BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5011

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002512528.1|  importin alpha, putative                           329   3e-107   
ref|XP_004230322.1|  PREDICTED: importin subunit alpha-1                325   3e-104   Solanum lycopersicum
ref|XP_009592620.1|  PREDICTED: importin subunit alpha-1                325   3e-104   Nicotiana tomentosiformis
ref|XP_009796205.1|  PREDICTED: importin subunit alpha-1                324   3e-104   Nicotiana sylvestris
ref|XP_012088870.1|  PREDICTED: importin subunit alpha-4 isoform X2     323   1e-103   Jatropha curcas
ref|XP_006344784.1|  PREDICTED: importin subunit alpha-1                321   7e-103   Solanum tuberosum [potatoes]
ref|XP_002281670.1|  PREDICTED: importin subunit alpha                  319   4e-102   Vitis vinifera
ref|XP_012088868.1|  PREDICTED: importin subunit alpha-4 isoform X1     319   5e-102   Jatropha curcas
ref|XP_002319478.1|  importin alpha-1 subunit family protein            319   5e-102   Populus trichocarpa [western balsam poplar]
ref|XP_011023801.1|  PREDICTED: importin subunit alpha                  318   8e-102   Populus euphratica
gb|AAK38726.1|AF369706_1  importin alpha 1                              318   1e-101   Capsicum annuum
ref|XP_008246117.1|  PREDICTED: importin subunit alpha-1                316   5e-101   Prunus mume [ume]
ref|XP_010267916.1|  PREDICTED: importin subunit alpha-like             316   5e-101   Nelumbo nucifera [Indian lotus]
ref|XP_007205030.1|  hypothetical protein PRUPE_ppa004046mg             316   5e-101   Prunus persica
gb|KJB26294.1|  hypothetical protein B456_004G235800                    316   7e-101   Gossypium raimondii
ref|XP_011092170.1|  PREDICTED: importin subunit alpha                  315   1e-100   Sesamum indicum [beniseed]
ref|XP_008370371.1|  PREDICTED: importin subunit alpha-like             315   2e-100   
ref|XP_007031183.1|  Importin alpha isoform 1                           315   2e-100   Theobroma cacao [chocolate]
ref|XP_007031184.1|  Importin alpha isoform 2                           315   2e-100   
ref|XP_009373302.1|  PREDICTED: importin subunit alpha-1-like           314   5e-100   Pyrus x bretschneideri [bai li]
ref|XP_009337642.1|  PREDICTED: importin subunit alpha-like isofo...    313   5e-100   Pyrus x bretschneideri [bai li]
ref|XP_008388467.1|  PREDICTED: importin subunit alpha-1                312   2e-99    
ref|XP_008453295.1|  PREDICTED: importin subunit alpha                  312   3e-99    Cucumis melo [Oriental melon]
ref|XP_004144743.1|  PREDICTED: importin subunit alpha-4                311   3e-99    Cucumis sativus [cucumbers]
ref|XP_004302281.1|  PREDICTED: importin subunit alpha-4                311   5e-99    Fragaria vesca subsp. vesca
gb|EYU38410.1|  hypothetical protein MIMGU_mgv1a004192mg                311   7e-99    Erythranthe guttata [common monkey flower]
ref|XP_010270837.1|  PREDICTED: importin subunit alpha-like             310   1e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010914627.1|  PREDICTED: importin subunit alpha isoform X2       310   2e-98    Elaeis guineensis
ref|XP_009337641.1|  PREDICTED: importin subunit alpha-like isofo...    309   3e-98    Pyrus x bretschneideri [bai li]
gb|KDO81642.1|  hypothetical protein CISIN_1g016714mg                   303   8e-98    Citrus sinensis [apfelsine]
ref|XP_008801731.1|  PREDICTED: importin subunit alpha-1a isoform X4    304   2e-97    Phoenix dactylifera
ref|XP_008801730.1|  PREDICTED: importin subunit alpha-1a isoform X3    304   2e-97    
ref|XP_010931776.1|  PREDICTED: importin subunit alpha-like             305   2e-96    Elaeis guineensis
ref|XP_010501391.1|  PREDICTED: importin subunit alpha-1a-like          294   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_008806719.1|  PREDICTED: importin subunit alpha-1a-like          296   4e-96    Phoenix dactylifera
ref|XP_008801728.1|  PREDICTED: importin subunit alpha-1a isoform X1    303   4e-96    Phoenix dactylifera
ref|XP_008801729.1|  PREDICTED: importin subunit alpha-1a isoform X2    303   4e-96    Phoenix dactylifera
ref|NP_001275782.1|  importin alpha                                     303   5e-96    Citrus sinensis [apfelsine]
ref|XP_009414157.1|  PREDICTED: importin subunit alpha-1a-like          302   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO72000.1|  hypothetical protein CISIN_1g009700mg                   300   8e-95    Citrus sinensis [apfelsine]
ref|XP_006488809.1|  PREDICTED: importin subunit alpha-1b-like          300   9e-95    Citrus sinensis [apfelsine]
ref|XP_010549392.1|  PREDICTED: importin subunit alpha-1                300   2e-94    Tarenaya hassleriana [spider flower]
ref|XP_010674568.1|  PREDICTED: importin subunit alpha-1a               299   2e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010544159.1|  PREDICTED: importin subunit alpha-1b-like          296   3e-93    Tarenaya hassleriana [spider flower]
ref|XP_006417589.1|  hypothetical protein EUTSA_v10007310mg             296   3e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010095558.1|  Importin subunit alpha                             298   4e-93    
ref|XP_010914626.1|  PREDICTED: importin subunit alpha isoform X1       296   5e-93    Elaeis guineensis
ref|XP_010458211.1|  PREDICTED: importin subunit alpha-1b-like is...    295   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010458212.1|  PREDICTED: importin subunit alpha-1b-like is...    295   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010489893.1|  PREDICTED: importin subunit alpha-1-like           295   2e-92    Camelina sativa [gold-of-pleasure]
gb|ABO21639.1|  importin alpha-like protein                             294   2e-92    Brassica napus [oilseed rape]
emb|CDX94988.1|  BnaC05g06830D                                          294   2e-92    
emb|CDX93514.1|  BnaA06g05340D                                          294   3e-92    
ref|XP_010475758.1|  PREDICTED: importin subunit alpha-1a-like          293   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010024140.1|  PREDICTED: importin subunit alpha                  293   4e-92    Eucalyptus grandis [rose gum]
ref|XP_002889740.1|  hypothetical protein ARALYDRAFT_888168             293   5e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_009148181.1|  PREDICTED: importin subunit alpha-1                293   7e-92    Brassica rapa
emb|CDY31102.1|  BnaA08g26520D                                          293   7e-92    Brassica napus [oilseed rape]
ref|XP_009110839.1|  PREDICTED: importin subunit alpha-1-like iso...    291   4e-91    Brassica rapa
ref|XP_006304709.1|  hypothetical protein CARUB_v10011976mg             290   7e-91    Capsella rubella
ref|XP_008781168.1|  PREDICTED: importin subunit alpha-like isofo...    290   8e-91    Phoenix dactylifera
ref|NP_172398.1|  importin alpha isoform 4                              290   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010093918.1|  Importin subunit alpha                             297   1e-90    
gb|KFK43224.1|  hypothetical protein AALP_AA1G096500                    289   2e-90    Arabis alpina [alpine rockcress]
