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGIT  445
            +  AL  L+F     +  SL  +G SLL  K ++    +GS  SDW  +D TPC W GI+
Sbjct  5    IFSALIFLLFLVDTTL--SLTPDGLSLLSLKSAVDQSSDGSAFSDWLDTDPTPCRWTGIS  62

Query  446  C------KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGL  607
            C       D RVV +++  K L G++ S LG+L  LR +NL SN  +GS+P  LF A  L
Sbjct  63   CMNITGFSDPRVVGIALSGKNLRGYIPSELGTLVYLRRLNLHSNNFHGSIPSQLFNATSL  122

Query  608  ESLVLYENYLSGPLP  652
             SL LY N LSGPLP
Sbjct  123  HSLFLYGNNLSGPLP  137



>ref|XP_010271084.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Nelumbo nucifera]
Length=784

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 68/118 (58%), Gaps = 9/118 (8%)
 Frame = +2

Query  326  LNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK---------DQRVVSLSI  478
            LN +G  LL FK S++ DP  ++  WN  D+ PCSWNGITC            RV SL++
Sbjct  29   LNADGVLLLSFKYSVLSDPLSALQSWNYEDQAPCSWNGITCTRFAMPGTGDTLRVTSLAL  88

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            P  +L G     LG L  L++++L +N LNGSLP  LF A  L +L L  N +SG LP
Sbjct  89   PNCQLLGTTPPELGMLEHLQYLDLSNNLLNGSLPASLFNASELRTLSLSNNVISGALP  146



>dbj|BAJ88818.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD----QRVVSLSIPKKKls  496
             ++G +LL FK ++ DDP   +S W+ SD  PC W G+TC +     RVV L++  K ++
Sbjct  26   TDDGLALLAFKAAVTDDPASVLSKWSESDADPCRWPGVTCANISSQPRVVGLAVAGKNVA  85

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLPF  655
            G++ S LGSL  LR +NL  NRL G +P  L  +  L S+ LY N L+G LP 
Sbjct  86   GYIPSELGSLLFLRRLNLHDNRLTGGIPAALSNSSSLHSIFLYNNALTGKLPV  138



>ref|XP_008462844.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Cucumis melo]
Length=753

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = +2

Query  326  LNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-----RVVSLSIPKKK  490
            LN +G  LL FK S++DDP   + +WN SDETPC W G+ C D      RV  LS+P  +
Sbjct  25   LNFDGVLLLSFKYSVLDDPLFVLQNWNYSDETPCLWQGVQCSDNGSGGSRVTGLSLPNSQ  84

Query  491  lsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            L G +SS LG +  L+ V+L +N  NGSLP  LF A  L  L L +N +SG +P
Sbjct  85   LMGSVSSDLGLIQNLQTVDLSNNSFNGSLPQSLFNATMLRFLDLSDNLISGEVP  138



>ref|XP_002323301.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF05062.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=652

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            + A  IL    +  +LSSLN +G +LL  K +I  DP  +++ W+ +D TPC W+GITC 
Sbjct  8    VTACLILFTFTNLPLLSSLNTDGLALLALKAAITADPTDTLASWSETDPTPCHWHGITCI  67

Query  452  DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
            + RV SLS+P K  +G++   LG L  L  + L  N  + S+P  LF A  L  L L  N
Sbjct  68   NDRVTSLSLPDKNFTGYIPFELGLLGSLTRLTLSRNNFSKSIPSHLFNATTLRFLDLSHN  127

Query  632  YLSGPLP  652
             LSGP+P
Sbjct  128  SLSGPIP  134



>ref|XP_006576844.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Glycine max]
Length=647

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKls  496
            ++SLN +G SLL  K ++  DP G ++ W+ +D TPC W GI+C   +V  LS+P+K L+
Sbjct  20   MTSLNSDGLSLLALKAAVDADPTGVLTSWSETDVTPCHWPGISCTGDKVTQLSLPRKNLT  79

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G++ S LG L+ L+ ++L  N  + ++PP LF A  L  L L  N LSG LP
Sbjct  80   GYIPSELGFLTSLKRLSLPYNNFSNAIPPSLFNARSLIVLDLSHNSLSGSLP  131



>ref|XP_010432446.1| PREDICTED: receptor protein kinase-like protein At4g34220 isoform 
X1 [Camelina sativa]
Length=755

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 76/133 (57%), Gaps = 11/133 (8%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD--  454
            LF LI   +Q  L +LN +G  LL FK SI+ DP   + +WN  D TPC W G+TC +  
Sbjct  14   LFHLILVPTQ--LQALNTDGVLLLAFKYSILSDPLSVLRNWNYEDATPCLWTGVTCTELG  71

Query  455  -------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
                    RV SL +P K LSG ++  L SL  LR ++L +N  NGSLP  +F A  L++
Sbjct  72   KPNTPDTLRVTSLVLPNKNLSGSVTPDLFSLPHLRILDLSTNFFNGSLPDSVFNATELQN  131

Query  614  LVLYENYLSGPLP  652
            + L  N LSG LP
Sbjct  132  ISLGSNNLSGDLP  144



>ref|XP_009394541.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Musa acuminata subsp. malaccensis]
Length=781

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 68/120 (57%), Gaps = 13/120 (11%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC-------------KDQRVVS  469
            N++G  LL FK S++ DP  ++ DWN  D +PCSWNG+ C                RV+ 
Sbjct  27   NQDGVLLLQFKYSVLSDPLTALGDWNYDDASPCSWNGVVCMGLPEESTGAQASTTSRVIG  86

Query  470  LSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPL  649
            L +P  +L G +   LG +  LRH++L  N LNG+LPP +F A  L+ L L +N +SG L
Sbjct  87   LVLPDSQLVGSIPPELGLVEHLRHLDLSGNALNGTLPPSIFNASELQVLSLADNAISGEL  146