ref|XP_001778004.1|  predicted protein                                  288   6e-90    
emb|CAN64716.1|  hypothetical protein VITISV_026717                     287   9e-90    Vitis vinifera
emb|CDY32165.1|  BnaCnng06740D                                          286   3e-89    Brassica napus [oilseed rape]
gb|KHN03320.1|  Importin subunit alpha-1                                284   3e-89    Glycine soja [wild soybean]
ref|XP_011036930.1|  PREDICTED: importin subunit alpha-1 isoform X1     285   6e-89    Populus euphratica
ref|XP_012084120.1|  PREDICTED: importin subunit alpha-4-like           285   8e-89    Jatropha curcas
ref|XP_001760522.1|  predicted protein                                  285   1e-88    
ref|XP_003550530.1|  PREDICTED: importin subunit alpha-1-like           284   1e-88    Glycine max [soybeans]
gb|AAB57845.1|  AtKAP-like protein                                      273   1e-88    Selaginella lepidophylla
ref|XP_006378030.1|  hypothetical protein POPTR_0010s00380g             278   1e-88    
gb|KDO87075.1|  hypothetical protein CISIN_1g009679mg                   280   2e-88    Citrus sinensis [apfelsine]
gb|KDO87076.1|  hypothetical protein CISIN_1g009679mg                   280   2e-88    Citrus sinensis [apfelsine]
ref|XP_004295110.1|  PREDICTED: importin subunit alpha-1-like           283   2e-88    Fragaria vesca subsp. vesca
ref|XP_008223291.1|  PREDICTED: importin subunit alpha-1-like           283   3e-88    Prunus mume [ume]
ref|XP_007222489.1|  hypothetical protein PRUPE_ppa004118mg             283   3e-88    Prunus persica
ref|XP_002961054.1|  hypothetical protein SELMODRAFT_266556             283   4e-88    Selaginella moellendorffii
ref|XP_011079596.1|  PREDICTED: importin subunit alpha-like             283   4e-88    Sesamum indicum [beniseed]
ref|XP_011023747.1|  PREDICTED: importin subunit alpha-1-like iso...    283   5e-88    Populus euphratica
ref|XP_009623312.1|  PREDICTED: importin subunit alpha-like isofo...    278   5e-88    
ref|XP_011036931.1|  PREDICTED: importin subunit alpha-1 isoform X2     282   6e-88    Populus euphratica
ref|XP_006382424.1|  Importin alpha-1 subunit family protein            282   6e-88    Populus trichocarpa [western balsam poplar]
gb|KHN02923.1|  Importin subunit alpha-1                                282   7e-88    Glycine soja [wild soybean]
ref|XP_002318966.1|  Importin alpha-1 subunit family protein            282   8e-88    Populus trichocarpa [western balsam poplar]
emb|CDY22779.1|  BnaA08g06090D                                          282   1e-87    Brassica napus [oilseed rape]
ref|XP_008368355.1|  PREDICTED: importin subunit alpha-1a-like          276   1e-87    
gb|EPS62504.1|  hypothetical protein M569_12283                         281   1e-87    Genlisea aurea
ref|XP_011023748.1|  PREDICTED: importin subunit alpha-1-like iso...    281   2e-87    Populus euphratica
emb|CDY52043.1|  BnaC08g48070D                                          281   2e-87    Brassica napus [oilseed rape]
ref|XP_009623317.1|  PREDICTED: importin subunit alpha-like isofo...    275   2e-87    
ref|XP_002966958.1|  hypothetical protein SELMODRAFT_439828             281   2e-87    
ref|XP_001773629.1|  predicted protein                                  281   2e-87    
gb|KJB28705.1|  hypothetical protein B456_005G065400                    281   2e-87    Gossypium raimondii
ref|XP_009623316.1|  PREDICTED: importin subunit alpha-like isofo...    275   2e-87    
ref|XP_009623313.1|  PREDICTED: importin subunit alpha-like isofo...    276   2e-87    
ref|XP_010268071.1|  PREDICTED: importin subunit alpha-1-like           281   3e-87    Nelumbo nucifera [Indian lotus]
ref|XP_008355762.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    271   3e-87    
ref|XP_011100802.1|  PREDICTED: importin subunit alpha-1a-like          280   3e-87    Sesamum indicum [beniseed]
ref|XP_007154341.1|  hypothetical protein PHAVU_003G110500g             280   3e-87    Phaseolus vulgaris [French bean]
gb|EPS72719.1|  hypothetical protein M569_02038                         274   4e-87    Genlisea aurea
gb|AES65063.2|  importin subunit alpha-1b                               280   4e-87    Medicago truncatula
gb|AAD09923.1|  importin alpha homolog                                  276   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107883.1|  PREDICTED: importin subunit alpha-1-like           280   5e-87    Brassica rapa
ref|XP_009623314.1|  PREDICTED: importin subunit alpha-like isofo...    275   6e-87    
ref|XP_006842676.1|  PREDICTED: importin subunit alpha-1                280   7e-87    Amborella trichopoda
ref|XP_003594812.1|  Importin subunit alpha-1                           280   7e-87    
gb|EYU44000.1|  hypothetical protein MIMGU_mgv1a004419mg                280   8e-87    Erythranthe guttata [common monkey flower]
ref|XP_009623315.1|  PREDICTED: importin subunit alpha-like isofo...    274   9e-87    
ref|XP_009796163.1|  PREDICTED: importin subunit alpha-1a-like          279   9e-87    Nicotiana sylvestris
ref|XP_006480039.1|  PREDICTED: importin subunit alpha-like             279   9e-87    Citrus sinensis [apfelsine]
ref|XP_010098874.1|  Importin subunit alpha-1a                          274   1e-86    Morus notabilis
gb|AII99829.1|  importin alpha                                          279   1e-86    Nicotiana tabacum [American tobacco]
emb|CDP17235.1|  unnamed protein product                                278   2e-86    Coffea canephora [robusta coffee]
ref|XP_002512485.1|  importin alpha, putative                           278   2e-86    Ricinus communis
ref|XP_007138966.1|  hypothetical protein PHAVU_009G253500g             278   2e-86    Phaseolus vulgaris [French bean]
ref|XP_010098873.1|  Importin subunit alpha-1a                          274   3e-86    
ref|XP_009623311.1|  PREDICTED: importin subunit alpha-like isofo...    273   3e-86    Nicotiana tomentosiformis
ref|XP_011046400.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    278   3e-86    Populus euphratica
ref|XP_006345634.1|  PREDICTED: importin subunit alpha-1-like           278   4e-86    Solanum tuberosum [potatoes]
ref|XP_001773628.1|  predicted protein                                  278   4e-86    
ref|XP_010486198.1|  PREDICTED: importin subunit alpha-1 isoform X1     278   4e-86    Camelina sativa [gold-of-pleasure]
ref|XP_008458386.1|  PREDICTED: importin subunit alpha-1-like           278   4e-86    Cucumis melo [Oriental melon]
ref|XP_002519178.1|  importin alpha, putative                           276   4e-86    
ref|XP_004150082.1|  PREDICTED: importin subunit alpha-1                277   4e-86    Cucumis sativus [cucumbers]
ref|XP_012084020.1|  PREDICTED: importin subunit alpha-2 isoform X2     277   5e-86    Jatropha curcas
ref|XP_007031101.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    277   5e-86    
ref|XP_007031099.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 2         277   7e-86    
ref|XP_006380206.1|  hypothetical protein POPTR_0008s22930g             273   7e-86    
ref|XP_012082851.1|  PREDICTED: importin subunit alpha-like             277   8e-86    Jatropha curcas
gb|KJB41863.1|  hypothetical protein B456_007G124900                    274   8e-86    Gossypium raimondii
ref|XP_004487798.1|  PREDICTED: importin subunit alpha-1-like           276   9e-86    Cicer arietinum [garbanzo]
ref|XP_006355403.1|  PREDICTED: importin subunit alpha-1-like iso...    276   9e-86    Solanum tuberosum [potatoes]
ref|XP_011082432.1|  PREDICTED: importin subunit alpha-like             276   1e-85    Sesamum indicum [beniseed]
ref|XP_009146474.1|  PREDICTED: importin subunit alpha-1-like           276   1e-85    Brassica rapa
ref|XP_007035723.1|  Importin subunit alpha-1a isoform 3                273   1e-85    
ref|XP_008340751.1|  PREDICTED: importin subunit alpha-1                276   1e-85    
ref|XP_010094009.1|  Importin subunit alpha-1                           276   1e-85    Morus notabilis
ref|XP_008797160.1|  PREDICTED: importin subunit alpha-1b-like          276   1e-85    Phoenix dactylifera
ref|XP_010444089.1|  PREDICTED: importin subunit alpha-1-like           276   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_007051048.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 1         276   2e-85    
gb|KDO71826.1|  hypothetical protein CISIN_1g009544mg                   271   2e-85    Citrus sinensis [apfelsine]
ref|XP_012088940.1|  PREDICTED: importin subunit alpha-2                276   2e-85    Jatropha curcas
gb|KJB82641.1|  hypothetical protein B456_013G206500                    276   2e-85    Gossypium raimondii
emb|CDY34430.1|  BnaC01g22030D                                          276   2e-85    Brassica napus [oilseed rape]
ref|NP_187328.1|  Importin subunit alpha-1                              276   2e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CAA74966.1|  Importin alpha-like protein                            275   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244944.1|  PREDICTED: importin subunit alpha-1                275   3e-85    Solanum lycopersicum
ref|XP_002275593.1|  PREDICTED: importin subunit alpha-1 isoform X1     275   3e-85    
ref|XP_008388495.1|  PREDICTED: importin subunit alpha-1b-like          275   3e-85    Malus domestica [apple tree]
gb|AAB72116.2|  AtKAP alpha                                             275   3e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009347771.1|  PREDICTED: importin subunit alpha-1-like           275   3e-85    Pyrus x bretschneideri [bai li]
ref|XP_003533220.1|  PREDICTED: importin subunit alpha-1-like iso...    275   3e-85    
tpg|DAA53968.1|  TPA: hypothetical protein ZEAMMB73_409958              268   3e-85    
ref|XP_012084019.1|  PREDICTED: importin subunit alpha-2 isoform X1     275   3e-85    Jatropha curcas
gb|KHG29743.1|  Importin subunit alpha-1 -like protein                  276   4e-85    Gossypium arboreum [tree cotton]
ref|XP_001763761.1|  predicted protein                                  275   4e-85    
ref|XP_009369966.1|  PREDICTED: importin subunit alpha-1-like           275   4e-85    Pyrus x bretschneideri [bai li]
ref|XP_009631847.1|  PREDICTED: importin subunit alpha-1a-like          275   4e-85    Nicotiana tomentosiformis
gb|KJB12652.1|  hypothetical protein B456_002G029800                    273   4e-85    Gossypium raimondii
ref|XP_007031098.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    277   5e-85    
ref|XP_003546338.1|  PREDICTED: importin subunit alpha-1-like iso...    275   5e-85    Glycine max [soybeans]
ref|XP_002282816.1|  PREDICTED: importin subunit alpha-1                275   6e-85    Vitis vinifera
gb|AAL06825.1|  AT3g06720/F3E22_14                                      274   8e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008360253.1|  PREDICTED: importin subunit alpha-1-like iso...    273   9e-85    
ref|NP_001154239.1|  importin alpha isoform 2                           274   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010259399.1|  PREDICTED: importin subunit alpha-1                274   1e-84    Nelumbo nucifera [Indian lotus]
ref|XP_009621534.1|  PREDICTED: importin subunit alpha-1-like           273   1e-84    Nicotiana tomentosiformis
gb|ABM05488.1|  Impa2                                                   273   2e-84    Nicotiana benthamiana
ref|XP_006407910.1|  hypothetical protein EUTSA_v10020480mg             273   2e-84    Eutrema salsugineum [saltwater cress]
emb|CAA75513.1|  Importin alpha-like protein                            273   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781699.1|  PREDICTED: importin subunit alpha-1-like iso...    273   2e-84    Nicotiana sylvestris
gb|AAK32824.1|AF361811_1  AT3g06720/F3E22_14                            273   2e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KJB41862.1|  hypothetical protein B456_007G124900                    273   2e-84    Gossypium raimondii
emb|CAA74965.1|  Importin alpha-like protein                            273   2e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KHG01621.1|  Importin subunit alpha-1 -like protein                  273   3e-84    Gossypium arboreum [tree cotton]
ref|XP_010094336.1|  Importin subunit alpha-1                           273   3e-84    Morus notabilis
ref|NP_001042611.1|  Os01g0253300                                       273   3e-84    
gb|EAY73331.1|  hypothetical protein OsI_01208                          273   3e-84    Oryza sativa Indica Group [Indian rice]
gb|KJB12655.1|  hypothetical protein B456_002G029800                    273   3e-84    Gossypium raimondii
gb|KJB12653.1|  hypothetical protein B456_002G029800                    273   3e-84    Gossypium raimondii
gb|KDO81731.1|  hypothetical protein CISIN_1g009184mg                   269   3e-84    Citrus sinensis [apfelsine]
gb|AAQ13406.1|AF005265_1  importin                                      273   3e-84    Oryza sativa [red rice]
ref|XP_010914512.1|  PREDICTED: importin subunit alpha-1b-like          273   3e-84    Elaeis guineensis
gb|KDO81732.1|  hypothetical protein CISIN_1g009184mg                   269   4e-84    Citrus sinensis [apfelsine]
ref|XP_008360251.1|  PREDICTED: importin subunit alpha-1-like iso...    272   4e-84    
pdb|4B8J|A  Chain A, Rimp_alpha1a                                       272   4e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010546997.1|  PREDICTED: importin subunit alpha-1                273   4e-84    Tarenaya hassleriana [spider flower]
ref|XP_007035721.1|  Importin alpha isoform 1                           272   4e-84    
ref|XP_007035722.1|  Importin alpha isoform 2                           272   5e-84    
ref|XP_006380207.1|  hypothetical protein POPTR_0008s22930g             272   5e-84    Populus trichocarpa [western balsam poplar]
ref|XP_008453860.1|  PREDICTED: importin subunit alpha-1                272   6e-84    Cucumis melo [Oriental melon]
ref|XP_009393195.1|  PREDICTED: importin subunit alpha-1b-like          272   6e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931697.1|  PREDICTED: importin subunit alpha-1b               272   6e-84    Elaeis guineensis
ref|XP_006375444.1|  hypothetical protein POPTR_0014s11920g             269   6e-84    