>ref|XP_010432447.1| PREDICTED: receptor protein kinase-like protein At4g34220 isoform 
X2 [Camelina sativa]
Length=750

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 76/133 (57%), Gaps = 11/133 (8%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD--  454
            LF LI   +Q  L +LN +G  LL FK SI+ DP   + +WN  D TPC W G+TC +  
Sbjct  14   LFHLILVPTQ--LQALNTDGVLLLAFKYSILSDPLSVLRNWNYEDATPCLWTGVTCTELG  71

Query  455  -------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
                    RV SL +P K LSG ++  L SL  LR ++L +N  NGSLP  +F A  L++
Sbjct  72   KPNTPDTLRVTSLVLPNKNLSGSVTPDLFSLPHLRILDLSTNFFNGSLPDSVFNATELQN  131

Query  614  LVLYENYLSGPLP  652
            + L  N LSG LP
Sbjct  132  ISLGSNNLSGDLP  144



>ref|XP_007199418.1| hypothetical protein PRUPE_ppa026375mg, partial [Prunus persica]
 gb|EMJ00617.1| hypothetical protein PRUPE_ppa026375mg, partial [Prunus persica]
Length=758

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK SI+ DP   +  WN +DETPCSWNG+TC            RV SL 
Sbjct  4    ALNSDGVLLLSFKYSILSDPLSVLESWNYNDETPCSWNGVTCTQMGNPGTPDMFRVTSLV  63

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G ++S LGS+  L  ++L +N  NGSLP  LF A  L+ L L  N +SG LP
Sbjct  64   LPNSQLLGSIASELGSIEHLHSLDLSNNFFNGSLPLTLFNASELQVLSLSNNVISGDLP  122



>ref|XP_009396270.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Musa acuminata subsp. malaccensis]
Length=847

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 11/119 (9%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD-----------QRVVSLS  475
            N++G  LL FK S++ DP  ++ DWN  D TPCSWNG+ C              RV+ L 
Sbjct  84   NQDGALLLRFKYSVLSDPLAALRDWNYDDATPCSWNGVVCTGFPDGGAPTLAASRVIGLV  143

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G +   LG +  LRH++L  N LNG+LP  +F A  L  L L  N +SG LP
Sbjct  144  LPNSQLLGCVPPELGFIEHLRHLDLSGNDLNGTLPASIFNASELRVLSLAANEISGGLP  202



>ref|XP_011033271.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Populus euphratica]
Length=654

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            + A  IL    +  +LSSLN +G +LL  K +I  DP  +++ W+ +D TPC W+GITC 
Sbjct  8    VTACLILFTFTNLPLLSSLNTDGLALLALKAAITADPMDTLASWSETDPTPCHWHGITCI  67

Query  452  DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYEN  631
            + RV SLS+P K  +G++   LG L  L  + L  N  + S+P  LF A  L  L L  N
Sbjct  68   NDRVTSLSLPDKNFTGYIPFELGLLGSLTRLTLSRNNFSKSIPSHLFNATTLRFLDLSHN  127

Query  632  YLSGPLP  652
             LSGP+P
Sbjct  128  SLSGPIP  134



>ref|XP_003578742.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Brachypodium distachyon]
Length=784

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 70/119 (59%), Gaps = 11/119 (9%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD-----------QRVVSLS  475
              +G +LL FK ++ +DP  ++S W+ SD  PC W+G+TC +            RVV L+
Sbjct  29   TADGLALLAFKAAVTEDPTSALSSWSESDADPCRWSGVTCANISSAQPQQPPQPRVVGLA  88

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +  K +SG++ S LGSL  LR +NL  NRL G++P  L  A  L SL LY N L+G LP
Sbjct  89   VAGKNVSGYIPSELGSLLFLRRLNLHDNRLTGAIPAALSNASSLHSLFLYNNALTGVLP  147



>ref|NP_001169295.1| uncharacterized LOC100383159 precursor [Zea mays]
 gb|ACN33314.1| unknown [Zea mays]
 gb|AFW56719.1| putative leucine-rich repat protein kinase family protein [Zea 
mays]
Length=755

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 68/115 (59%), Gaps = 9/115 (8%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD---------QRVVSLSIPKK  487
            EG +LL FK +  DDP  ++S W+ SD+ PC W G+ C +          RVV L++  K
Sbjct  24   EGLALLTFKAAATDDPHSALSRWSESDQDPCRWPGVICANASSSAPSAAPRVVGLAVAGK  83

Query  488  KlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             +SG++ S LGSL  LR +NL  NRL+G +P  L  A  L SL LY N L+G LP
Sbjct  84   NISGYIPSELGSLLFLRRLNLHGNRLSGVIPAALSNASSLHSLYLYGNRLTGGLP  138



>gb|ABR16672.1| unknown [Picea sitchensis]
Length=514

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 82/131 (63%), Gaps = 8/131 (6%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            MV++   IL  C      SS+++EG +LL FK +I DDP   +S+WN  DE PC+W+GI 
Sbjct  7    MVVVCGAILQGC------SSISDEGLALLAFKDAIYDDPNAVLSNWNALDEQPCNWSGIN  60

Query  446  C--KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            C      V +L++P+  L GFL+  LG L+ L+ +NLR+N + G++P  L R   L++L 
Sbjct  61   CSPSGTSVQALNLPRSSLKGFLAPELGLLASLQTLNLRANNILGAIPRELGRLKNLQNLD  120

Query  620  LYENYLSGPLP  652
            L +N L+G +P
Sbjct  121  LAQNQLTGAIP  131



>ref|XP_011099092.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Sesamum indicum]
Length=782

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = +2

Query  350  LIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ-------RVVSLSIPKKKlsgfls  508
            + FK S++ DP G +  WN +DETPCSWNG+TC          RV  LS+P   L G + 
Sbjct  39   MSFKYSVLSDPFGVLQGWNYNDETPCSWNGVTCGTPGSDDAYFRVTGLSLPDSGLLGSVP  98