ref|XP_008781167.1|  PREDICTED: importin subunit alpha-like isofo...    273   6e-84    Phoenix dactylifera
ref|XP_002882488.1|  AT-IMP                                             272   6e-84    
ref|XP_009338212.1|  PREDICTED: importin subunit alpha-1-like           272   7e-84    Pyrus x bretschneideri [bai li]
ref|XP_002868159.1|  AT3g06720/F3E22_14                                 273   7e-84    
emb|CDY09716.1|  BnaC07g33450D                                          272   7e-84    Brassica napus [oilseed rape]
gb|KHG15238.1|  Importin subunit alpha-1 -like protein                  271   9e-84    Gossypium arboreum [tree cotton]
gb|KJB49857.1|  hypothetical protein B456_008G142000                    271   1e-83    Gossypium raimondii
ref|XP_006488879.1|  PREDICTED: importin subunit alpha-1-like           271   1e-83    Citrus sinensis [apfelsine]
ref|XP_010551087.1|  PREDICTED: importin subunit alpha-1-like           271   1e-83    Tarenaya hassleriana [spider flower]
gb|KDO71823.1|  hypothetical protein CISIN_1g009544mg                   271   1e-83    Citrus sinensis [apfelsine]
ref|XP_004228994.1|  PREDICTED: importin subunit alpha-1a               271   1e-83    Solanum lycopersicum
ref|XP_010464259.1|  PREDICTED: importin subunit alpha-1-like           271   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_008810191.1|  PREDICTED: importin subunit alpha-1b-like          270   2e-83    Phoenix dactylifera
ref|XP_009373267.1|  PREDICTED: importin subunit alpha-1b               270   2e-83    Pyrus x bretschneideri [bai li]
ref|XP_004144766.1|  PREDICTED: importin subunit alpha-2                270   2e-83    Cucumis sativus [cucumbers]
gb|AAK38727.1|AF369707_1  importin alpha 2                              270   3e-83    Capsicum annuum
ref|XP_010558435.1|  PREDICTED: importin subunit alpha-1-like           270   3e-83    Tarenaya hassleriana [spider flower]
ref|XP_008245768.1|  PREDICTED: importin subunit alpha-1                270   3e-83    Prunus mume [ume]
ref|XP_010024115.1|  PREDICTED: importin subunit alpha-1a               270   4e-83    Eucalyptus grandis [rose gum]
ref|XP_010670910.1|  PREDICTED: importin subunit alpha-1                270   4e-83    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU34461.1|  putative importin subunit alpha-2                       270   4e-83    Taraxacum brevicorniculatum
emb|CDO98800.1|  unnamed protein product                                270   5e-83    Coffea canephora [robusta coffee]
ref|XP_009136744.1|  PREDICTED: importin subunit alpha-1                270   5e-83    Brassica rapa
ref|XP_010434881.1|  PREDICTED: importin subunit alpha-1-like           270   6e-83    Camelina sativa [gold-of-pleasure]
ref|NP_001234006.1|  importin subunit alpha                             269   7e-83    Solanum lycopersicum
ref|XP_009412111.1|  PREDICTED: importin subunit alpha-1b-like          269   7e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006472169.1|  PREDICTED: importin subunit alpha-1b-like          269   9e-83    Citrus sinensis [apfelsine]
ref|XP_008673870.1|  PREDICTED: importin subunit alpha-1a               269   9e-83    Zea mays [maize]
gb|KCW85238.1|  hypothetical protein EUGRSUZ_B02080                     263   9e-83    Eucalyptus grandis [rose gum]
gb|KHN14650.1|  Importin subunit alpha-1                                269   1e-82    Glycine soja [wild soybean]
gb|KDO81726.1|  hypothetical protein CISIN_1g009184mg                   269   1e-82    Citrus sinensis [apfelsine]
gb|ABM05487.1|  Impa1                                                   269   1e-82    Nicotiana benthamiana
ref|XP_009789105.1|  PREDICTED: importin subunit alpha                  268   1e-82    Nicotiana sylvestris
ref|XP_007205032.1|  hypothetical protein PRUPE_ppa004091mg             268   1e-82    Prunus persica
ref|XP_007206524.1|  hypothetical protein PRUPE_ppa019448mg             257   1e-82    
gb|KHG28859.1|  Importin subunit alpha-1                                268   2e-82    Gossypium arboreum [tree cotton]
ref|XP_006355841.1|  PREDICTED: importin subunit alpha-like             268   2e-82    Solanum tuberosum [potatoes]
ref|XP_011042196.1|  PREDICTED: importin subunit alpha-like             268   2e-82    Populus euphratica
ref|XP_006414387.1|  hypothetical protein EUTSA_v10024884mg             268   2e-82    Eutrema salsugineum [saltwater cress]
ref|XP_006285325.1|  hypothetical protein CARUB_v10006712mg             268   3e-82    Capsella rubella
gb|KHG26190.1|  Importin subunit alpha-1 -like protein                  268   3e-82    Gossypium arboreum [tree cotton]
ref|XP_002320318.1|  hypothetical protein POPTR_0014s11920g             268   3e-82    Populus trichocarpa [western balsam poplar]
gb|KHG28860.1|  Importin subunit alpha-1                                268   3e-82    Gossypium arboreum [tree cotton]
gb|AHJ25927.1|  importin subunit alpha-1                                268   3e-82    Senecio scandens
ref|XP_010548966.1|  PREDICTED: importin subunit alpha-1-like           267   3e-82    Tarenaya hassleriana [spider flower]
gb|KHN12909.1|  Importin subunit alpha-1                                267   4e-82    Glycine soja [wild soybean]
gb|KJB24393.1|  hypothetical protein B456_004G143100                    267   4e-82    Gossypium raimondii
gb|KJB24392.1|  hypothetical protein B456_004G143100                    267   4e-82    Gossypium raimondii
ref|XP_011041680.1|  PREDICTED: importin subunit alpha-like             267   5e-82    Populus euphratica
ref|XP_002274422.1|  PREDICTED: importin subunit alpha                  266   6e-82    Vitis vinifera
ref|XP_009401503.1|  PREDICTED: importin subunit alpha-1b-like          266   8e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011013186.1|  PREDICTED: importin subunit alpha-1-like           266   8e-82    Populus euphratica
ref|XP_009606138.1|  PREDICTED: importin subunit alpha                  266   1e-81    Nicotiana tomentosiformis
ref|XP_004967840.1|  PREDICTED: importin subunit alpha-1a-like          266   1e-81    Setaria italica
gb|EMS47918.1|  Importin subunit alpha-1a                               265   2e-81    Triticum urartu
ref|NP_001148537.1|  LOC100282153                                       265   2e-81    Zea mays [maize]
ref|XP_009763482.1|  PREDICTED: importin subunit alpha-1a-like          265   3e-81    Nicotiana sylvestris
gb|ACJ85746.1|  unknown                                                 260   3e-81    Medicago truncatula
gb|AFK47768.1|  unknown                                                 260   3e-81    Medicago truncatula
ref|XP_009402512.1|  PREDICTED: importin subunit alpha-1b-like          265   4e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003566399.1|  PREDICTED: importin subunit alpha-1a               264   6e-81    Brachypodium distachyon [annual false brome]
ref|XP_003554623.1|  PREDICTED: importin subunit alpha-1-like           264   6e-81    Glycine max [soybeans]
gb|EPS69743.1|  hypothetical protein M569_05021                         263   7e-81    Genlisea aurea
ref|XP_009612538.1|  PREDICTED: importin subunit alpha-1a-like          264   9e-81    Nicotiana tomentosiformis