Query  509  sslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            ++LG +  LR +NL +N +NGS+PP LF A  L+ L    N +SG LP
Sbjct  99   ATLGMIEHLRSLNLSNNSINGSIPPSLFNASKLQVLDFSNNLISGGLP  146



>ref|XP_006412255.1| hypothetical protein EUTSA_v10024498mg [Eutrema salsugineum]
 gb|ESQ53708.1| hypothetical protein EUTSA_v10024498mg [Eutrema salsugineum]
Length=754

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVS  469
            L +LN +G  LL FK SI+ DP   + +WN  DETPC W G+TC +          RV S
Sbjct  23   LQALNTDGVLLLSFKYSILSDPLSVLRNWNYDDETPCLWTGVTCTELGKPNTPDMFRVTS  82

Query  470  LSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPL  649
            L +P K+L G ++  L S+  +R+++L SN  NGSLP  +F A  L  + L  N LSG L
Sbjct  83   LVLPNKQLLGSVTPDLFSIPHIRNLDLSSNFFNGSLPDSVFNATELRVISLGSNSLSGDL  142

Query  650  P  652
            P
Sbjct  143  P  143



>ref|XP_008340196.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At1g66830 [Malus domestica]
Length=717

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 75/132 (57%), Gaps = 9/132 (7%)
 Frame = +2

Query  278  ALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGITC--  448
            AL  L+F     +  SL  +G SLL  K ++    +GS  SDW  +D TPC W GI+C  
Sbjct  8    ALIFLLFLVDTTL--SLTPDGLSLLSLKSAVDQSSDGSAFSDWLDTDPTPCRWTGISCMN  65

Query  449  ----KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESL  616
                 D RVV +++  K L G++ S LG+L  LR +NL SN   GS+P  LF A  L SL
Sbjct  66   ITGFSDPRVVGITLSGKNLRGYIPSELGTLVYLRRLNLHSNNFRGSIPSQLFNATSLHSL  125

Query  617  VLYENYLSGPLP  652
             LY N LSGPLP
Sbjct  126  FLYGNNLSGPLP  137



>ref|XP_003550036.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250-like [Glycine max]
Length=761

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            +I++L IL+   +Q    +L+ +G  LL FK ++++DP   +++WN SDETPCSWNG++C
Sbjct  8    LIISLVILLVTVNQCC--ALSRDGVLLLSFKYAVLNDPLYVLANWNYSDETPCSWNGVSC  65

Query  449  KDQ-RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
             ++ RV SL +P  +  G + S LGS+  L+ ++L +N LNGSLP  L +A  L  L L 
Sbjct  66   SNENRVTSLLLPNSQFLGSVPSDLGSIEHLQILDLSNNSLNGSLPSSLSQASELRFLNLS  125

Query  626  ENYLSGPLP  652
             N ++G +P
Sbjct  126  NNLITGEVP  134



>gb|KHN27071.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=762

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            +I++L IL+   +Q    +L+ +G  LL FK ++++DP   +++WN SDETPCSWNG++C
Sbjct  8    LIISLVILLVTVNQCC--ALSRDGVLLLSFKYAVLNDPLYVLANWNYSDETPCSWNGVSC  65

Query  449  KDQ-RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
             ++ RV SL +P  +  G + S LGS+  L+ ++L +N LNGSLP  L +A  L  L L 
Sbjct  66   SNENRVTSLLLPNSQFLGSVPSDLGSIEHLQILDLSNNSLNGSLPSSLSQASELRFLNLS  125

Query  626  ENYLSGPLP  652
             N ++G +P
Sbjct  126  NNLITGEVP  134



>gb|EYU42102.1| hypothetical protein MIMGU_mgv1a001951mg [Erythranthe guttata]
Length=734

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 71/131 (54%), Gaps = 6/131 (5%)
 Frame = +2

Query  278  ALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC---  448
            A  +L  C       SLN +G SLL  K ++      ++SDWN  D TPC W+GI+C   
Sbjct  12   AFLLLNLCLQINSGVSLNPDGLSLLSLKSAVDAATSAALSDWNEDDATPCRWSGISCMNI  71

Query  449  ---KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
                D RVV +S+  K L G++ S LG+L  LR +N   N   GS+P  LF A  L S+ 
Sbjct  72   SGSDDPRVVGISVAAKNLHGYIPSELGNLIYLRRLNFHGNSFYGSIPDQLFNASSLHSIF  131

Query  620  LYENYLSGPLP  652
            LY N LSG LP
Sbjct  132  LYGNNLSGSLP  142



>ref|XP_011035108.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 isoform X2 [Populus euphratica]
Length=658

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (57%), Gaps = 10/139 (7%)
 Frame = +2

Query  257  VGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWN  436
            V + V L  FI+ +        S+N+EG +LL FK+S+VD    S+ +WN SD  PCSW 
Sbjct  2    VLQFVSLVFFIVHYI---TFAGSVNDEGLALLSFKQSLVDSTTRSLDNWNSSDANPCSWY  58

Query  437  GITCKDQRVVSLSIPKKKlsgflssslgsl-------sqlRHVNLRSNRLNGSLPPGLFR  595
            G+TC++++V  L +P K L+G L    G++         L+ ++L  N  NGSLP  L +
Sbjct  59   GVTCREEKVFFLRLPNKGLAGMLQLDTGTVPEEIRNLKNLQTLDLSQNSFNGSLPSYLIQ  118

Query  596  ALGLESLVLYENYLSGPLP  652
               L++LVL  N  +G LP
Sbjct  119  CKRLKNLVLSRNIFTGFLP  137



>ref|XP_002966565.1| hypothetical protein SELMODRAFT_407578 [Selaginella moellendorffii]
 gb|EFJ32592.1| hypothetical protein SELMODRAFT_407578 [Selaginella moellendorffii]
Length=1038

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 67/107 (63%), Gaps = 0/107 (0%)
 Frame = +2

Query  332  EEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQRVVSLSIPKKKlsgflss  511
            E   + LI  KS ++DPEG+++ W  S   PCSW GI+C + RVV L +P  +L G +S 
Sbjct  27   ESDIAALIAFKSNLNDPEGALAQWINSTTAPCSWRGISCLNNRVVELRLPGLELRGAISD  86

Query  512  slgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             +G+L  LR ++L SNR NG++P  +   + L SLVL  N  SGP+P
Sbjct  87   EIGNLVGLRRLSLHSNRFNGTIPASIGNLVNLRSLVLGRNLFSGPIP  133



>gb|KCW61968.1| hypothetical protein EUGRSUZ_H04654 [Eucalyptus grandis]
Length=636

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 69/117 (59%), Gaps = 12/117 (10%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMS---DWNRSDETPCSWNGITCK--------DQRVVSLSIP  481
            +G SLL  K S VD+P G+ S   DWN  D TPC W G++C         D RVV L++ 
Sbjct  29   DGLSLLSLK-SAVDEPPGAASAFADWNEDDPTPCRWTGVSCANVSANSSDDPRVVGLAVS  87

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             K L G++ S LG+L  LR +NL  N L+G +P  LF A  L SL LY N LSGPLP
Sbjct  88   GKGLRGYIPSELGTLLYLRRLNLHGNDLSGPIPDPLFNATSLHSLFLYGNNLSGPLP  144



>ref|XP_006361554.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830-like [Solanum tuberosum]
Length=716

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 82/133 (62%), Gaps = 8/133 (6%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSM-SDWNRSDETPCSWNGITCK  451
            +++F+++  NS      L  +G SLL  K ++ D   G++ SDWN +D+TPC+W GI+C 
Sbjct  5    ISVFLVLLLNSHTGFC-LTSDGLSLLSLKSAMDDGGGGTVFSDWNENDDTPCTWTGISCA  63

Query  452  ------DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
                  + RVV +++  K L G+LSS LG+L  LR +NL  N + GS+P  LF A  L S
Sbjct  64   NISGSSEPRVVGITLSGKNLRGYLSSELGTLLYLRRLNLHGNNIYGSIPDPLFNATSLHS  123

Query  614  LVLYENYLSGPLP  652
            + LY+N +SG LP
Sbjct  124  IYLYDNNISGILP  136



>ref|XP_010244265.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Nelumbo nucifera]
Length=782

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 14/142 (10%)
 Frame = +2

Query  254  RVGKMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSW  433
            RV ++  L   +L F   Q++   LN +G  LL FK S++ DP   +  WN  D+TPCSW
Sbjct  13   RVWRLTPLVFLLLAF---QSL--GLNTDGILLLSFKYSVLSDPLSVLESWNYEDQTPCSW  67

Query  434  NGITCK---------DQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPG  586
            NGITC            RV  L +P  +L G +   LG L  L+H++L +N LNGSLP  
Sbjct  68   NGITCAGFGIPGTGDTFRVTRLHLPDSQLLGSIPPDLGMLEHLQHLDLSNNFLNGSLPTT  127

Query  587  LFRALGLESLVLYENYLSGPLP  652
            LF +  L  L L  N +SG LP
Sbjct  128  LFNSSELRILSLSNNVISGALP  149



>emb|CDY01423.1| BnaA07g11960D [Brassica napus]
Length=1063

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            +    +L+ C+      +LN +G  LL F+ SI+DDP   +  W   DETPCSW G+TC 
Sbjct  12   LFVFTVLLLCDQSL---ALNTDGVLLLSFRYSILDDPLSVLRSWRLEDETPCSWRGVTCD  68

Query  452  D--QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
            +  + V  LS+P  KL+G L S+LGSL  L+ ++L +N +NGS P  L  A  L  L L 
Sbjct  69   ESSRHVTVLSLPSSKLAGTLPSNLGSLPSLQKLDLSNNSINGSFPASLLNATELRFLDLS  128

Query  626  ENYLSGPLP  652
             N++SG LP
Sbjct  129  RNHISGELP  137



>ref|XP_012079309.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Jatropha curcas]
 gb|KDP31995.1| hypothetical protein JCGZ_12456 [Jatropha curcas]
Length=765

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +2

Query  326  LNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ----RVVSLSIPKKKl  493
            LN +G  LL FK SI+DDP   +  WN  DETPCSWNG++C        V  LS+P  +L
Sbjct  23   LNTDGILLLSFKFSILDDPLHVLQTWNFYDETPCSWNGVSCSLDNSFPHVTGLSLPNSQL  82

Query  494  sgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             G + + LG +  LR+++L +N LNGSLP  LF A  L  L L  N +SG LP
Sbjct  83   LGSIPADLGMIQNLRNLDLSNNSLNGSLPLSLFNATQLRFLDLSNNLISGVLP  135



>ref|XP_008446051.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Cucumis melo]
Length=715

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 5/115 (4%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSM-SDWNRSDETPCSWNGITC----KDQRVVSLSIPKK  487
            +L+ +G SLL  K ++   P+ S+ SDWN +D TPC W+GI+C     D RVV +++  K
Sbjct  28   ALSPDGLSLLSLKSAVDQSPDTSVFSDWNENDSTPCGWSGISCMNVSGDSRVVGIALSGK  87

Query  488  KlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             L G++ S LGSL  LR +NL +N L GS+P  LF A  L SL LY N LSG  P
Sbjct  88   NLHGYIPSELGSLVYLRRLNLHNNNLYGSIPEQLFNATSLHSLFLYSNNLSGSFP  142



>ref|XP_010025331.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Eucalyptus grandis]
 gb|KCW61969.1| hypothetical protein EUGRSUZ_H04654 [Eucalyptus grandis]
Length=733

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 69/117 (59%), Gaps = 12/117 (10%)
 Frame = +2