ref|XP_008345591.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    263   1e-80    
ref|XP_002302745.2|  hypothetical protein POPTR_0002s20060g             263   1e-80    Populus trichocarpa [western balsam poplar]
ref|XP_004495674.1|  PREDICTED: importin subunit alpha-1b-like is...    263   2e-80    Cicer arietinum [garbanzo]
ref|XP_003521670.1|  PREDICTED: importin subunit alpha-1-like           263   2e-80    Glycine max [soybeans]
ref|XP_010684628.1|  PREDICTED: importin subunit alpha                  263   3e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007163337.1|  hypothetical protein PHAVU_001G226400g             262   4e-80    Phaseolus vulgaris [French bean]
gb|AES82394.2|  importin subunit alpha-1b                               262   4e-80    Medicago truncatula
gb|AGZ15387.1|  importin alpha                                          262   4e-80    Phaseolus vulgaris [French bean]
emb|CDO98799.1|  unnamed protein product                                261   5e-80    Coffea canephora [robusta coffee]
gb|KHN03948.1|  Importin subunit alpha                                  261   6e-80    Glycine soja [wild soybean]
gb|EYU25627.1|  hypothetical protein MIMGU_mgv1a004356mg                261   6e-80    Erythranthe guttata [common monkey flower]
ref|XP_010043209.1|  PREDICTED: importin subunit alpha-1a-like          261   7e-80    Eucalyptus grandis [rose gum]
ref|XP_003626176.1|  Importin subunit alpha                             262   1e-79    
ref|XP_006297392.1|  hypothetical protein CARUB_v10013416mg             261   1e-79    Capsella rubella
ref|XP_004302255.1|  PREDICTED: importin subunit alpha-1                260   2e-79    Fragaria vesca subsp. vesca
ref|XP_007144986.1|  hypothetical protein PHAVU_007G199900g             260   2e-79    Phaseolus vulgaris [French bean]
ref|XP_003591197.1|  Importin subunit alpha-1                           260   2e-79    Medicago truncatula
ref|XP_011092122.1|  PREDICTED: importin subunit alpha-1                259   4e-79    Sesamum indicum [beniseed]
ref|XP_010024770.1|  PREDICTED: importin subunit alpha-1                259   5e-79    
gb|AAT08686.1|  karyopherin alpha                                       251   8e-79    
ref|XP_010231685.1|  PREDICTED: importin subunit alpha-1b               258   9e-79    
ref|XP_004494548.1|  PREDICTED: importin subunit alpha-like             258   1e-78    
dbj|BAA88950.1|  importin alpha 1b                                      258   1e-78    
ref|NP_001054692.1|  Os05g0155500                                       258   1e-78    
ref|XP_003536050.1|  PREDICTED: importin subunit alpha-1-like           258   1e-78    
gb|KHN16078.1|  Importin subunit alpha-1                                258   2e-78    
ref|XP_003556535.1|  PREDICTED: importin subunit alpha-1-like iso...    257   4e-78    
gb|KJB09437.1|  hypothetical protein B456_001G142300                    254   6e-77    
dbj|BAE71209.1|  putative importin alpha                                252   3e-76    
ref|XP_010556709.1|  PREDICTED: importin subunit alpha-2-like           250   1e-75    
ref|XP_006644004.1|  PREDICTED: importin subunit alpha-1a-like          248   5e-75    
ref|XP_002889415.1|  hypothetical protein ARALYDRAFT_887411             242   3e-74    
ref|XP_005646985.1|  importin alpha                                     246   4e-74    
ref|XP_002872853.1|  ATIMPALPHA3/MOS6                                   246   9e-74    
ref|NP_001141568.1|  uncharacterized protein LOC100273684               245   2e-73    
ref|XP_010501290.1|  PREDICTED: importin subunit alpha-2-like           237   3e-73    
ref|XP_006289883.1|  hypothetical protein CARUB_v10003501mg             244   4e-73    
ref|XP_002894622.1|  hypothetical protein ARALYDRAFT_474778             233   5e-73    
ref|XP_006655009.1|  PREDICTED: importin subunit alpha-1b-like          243   6e-73    
ref|XP_006396421.1|  hypothetical protein EUTSA_v10028572mg             243   1e-72    
gb|KFK42624.1|  hypothetical protein AALP_AA1G019500                    242   1e-72    
ref|XP_003057280.1|  predicted protein                                  241   4e-72    
ref|XP_010429262.1|  PREDICTED: importin subunit alpha-2                241   5e-72    
gb|AFW81447.1|  hypothetical protein ZEAMMB73_731576                    241   6e-72    
ref|XP_002440631.1|  hypothetical protein SORBIDRAFT_09g004320          239   2e-71    
emb|CAA70703.1|  Kap alpha protein                                      239   4e-71    
ref|NP_192124.1|  Importin alpha 3                                      238   4e-71    
emb|CAA75514.1|  Importin alpha-like protein                            238   5e-71    
emb|CDX97257.1|  BnaA02g20480D                                          238   5e-71    
ref|XP_003609724.1|  Importin alpha-1b subunit                          238   1e-70    
gb|KEH32336.1|  importin subunit alpha                                  238   1e-70    
ref|XP_011396312.1|  Importin subunit alpha-1                           238   1e-70    
gb|KDD73677.1|  hypothetical protein H632_c1936p0                       237   1e-70    
ref|XP_005849695.1|  hypothetical protein CHLNCDRAFT_30497              237   1e-70    
ref|XP_004508265.1|  PREDICTED: importin subunit alpha-1-like           237   2e-70    
gb|EEC78554.1|  hypothetical protein OsI_18524                          236   2e-70    
ref|XP_009128526.1|  PREDICTED: importin subunit alpha-2-like           236   2e-70    
emb|CDY01921.1|  BnaC02g28060D                                          236   3e-70    
ref|XP_010495334.1|  PREDICTED: importin subunit alpha-1-like           235   4e-70    
emb|CAN74148.1|  hypothetical protein VITISV_025742                     227   7e-70    
ref|XP_004977076.1|  PREDICTED: importin subunit alpha-1b-like is...    235   7e-70    
ref|XP_006307204.1|  hypothetical protein CARUB_v10008795mg             235   9e-70    
ref|XP_010482208.1|  PREDICTED: importin subunit alpha-1-like           234   1e-69    
ref|XP_002508520.1|  predicted protein                                  234   2e-69    
ref|XP_010522816.1|  PREDICTED: importin subunit alpha-2 isoform X2     231   2e-69    
ref|NP_199742.1|  importin alpha isoform 5                              234   2e-69    
ref|XP_004977075.1|  PREDICTED: importin subunit alpha-1b-like is...    235   2e-69    
ref|NP_171769.1|  importin alpha isoform 6                              234   3e-69    
ref|NP_973743.1|  importin alpha isoform 6                              234   3e-69    
ref|XP_010474848.1|  PREDICTED: importin subunit alpha-2                233   5e-69    
ref|XP_010442392.1|  PREDICTED: importin subunit alpha-1-like           231   2e-68    
ref|XP_010440459.1|  PREDICTED: importin subunit alpha-1-like           231   3e-68    
ref|XP_010522815.1|  PREDICTED: importin subunit alpha isoform X1       231   3e-68    
gb|KJB34728.1|  hypothetical protein B456_006G080400                    230   8e-68    
ref|XP_010501291.1|  PREDICTED: importin subunit alpha-2-like           236   9e-68    
gb|ABB55384.1|  importin alpha 1-like                                   227   2e-67    