Query  335  EGKSLLIFKKSIVDDPEGSMS---DWNRSDETPCSWNGITCK--------DQRVVSLSIP  481
            +G SLL  K S VD+P G+ S   DWN  D TPC W G++C         D RVV L++ 
Sbjct  29   DGLSLLSLK-SAVDEPPGAASAFADWNEDDPTPCRWTGVSCANVSANSSDDPRVVGLAVS  87

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             K L G++ S LG+L  LR +NL  N L+G +P  LF A  L SL LY N LSGPLP
Sbjct  88   GKGLRGYIPSELGTLLYLRRLNLHGNDLSGPIPDPLFNATSLHSLFLYGNNLSGPLP  144



>ref|XP_004496951.1| PREDICTED: receptor protein kinase-like protein At4g34220-like 
[Cicer arietinum]
Length=759

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 9/120 (8%)
 Frame = +2

Query  320  SSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD---------QRVVSL  472
            SSLN +G  LL FK SI+ DP      WN  D TPCSW+G+ C +          RV SL
Sbjct  27   SSLNSDGIFLLKFKYSILSDPLSVFETWNYDDATPCSWHGVACTEIKSPNTLDFLRVTSL  86

Query  473  SIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             +P  +L G ++  LG +  L+H++L +N LNGSLP  +F +  L+ L L  N +SG LP
Sbjct  87   ILPNSQLLGSIAEELGLIQNLQHIDLSNNFLNGSLPNSIFNSSQLQILSLSNNAISGKLP  146



>ref|XP_010484520.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Camelina sativa]
Length=753

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (61%), Gaps = 6/130 (5%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
             +L+ F+L   +S A    L+ +G  LL F+ SIVDDP   +  W   DETPCSW G+TC
Sbjct  17   TVLSFFLLCDRSSHA----LSTDGVLLLSFRYSIVDDPLSVLRSWRFEDETPCSWRGVTC  72

Query  449  --KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVL  622
                + V  LS+P  KLSG L S+LGSLS L+ ++L +N +NGS P  L  A  L  L L
Sbjct  73   DVSSRHVTVLSLPSSKLSGTLPSNLGSLSSLQRLDLSNNNMNGSFPVSLLNATELRFLDL  132

Query  623  YENYLSGPLP  652
             +N++SG LP
Sbjct  133  SDNHISGELP  142



>ref|XP_010437246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Camelina sativa]
Length=777

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 75/129 (58%), Gaps = 2/129 (2%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            +I  +FI  FC S    S+LN +G  LL FK S++ DP   +  WN   ETPCSW G++C
Sbjct  5    LIPVVFIFFFC-SVLTSSALNSDGLVLLKFKSSVLVDPLSLLQTWNHKHETPCSWRGVSC  63

Query  449  -KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
              D +V +LS+P  +L G + S LGSL  L+ ++L +N  NG LP   F A  L  L L 
Sbjct  64   NNDSKVSTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFDARELRFLDLS  123

Query  626  ENYLSGPLP  652
             N +SG +P
Sbjct  124  SNMISGEIP  132



>ref|XP_006442219.1| hypothetical protein CICLE_v10018604mg [Citrus clementina]
 gb|ESR55459.1| hypothetical protein CICLE_v10018604mg [Citrus clementina]
Length=1109

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L  F LIFC S   ++SL EEG SLL FK S++D P  ++  WN SD TPC+W G+ C D
Sbjct  13   LFYFALIFCFSNVSVTSLTEEGVSLLEFKASLID-PSNNLESWNSSDMTPCNWIGVECTD  71

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             +V S+ +    LSG LS  +  L +L   N+  N + GS+P  L     LE L L  N 
Sbjct  72   FKVTSVDLHGLNLSGILSPRICDLPRLVEFNISMNFITGSIPTDLANCSSLEILDLCTNR  131

Query  635  LSGPLPF  655
            L G +PF
Sbjct  132  LHGVIPF  138



>ref|XP_010432075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Camelina sativa]
Length=776

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 75/129 (58%), Gaps = 2/129 (2%)
 Frame = +2

Query  269  VILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC  448
            +I  +FI  FC S    S+LN +G  LL FK S++ DP   +  WN   ETPCSW G++C
Sbjct  5    LIPVVFIFFFC-SVLTSSALNSDGLVLLKFKSSVLVDPLSLLQTWNHKHETPCSWRGVSC  63

Query  449  -KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
              D +V +LS+P  +L G + S LGSL  L+ ++L +N  NG LP   F A  L  L L 
Sbjct  64   NNDSKVSTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFDARELRFLDLS  123

Query  626  ENYLSGPLP  652
             N +SG +P
Sbjct  124  SNMISGEIP  132



>ref|XP_006393926.1| hypothetical protein EUTSA_v10003700mg [Eutrema salsugineum]
 gb|ESQ31212.1| hypothetical protein EUTSA_v10003700mg [Eutrema salsugineum]
Length=748

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD--QRVVSLSIPKKKls  496
            +LN +G  LL F+ S+VDDP   +  W   DETPCSW G+TC +  + V  LS+P   LS
Sbjct  29   ALNTDGVLLLSFRYSVVDDPLSVLRSWRFEDETPCSWRGVTCDESSRHVTVLSLPSSNLS  88

Query  497  gflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            G L S+LGSL  L+ ++L +N +NGS P  LF A  L  L L  N++SG LP
Sbjct  89   GTLPSNLGSLLSLQRLDLSNNSINGSFPVSLFNATELRYLDLSSNHISGELP  140



>ref|XP_010691679.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Beta vulgaris subsp. vulgaris]
Length=800

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC-KDQRVVSLSIPKKKlsg  499
            SLN +G  LL  K SI+ DP   ++ W+  D  PCSWNG+ C +D RV++LS+P  +L G
Sbjct  24   SLNSDGSFLLALKYSILSDPLSVLNSWDYLDLNPCSWNGVVCSQDLRVITLSLPNSQLLG  83