ref|XP_006280291.1|  hypothetical protein CARUB_v10026215mg             229   2e-67    
emb|CDY64806.1|  BnaCnng45030D                                          227   6e-67    
ref|XP_001419614.1|  predicted protein                                  227   8e-67    
ref|XP_009134443.1|  PREDICTED: importin subunit alpha-2-like           226   1e-66    
emb|CDX90948.1|  BnaA03g26280D                                          225   3e-66    
ref|XP_001698656.1|  importin alpha                                     225   8e-66    
gb|EWM26234.1|  Importin-alpha, importin-beta-binding domain protein    226   9e-66    
gb|AAK56273.1|AF367284_1  At1g09270/T12M4_2                             216   2e-65    
ref|XP_002957574.1|  hypothetical protein VOLCADRAFT_84159              223   3e-65    
ref|XP_009034847.1|  hypothetical protein AURANDRAFT_69702              223   5e-65    
ref|XP_010649543.1|  PREDICTED: importin subunit alpha-1 isoform X2     222   6e-65    
ref|NP_001042958.1|  Os01g0343200                                       223   9e-65    
emb|CEF99159.1|  Armadillo-type fold                                    221   1e-64    
ref|XP_006301945.1|  hypothetical protein CARUB_v10022422mg             219   4e-64    
gb|KDO87077.1|  hypothetical protein CISIN_1g009679mg                   219   4e-64    
ref|XP_007510824.1|  predicted protein                                  219   1e-63    
ref|NP_001031011.1|  importin alpha isoform 4                           217   1e-63    
ref|XP_005707794.1|  importin alpha                                     219   1e-63    
ref|XP_002519264.1|  importin alpha, putative                           216   2e-63    
ref|XP_009781700.1|  PREDICTED: importin subunit alpha-1-like iso...    216   2e-63    
gb|KHG14170.1|  Importin subunit alpha-1 -like protein                  214   4e-63    
gb|KDO52349.1|  hypothetical protein CISIN_1g042204mg                   218   4e-63    
gb|KIY97690.1|  Importin subunit alpha-1                                209   5e-63    
gb|ABE66234.1|  importin alpha-1 subunit                                214   7e-63    
ref|XP_007035863.1|  Importin alpha, putative                           218   8e-63    
ref|XP_002515324.1|  importin alpha, putative                           214   1e-62    
emb|CDY05638.1|  BnaC02g38990D                                          216   1e-62    
emb|CDX89948.1|  BnaA10g01340D                                          216   1e-62    
gb|KJB41861.1|  hypothetical protein B456_007G124900                    214   2e-62    
ref|XP_006645862.1|  PREDICTED: importin subunit alpha-1b-like          216   2e-62    
gb|KDO38014.1|  hypothetical protein CISIN_1g0355071mg                  216   2e-62    
ref|XP_010456072.1|  PREDICTED: importin subunit alpha-2                215   2e-62    
ref|XP_006494505.1|  PREDICTED: importin subunit alpha-1a-like          218   4e-62    
gb|KDO71825.1|  hypothetical protein CISIN_1g009544mg                   213   4e-62    
ref|XP_004495675.1|  PREDICTED: importin subunit alpha-1b-like is...    213   5e-62    
ref|XP_009119620.1|  PREDICTED: importin subunit alpha-1                214   5e-62    
ref|XP_004306871.1|  PREDICTED: importin subunit alpha-1-like           214   8e-62    
pdb|4BPL|A  Chain A, Rice Importin_alpha In Complex With Nucleopl...    212   1e-61    
pdb|4BQK|A  Chain A, Rice Importin_alpha : Vird2nls Complex             212   1e-61    
pdb|4BQK|B  Chain B, Rice Importin_alpha : Vird2nls Complex             212   1e-61    
ref|XP_005705411.1|  importin alpha                                     213   1e-61    
pdb|2YNS|A  Chain A, Rimp_alpha_b54nls                                  212   2e-61    
ref|XP_010921406.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    207   2e-61    
ref|XP_006480868.1|  PREDICTED: uncharacterized protein LOC102608919    219   3e-61    
ref|WP_028833024.1|  hypothetical protein                               213   5e-61    
gb|KDO38489.1|  hypothetical protein CISIN_1g043950mg                   207   6e-60    
ref|XP_009129776.1|  PREDICTED: importin subunit alpha-1-like           209   6e-60    
emb|CBN79488.1|  conserved unknown protein                              209   1e-59    
emb|CDY33917.1|  BnaA02g30700D                                          207   2e-59    
ref|XP_005710150.1|  Predicted protein                                  208   4e-59    
gb|ETI56773.1|  hypothetical protein, variant 2                         205   5e-59    
ref|XP_009523333.1|  hypothetical protein PHYSODRAFT_354318             206   7e-59    
ref|XP_010524836.1|  PREDICTED: importin subunit alpha                  206   7e-59    
emb|CDY15260.1|  BnaC05g01390D                                          209   9e-59    
ref|XP_005758728.1|  hypothetical protein EMIHUDRAFT_460128             206   9e-59    
ref|XP_005778844.1|  hypothetical protein EMIHUDRAFT_421349             206   1e-58    
ref|XP_008890414.1|  hypothetical protein PPTG_00708                    206   1e-58    
ref|XP_006471714.1|  PREDICTED: importin subunit alpha-1-like iso...    202   3e-58    
gb|KDO37705.1|  hypothetical protein CISIN_1g039940mg                   202   4e-58    
gb|KDO38849.1|  hypothetical protein CISIN_1g037562mg                   207   4e-58    
ref|XP_010424664.1|  PREDICTED: importin subunit alpha-2-like           204   4e-58    
ref|XP_002295213.1|  importin alpha 1 subunit-like protein              205   5e-58    
ref|XP_645137.1|  hypothetical protein DDB_G0272318                     204   5e-58    
ref|XP_003081334.1|  putative importin alpha 2 (ISS)                    204   1e-57    
ref|XP_002896684.1|  importin alpha-2 subunit                           202   2e-57    
ref|XP_003293360.1|  hypothetical protein DICPUDRAFT_50915              202   2e-57    
ref|XP_003880299.1|  mgc78841 protein, related                          202   2e-57    
ref|XP_003610377.1|  Importin alpha-1b subunit                          200   3e-57    
dbj|GAM20445.1|  hypothetical protein SAMD00019534_036200               201   8e-57    
ref|XP_004350967.1|  putative importin subunit alpha B                  200   8e-57    
ref|XP_002182420.1|  predicted protein                                  201   8e-57    
ref|XP_006471709.1|  PREDICTED: importin subunit alpha-1a-like is...    203   1e-56    
ref|XP_008609577.1|  hypothetical protein SDRG_05629                    200   1e-56    
ref|XP_006395074.1|  hypothetical protein EUTSA_v10005613mg             199   2e-56    
gb|KDO42368.1|  hypothetical protein CISIN_1g043676mg                   198   2e-56    
ref|XP_006494499.1|  PREDICTED: importin subunit alpha-1a-like          199   3e-56    
gb|KDO44063.1|  hypothetical protein CISIN_1g043116mg                   198   3e-56    
emb|CEI88676.1|  Putative Importin subunit alpha                        197   6e-56    
ref|XP_006471713.1|  PREDICTED: importin subunit alpha-1-like iso...    205   6e-56    
gb|EMS18091.1|  karyopherin alpha subunit                               198   8e-56    
ref|XP_008870934.1|  hypothetical protein H310_07333                    198   9e-56    
gb|KIO22825.1|  hypothetical protein M407DRAFT_27697                    197   2e-55    
gb|EFA85470.1|  putative importin subunit alpha B                       196   3e-55    
gb|KIR27323.1|  importin subunit alpha-2                                193   4e-55    
ref|XP_008617625.1|  hypothetical protein SDRG_13323                    196   4e-55    
gb|KIK28373.1|  hypothetical protein PISMIDRAFT_27425                   196   4e-55    
gb|KIO08364.1|  hypothetical protein M404DRAFT_134449                   196   4e-55    
ref|XP_006471707.1|  PREDICTED: importin subunit alpha-1a-like          197   8e-55    
ref|XP_006494502.1|  PREDICTED: uncharacterized protein LOC102607524    201   9e-55    
gb|ETI56774.1|  hypothetical protein, variant 3                         192   1e-54    
ref|XP_570493.1|  Importin alpha subunit                                195   2e-54    
ref|XP_012049493.1|  importin alpha subunit                             195   2e-54    
gb|KDO24211.1|  hypothetical protein SPRG_10640                         194   2e-54    
gb|KGB75088.1|  importin alpha subunit                                  194   2e-54    
gb|KDE02770.1|  importin subunit alpha-1                                194   3e-54    
gb|KDO21399.1|  hypothetical protein SPRG_12405                         194   3e-54    
gb|EPB84773.1|  hypothetical protein HMPREF1544_08495                   194   3e-54    
gb|ETI56772.1|  hypothetical protein, variant 1                         192   3e-54    
dbj|GAN09362.1|  importin alpha protein                                 198   4e-54    
gb|KIR49675.1|  importin alpha subunit                                  194   4e-54    
ref|XP_003193818.1|  importin alpha subunit                             194   5e-54    
gb|KIR68731.1|  importin alpha subunit                                  193   5e-54    
gb|KIJ21842.1|  hypothetical protein PAXINDRAFT_165213                  193   6e-54    
ref|XP_009826144.1|  hypothetical protein, variant                      196   7e-54    
ref|XP_002369337.1|  importin alpha, putative                           193   8e-54    
gb|KIL00238.1|  hypothetical protein PAXRUDRAFT_301824                  192   1e-53    
ref|XP_003610333.1|  Importin alpha-1b subunit                          192   1e-53    
gb|EMD41978.1|  hypothetical protein CERSUDRAFT_79582                   192   1e-53    
emb|CCF46291.1|  importin subunit alpha-1                               186   1e-53    
ref|XP_009826143.1|  hypothetical protein H257_03655                    195   1e-53    
ref|XP_008888584.1|  importin alpha, putative                           192   2e-53    
gb|KDO32844.1|  importin subunit alpha-1b                               191   3e-53    
gb|KIK46434.1|  hypothetical protein CY34DRAFT_800441                   191   3e-53    
ref|XP_007792839.1|  putative importin alpha subunit protein            192   3e-53    
emb|CDO73502.1|  hypothetical protein BN946_scf185013.g137              197   4e-53    
ref|XP_010464114.1|  PREDICTED: importin subunit alpha-1a-like is...    191   4e-53    
ref|XP_007360420.1|  importin alpha protein                             191   6e-53    
ref|XP_001873151.1|  predicted protein                                  191   6e-53    
gb|KIJ68553.1|  hypothetical protein HYDPIDRAFT_82295                   190   8e-53    
ref|XP_007004966.1|  hypothetical protein TREMEDRAFT_39274              190   8e-53    
ref|XP_008032837.1|  importin alpha protein                             190   1e-52    
ref|XP_007406517.1|  hypothetical protein MELLADRAFT_42367              190   1e-52    
ref|XP_003038549.1|  hypothetical protein SCHCODRAFT_72999              190   1e-52    
emb|CCU98302.1|  unnamed protein product                                190   1e-52    
emb|CCI11425.1|  unnamed protein product                                189   1e-52    
ref|NP_187223.1|  importin alpha isoform 7                              189   1e-52    
gb|EPT04015.1|  hypothetical protein FOMPIDRAFT_1028341                 189   1e-52    
ref|XP_007842722.1|  karyopherin alpha                                  189   1e-52    
gb|EJT97763.1|  importin alpha protein                                  189   2e-52    
gb|EIE85311.1|  hypothetical protein RO3G_10021                         189   2e-52    
ref|XP_007298970.1|  ARM repeat-containing protein                      189   2e-52    
ref|XP_010431108.1|  PREDICTED: importin subunit alpha-like isofo...    189   3e-52    
gb|KDN38320.1|  putative SRP1-importin alpha                            189   3e-52    
ref|XP_006494500.1|  PREDICTED: disease resistance protein At4g27...    194   3e-52    
ref|XP_006408037.1|  hypothetical protein EUTSA_v10020485mg             189   3e-52    
ref|XP_006494501.1|  PREDICTED: disease resistance protein At4g27...    194   3e-52    
ref|XP_002680607.1|  predicted protein                                  188   4e-52    
gb|KDQ63501.1|  hypothetical protein JAAARDRAFT_53706                   188   4e-52    
gb|KFH71790.1|  hypothetical protein MVEG_02085                         188   4e-52    
ref|XP_003329973.1|  hypothetical protein PGTG_11910                    188   5e-52    
gb|EQL01104.1|  importin alpha subunit                                  188   5e-52    
ref|XP_007603088.1|  hypothetical protein CFIO01_06933                  188   6e-52    
gb|KIM27889.1|  hypothetical protein M408DRAFT_70588                    187   6e-52    
dbj|GAM27870.1|  hypothetical protein SAMD00019534_110460               187   6e-52    
gb|KII93866.1|  hypothetical protein PLICRDRAFT_100750                  188   6e-52    
ref|XP_006454698.1|  hypothetical protein AGABI2DRAFT_189943            187   7e-52    
ref|XP_007325432.1|  hypothetical protein AGABI1DRAFT_110161            187   7e-52    
gb|EFQ28134.1|  hypothetical protein GLRG_03278                         188   7e-52    
gb|KFH71830.1|  hypothetical protein MVEG_02124                         187   7e-52    
ref|XP_001828605.1|  importin alpha protein                             187   8e-52    
gb|KJZ80544.1|  Importin subunit alpha-1                                188   8e-52    
ref|XP_002891339.1|  hypothetical protein ARALYDRAFT_891491             181   9e-52    
gb|KIM66284.1|  hypothetical protein SCLCIDRAFT_22128                   187   9e-52    
gb|KGQ10557.1|  Importin subunit alpha-1                                187   1e-51    
ref|XP_007265569.1|  importin alpha protein                             187   1e-51    
ref|XP_008594141.1|  importin alpha subunit                             187   1e-51    
gb|EFX01103.1|  karyopherin alpha-1-like protein                        187   1e-51    
gb|AES92530.2|  importin subunit alpha-like protein                     186   1e-51    
gb|KKA29239.1|  hypothetical protein TD95_002060                        187   1e-51    
emb|CCA14786.1|  importin alpha 1 subunitlike protein putative          187   1e-51    
ref|XP_007860972.1|  ARM repeat-containing protein                      187   2e-51    
gb|ENH78870.1|  importin alpha subunit                                  187   2e-51    
gb|KIK05517.1|  hypothetical protein K443DRAFT_675073                   187   2e-51    