Query  500  flssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             +   LG +  L+H++L +N  NG+LP  LF +  L+ L L  N +SG +P
Sbjct  84   SIPPDLGLIEHLQHLDLSNNFFNGTLPVTLFNSSQLQVLSLSSNVISGDIP  134



>ref|XP_007134648.1| hypothetical protein PHAVU_010G064900g [Phaseolus vulgaris]
 gb|ESW06642.1| hypothetical protein PHAVU_010G064900g [Phaseolus vulgaris]
Length=713

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC------KDQRVVSLSIPK  484
            SL+ +G +LL  K S VD P  + SDWN  D TPC+W+GI C      +D RVV +S+  
Sbjct  26   SLSSDGLALLALK-SAVDQPSSAFSDWNDGDVTPCAWSGIVCANISGEEDPRVVGISLAG  84

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K +SG+L S LG+L  LR +NL  N  +G LP  L  A  L SL L+ N LSGP+P
Sbjct  85   KFISGYLPSELGTLRFLRRLNLHDNAFSGVLPAQLGNATALHSLFLHRNNLSGPIP  140



>ref|XP_011097240.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Sesamum indicum]
Length=777

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 75/134 (56%), Gaps = 11/134 (8%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCK  451
            ILAL +L+    +A    LN +G  LL FK SI  DP G +  W   DE PCSWNG+TC 
Sbjct  14   ILALSLLV----RAQCFGLNTDGVLLLSFKYSITSDPFGVLRSWIYHDENPCSWNGVTCG  69

Query  452  DQ-------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLE  610
                     RV  LS+P   L G + ++LG +  L+++NL  N +NGSLP  LF A  L+
Sbjct  70   TPGSGDAYFRVTGLSLPDSGLRGTIPATLGMIEYLQNLNLSDNSINGSLPLSLFSASQLQ  129

Query  611  SLVLYENYLSGPLP  652
             L L  N +SG LP
Sbjct  130  ILDLSNNLISGGLP  143



>ref|XP_004289190.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Fragaria vesca subsp. vesca]
Length=787

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 10/119 (8%)
 Frame = +2

Query  326  LNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD----------QRVVSLS  475
            LN +G  LL FK SI+ DP+  + +WN +DETPCSW G+TC             RV+SL+
Sbjct  22   LNTDGLLLLSFKLSILQDPQLVLQNWNPNDETPCSWRGVTCATILTPPENVFYPRVISLA  81

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G + ++LG + QL+ +NL  N LNGSLP  LF +  L+ L L  N ++G LP
Sbjct  82   LPSSELVGSIPANLGMIEQLQSLNLSDNSLNGSLPLSLFNSTQLQVLDLAFNRIAGVLP  140



>ref|XP_006478014.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230-like [Citrus sinensis]
Length=1109

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L  F LIFC S   ++SL EEG SLL FK S++D P  ++  WN SD TPC+W G+ C D
Sbjct  13   LFYFALIFCFSNVSVTSLTEEGVSLLEFKASLID-PSNNLESWNSSDMTPCNWIGVECTD  71

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             +V S+ +    LSG LS  +  L +L   N+  N + GS+P  L     LE L L  N 
Sbjct  72   FKVTSVDLHGLNLSGILSPRICDLPRLVEFNISMNFVTGSIPTDLANCSSLEILDLCTNR  131

Query  635  LSGPLPF  655
            L G +PF
Sbjct  132  LHGVIPF  138



>ref|XP_002300237.2| hypothetical protein POPTR_0001s30800g [Populus trichocarpa]
 gb|EEE85042.2| hypothetical protein POPTR_0001s30800g [Populus trichocarpa]
Length=757

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK SI+ DP   +  WN  D+TPC W G+TC +          RV SL 
Sbjct  25   ALNTDGVLLLSFKYSILRDPLSVLETWNYEDKTPCFWKGVTCTELGLPGTPDMFRVTSLV  84

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G +   LGS+  LRH++L +N LNGSLP   F A  L+ + L  N +SG LP
Sbjct  85   LPNSQLLGSIPPDLGSVEHLRHLDLSNNFLNGSLPSSFFNATELQVISLSSNEISGELP  143



>gb|EPS65472.1| hypothetical protein M569_09303 [Genlisea aurea]
Length=749

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 10/137 (7%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSI-VDDPEGSMSDWNRSDETPCSWNGI  442
            M++L +  + F  S  V+  LN EG +LL  K ++       + S+WN +DETPC WNGI
Sbjct  12   MIVLVVLSIYFQGS--VVVCLNSEGLALLSLKSAVDAGTRAAAFSNWNENDETPCGWNGI  69

Query  443  TCKDQ-------RVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRAL  601
             C          RVV LS+  + L G++ S +GSLS LR +NL  N   GS+P  LF A 
Sbjct  70   DCSGNVSGSDGPRVVGLSVAGRNLRGYIPSEIGSLSYLRRLNLHGNHFYGSIPAQLFNAS  129

Query  602  GLESLVLYENYLSGPLP  652
             L ++ LY N LSG LP
Sbjct  130  SLHTIFLYGNNLSGLLP  146



>gb|KDO44090.1| hypothetical protein CISIN_1g001274mg [Citrus sinensis]
Length=1109

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +2

Query  275  LALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD  454
            L  F LIFC S   ++SL EEG SLL FK S++D P  ++  WN SD TPC+W G+ C D
Sbjct  13   LFYFALIFCFSNVSVTSLTEEGVSLLEFKASLID-PSNNLESWNSSDMTPCNWIGVECTD  71

Query  455  QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENY  634
             +V S+ +    LSG LS  +  L +L   N+  N + GS+P  L     LE L L  N 
Sbjct  72   FKVTSVDLHGLNLSGILSPRICDLPRLVEFNISMNFVTGSIPTDLANCSSLEILDLCTNR  131

Query  635  LSGPLPF  655
            L G +PF
Sbjct  132  LHGVIPF  138



>gb|KFK41150.1| hypothetical protein AALP_AA2G092300 [Arabis alpina]
Length=710

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC------KDQRVVSLSIPK  484
            SL+ +G +LL  K S +D    + SDWN +D  PC W+GI+C       D RVV +S+  
Sbjct  20   SLSPDGLALLSLK-SAIDQSSSAFSDWNDNDSDPCHWSGISCTNISGNSDLRVVGISLAG  78

Query  485  KKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            K L G++ S LGSL  LR +NL +N L+GS+P  LF A  L SL LY+N LSG LP
Sbjct  79   KNLRGYIPSELGSLIYLRRLNLHNNELSGSIPTQLFNATALHSLFLYKNNLSGSLP  134



>ref|XP_009103436.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g37250 [Brassica rapa]
Length=748

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = +2

Query  272  ILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITC-  448
            +    +L+ C+      +LN +G  LL F+ SI+DDP   +  W   DETPCSW G+TC 
Sbjct  12   LFVFTVLLLCDRSL---ALNTDGVLLLSFRYSILDDPLSVLRSWRLEDETPCSWRGVTCD  68

Query  449  -KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLY  625
               + V  LS+P  KL+G L S+LGSL  L+ ++L +N +NGS P  L  A  L  L L 
Sbjct  69   VSSRHVTVLSLPSSKLAGTLPSNLGSLPSLQRLDLSNNSINGSFPASLLNATELRFLDLS  128

Query  626  ENYLSGPLP  652
             N++SG LP
Sbjct  129  RNHISGELP  137



>ref|XP_010250769.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nelumbo nucifera]
Length=716

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGI  442
            M +  LF LI      +  SL+ +G SLL  K ++      S  S+WN  D  PC+W+GI
Sbjct  1    MKLFPLFFLILQLHANLTFSLSPDGLSLLALKSAVDQTSHASAFSNWNEQDNDPCNWSGI  60

Query  443  TC------KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALG  604
            +C       D RVV +S+    L G++ S LG+L  LR +NL  NR  GS+P  LF A  
Sbjct  61   SCINVTGFSDPRVVGISLSGLNLQGYIPSELGTLVFLRRLNLHGNRFYGSIPLQLFNATS  120

Query  605  LESLVLYENYLSGPLP  652
            L S+ LY N LSGPLP
Sbjct  121  LRSIFLYGNNLSGPLP  136



>ref|XP_011030400.1| PREDICTED: receptor protein kinase-like protein At4g34220 [Populus 
euphratica]
Length=770

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK SI+ DP   +  WN  D+TPC W G+TC +          RV S+ 
Sbjct  25   ALNTDGVLLLSFKYSILRDPLSVLETWNYEDKTPCFWKGVTCTELGLPGTPDMFRVTSVV  84

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G ++  LG +  LRH++L +N LNGSLP   F A  L+ + L  N +SG LP
Sbjct  85   LPNSQLLGSIAPDLGYIEHLRHLDLSNNFLNGSLPSSFFNATELQEISLSSNEISGELP  143



>ref|XP_012085656.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Jatropha curcas]
 gb|KDP26784.1| hypothetical protein JCGZ_17942 [Jatropha curcas]
Length=713

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 69/117 (59%), Gaps = 7/117 (6%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGS-MSDWNRSDETPCSWNGITC------KDQRVVSLSIP  481
            SL+ +G SLL  K ++    E S  +DWN  D TPC W GI+C       D RVV ++I 
Sbjct  24   SLSPDGLSLLSLKSAVDQPSENSPFADWNEDDSTPCRWTGISCMNITGFPDPRVVGIAIS  83

Query  482  KKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
             + L G++ S LG+L  LR +NL +N   GS+P  LF A  L SL LY N LSGPLP
Sbjct  84   ARNLRGYIPSELGTLVYLRRLNLHNNNFYGSIPAELFNATSLHSLFLYGNNLSGPLP  140



>emb|CDO97218.1| unnamed protein product [Coffea canephora]
Length=759

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 66/118 (56%), Gaps = 10/118 (8%)
 Frame = +2

Query  329  NEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ----------RVVSLSI  478
            N +G  LL FK SI++DP   + DWN  DETPC W G+TC             RV+SL +
Sbjct  20   NVDGTLLLSFKYSILNDPLSVLDDWNYDDETPCLWTGVTCAQVETPFGTPAMFRVISLVL  79

Query  479  PKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            P  KL G +   LG +  LR ++L  N LNG+LP  LF A  L+ L L  N ++G LP
Sbjct  80   PNSKLLGSIPEDLGFIQHLRTLDLSGNFLNGTLPNSLFNASELQVLSLSSNAITGGLP  137



>ref|XP_009335840.1| PREDICTED: receptor protein kinase-like protein At4g34220 isoform 
X2 [Pyrus x bretschneideri]
Length=558

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK SI+ DP   + +WN  DETPCSW G+TC            RV SL 
Sbjct  26   ALNSDGILLLSFKYSIISDPLSVLDNWNYEDETPCSWIGVTCTQLGNPGTPDMFRVTSLV  85

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P   L G +S  LGSL  ++ ++L  N  NGSLP  LF A  L+ L L  N++SG LP
Sbjct  86   LPNSHLVGSISPELGSLQHIQRLDLSKNFFNGSLPVTLFNASELKVLSLSNNFISGDLP  144



>gb|AAL06915.1| AT5g67280/K3G17_4 [Arabidopsis thaliana]
Length=751

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            + ++ +F+   C+  ++  +L  +G  LL F+ SIVDDP      W   DETPCSW G+T
Sbjct  13   LFLITVFLFFLCDKTSL--ALTTDGVLLLSFRYSIVDDPLYVFRSWRFDDETPCSWRGVT  70

Query  446  C--KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            C    + V  LS+P   L+G L S+LGSL+ L+ ++L +N +NGS P  L  A  L  L 
Sbjct  71   CDASSRHVTVLSLPSSNLTGTLPSNLGSLNSLQRLDLSNNSINGSFPVSLLNATELRFLD  130

Query  620  LYENYLSGPLP  652
            L +N++SG LP
Sbjct  131  LSDNHISGALP  141



>ref|XP_010437653.1| PREDICTED: receptor protein kinase-like protein At4g34220 [Camelina 
sativa]
Length=752

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 74/133 (56%), Gaps = 11/133 (8%)
 Frame = +2

Query  281  LFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKD--  454
            LF LI   +Q  L +LN +G  LL FK SI+ DP   + +WN  D TPC W G+TC +  
Sbjct  14   LFHLILVPTQ--LQALNTDGVLLLAFKYSILSDPLSVLRNWNYEDATPCLWTGVTCTELG  71

Query  455  -------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLES  613
                    RV SL +P K LSG ++  L  L  LR ++L +N  NGSLP  +F    L++
Sbjct  72   KPNTPDTLRVTSLVLPNKNLSGSVTPDLFFLPHLRILDLSTNFFNGSLPDSVFNVTELQN  131

Query  614  LVLYENYLSGPLP  652
            + L  N LSG LP
Sbjct  132  ISLGSNNLSGDLP  144



>ref|NP_201529.1| receptor-like kinase [Arabidopsis thaliana]
 dbj|BAB09647.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAN46893.1| At5g67280/K3G17_4 [Arabidopsis thaliana]
 dbj|BAE99205.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59409.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98324.1| receptor-like kinase [Arabidopsis thaliana]
Length=751

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +2

Query  266  MVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGIT  445
            + ++ +F+   C+  ++  +L  +G  LL F+ SIVDDP      W   DETPCSW G+T
Sbjct  13   LFLITVFLFFLCDKTSL--ALTTDGVLLLSFRYSIVDDPLYVFRSWRFDDETPCSWRGVT  70

Query  446  C--KDQRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLV  619
            C    + V  LS+P   L+G L S+LGSL+ L+ ++L +N +NGS P  L  A  L  L 
Sbjct  71   CDASSRHVTVLSLPSSNLTGTLPSNLGSLNSLQRLDLSNNSINGSFPVSLLNATELRFLD  130

Query  620  LYENYLSGPLP  652
            L +N++SG LP
Sbjct  131  LSDNHISGALP  141



>ref|XP_008373088.1| PREDICTED: receptor protein kinase-like protein At4g34220 [Malus 
domestica]
Length=777

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 68/119 (57%), Gaps = 9/119 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK SI+ DP   +  WN  DETPCSW G+TC            RV SL 
Sbjct  20   ALNSDGVLLLSFKYSILSDPLSVLDSWNYEDETPCSWTGVTCTQLGSPGTPDMFRVTSLV  79

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPLP  652
            +P  +L G +S  LGSL  L+ ++L +N  NGSLP  LF A  L+ L L  N +SG LP
Sbjct  80   LPNSQLLGSISPELGSLQHLQRLDLSNNFFNGSLPVALFNASELQVLSLSSNVISGDLP  138



>gb|KFK41396.1| hypothetical protein AALP_AA2G125200 [Arabis alpina]
Length=748

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 9/121 (7%)
 Frame = +2

Query  317  LSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVS  469
            L +LN +G SLL FK +I++DP   + +WN  DETPC W+G+TC +          RV S
Sbjct  24   LQALNTDGVSLLSFKYAILNDPLFVLRNWNYQDETPCLWSGVTCTELGKPNTTDMFRVTS  83

Query  470  LSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPL  649
            L +P K L GF+++ L S+  LR ++L  N  NGSLP  +F A  L  + L  N LSG +
Sbjct  84   LVLPNKHLLGFVTTDLFSIQHLRILDLSGNFFNGSLPDSVFNATELRVISLGSNNLSGDM  143

Query  650  P  652
            P
Sbjct  144  P  144



>ref|XP_002518685.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis]
 gb|EEF43610.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis]
Length=736

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 9/118 (8%)
 Frame = +2

Query  323  SLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGITCKDQ---------RVVSLS  475
            +LN +G  LL FK S + DP   +  WN  D+TPCSWNG+TC +          RV SL 
Sbjct  27   ALNTDGILLLSFKYSTLSDPLSVLESWNYDDDTPCSWNGVTCTELGLQGTPDMFRVTSLV  86

Query  476  IPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRALGLESLVLYENYLSGPL  649
            +P  +L G +   LG +  L+H++L +N LNGSLP  +F A  LE + L  N +SG L
Sbjct  87   LPSSQLLGSIPPDLGFIQHLKHLDLSNNYLNGSLPSSIFNATELEVISLSGNEISGEL  144



>ref|XP_007047392.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91549.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=783

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 14/138 (10%)
 Frame = +2

Query  263  KMVILALFILIFCNSQAVLSSLNEEGKSLLIFKKSIVDDPEGSMSDWNRSDETPCSWNGI  442
            +++++  F++I C        LN +G  LL FK+SI+ DP   +  WN  D+TPCSWNG+
Sbjct  14   RILVILEFLVIQC------LGLNTDGILLLSFKQSILSDPLNVLQSWNYRDQTPCSWNGV  67

Query  443  TCKD--------QRVVSLSIPKKKlsgflssslgslsqlRHVNLRSNRLNGSLPPGLFRA  598
            TC           RV SLS+P  +L G + S LG +  L +++L +N  NGSLP  +F A
Sbjct  68   TCGAPSNSNNNYSRVTSLSLPNCQLLGSIPSGLGMIQHLENLDLSNNSFNGSLPFSIFNA  127

Query  599  LGLESLVLYENYLSGPLP  652
              L  L L  N +SG +P
Sbjct  128  TQLRFLDLSNNLISGGIP  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1049455598775