>ref|XP_002512528.1| importin alpha, putative [Ricinus communis]
 gb|EEF49980.1| importin alpha, putative [Ricinus communis]
Length=450

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 188/201 (94%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP TRTEVRKKSYK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQH+
Sbjct  1    MSLRPSTRTEVRKKSYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQHL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LDASQ+  A +KRLE IP+MVQGVWS+DPA Q+EATTQFRKLLSIERSPPIDEVIKAGVV
Sbjct  61   LDASQNADAVEKRLESIPVMVQGVWSDDPASQLEATTQFRKLLSIERSPPIDEVIKAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLL S SDDVREQ
Sbjct  121  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPLFVQLLGSASDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP+CRDLVLG
Sbjct  181  AVWALGNVAGDSPSCRDLVLG  201



>ref|XP_004230322.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=534

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 186/201 (93%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP  RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +L SQ +
Sbjct  1    MSLRPSNRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLHSQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             DA+Q+PAA +KRLE IP+MVQGVWSEDPA Q+EATT FRKLLSIERSPPIDEVIKAGV+
Sbjct  61   PDATQTPAAIEKRLESIPIMVQGVWSEDPAAQVEATTHFRKLLSIERSPPIDEVIKAGVI  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R DLPQLQFEAAWALTNVASGTSEHTRVVI+HGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRQDLPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPMFVQLLSSTSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP+CRDLVLG
Sbjct  181  AVWALGNVAGDSPSCRDLVLG  201



>ref|XP_009592620.1| PREDICTED: importin subunit alpha-1 [Nicotiana tomentosiformis]
Length=531

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 187/200 (94%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRPGTRTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQ +
Sbjct  1    MSLRPGTRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             DA   PAA +KRLE IPLMVQGVWSEDPA Q+EATT FRKLLSIERSPPIDEVIKAGVV
Sbjct  61   PDA---PAAIEKRLESIPLMVQGVWSEDPAAQVEATTHFRKLLSIERSPPIDEVIKAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTR+VI+HGAVPKF+QLLSS SDDVREQ
Sbjct  118  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRIVIDHGAVPKFVQLLSSASDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  178  AVWALGNVAGDSPSCRDLVL  197


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI   V+P   Q L +N    ++ EA W ++N+ +G     + VIE   +P  + LL S 
Sbjct  322  VIDNQVLPCLCQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVIEANIIPPLVHLLQSA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_009796205.1| PREDICTED: importin subunit alpha-1 [Nicotiana sylvestris]
Length=531

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/200 (88%), Positives = 187/200 (94%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRPGTRTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQ +
Sbjct  1    MSLRPGTRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             DA   PAA +KRLE IPLMVQGVWSEDPA Q+EATT FRKLLSIERSPPIDEVIKAGVV
Sbjct  61   PDA---PAAIEKRLESIPLMVQGVWSEDPAAQVEATTHFRKLLSIERSPPIDEVIKAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTR+VI+HGAVPKF+QLLSS SDDVREQ
Sbjct  118  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRIVIDHGAVPKFVQLLSSASDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  178  AVWALGNVAGDSPSCRDLVL  197


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI   V+P   Q L +N    ++ EA W ++N+ +G     + VIE   +P  + LL S 
Sbjct  322  VIDNQVLPCLCQLLTQNHKKSIKKEACWTISNITAGNKAQIQAVIEANIIPPLVHLLQSA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_012088870.1| PREDICTED: importin subunit alpha-4 isoform X2 [Jatropha curcas]
Length=534

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 188/202 (93%), Gaps = 2/202 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP TRTEVRKK+YK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQ++
Sbjct  1    MSLRPSTRTEVRKKAYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQNL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            +DASQ+ AA +KRLE IP+MVQGVWS DP +Q++ATTQFRKLLSIERSPPIDEVIKAGVV
Sbjct  61   VDASQNAAAVEKRLESIPVMVQGVWSNDPGLQLDATTQFRKLLSIERSPPIDEVIKAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLL S SDDVREQ
Sbjct  121  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLGSASDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLGM  740
            AVWALGNVAGDSP+CRDLVLG 
Sbjct  181  AVWALGNVAGDSPSCRDLVLGY  202



>ref|XP_006344784.1| PREDICTED: importin subunit alpha-1 [Solanum tuberosum]
Length=534

 Score =   321 bits (822),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP  RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +L SQ +
Sbjct  1    MSLRPSNRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLHSQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             DA+Q+P A +KRLE IP+MVQGVWSEDPA QIEATT FRKLLSIERSPPIDEVIKAGV+
Sbjct  61   PDATQTPDAIEKRLESIPIMVQGVWSEDPAAQIEATTHFRKLLSIERSPPIDEVIKAGVI  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R DLPQLQFEAAWALTNVASGTSEHTRVVI+HGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRQDLPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPMFVQLLSSTSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            A+WALGNVAGDSP+CRDLVL
Sbjct  181  AIWALGNVAGDSPSCRDLVL  200



>ref|XP_002281670.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CBI39614.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 186/202 (92%), Gaps = 3/202 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRPG+RT+VRKKSYK GVDA+EARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQ  
Sbjct  1    MSLRPGSRTDVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDNLLKKRREGLILQSQQF  60

Query  315  L-DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
              DASQ+ A  +KRLE I LMVQGVWS+DPA Q+EATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   SSDASQTTAVVEKRLESITLMVQGVWSDDPASQLEATTQFRKLLSIERSPPIDEVIKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  121  VPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSASDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVLG  737
            QAVWALGNVAGDSP+CRDLVLG
Sbjct  181  QAVWALGNVAGDSPSCRDLVLG  202



>ref|XP_012088868.1| PREDICTED: importin subunit alpha-4 isoform X1 [Jatropha curcas]
 gb|KDP23371.1| hypothetical protein JCGZ_23204 [Jatropha curcas]
Length=535

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 188/203 (93%), Gaps = 3/203 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP TRTEVRKK+YK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQ++
Sbjct  1    MSLRPSTRTEVRKKAYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQNL  60

Query  315  LDASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            +DASQ+ AA +KR LE IP+MVQGVWS DP +Q++ATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   VDASQNAAAVEKRQLESIPVMVQGVWSNDPGLQLDATTQFRKLLSIERSPPIDEVIKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLL S SDDVRE
Sbjct  121  VPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLGSASDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVLGM  740
            QAVWALGNVAGDSP+CRDLVLG 
Sbjct  181  QAVWALGNVAGDSPSCRDLVLGY  203



>ref|XP_002319478.1| importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE95401.1| importin alpha-1 subunit family protein [Populus trichocarpa]
Length=537

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 188/203 (93%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL----QSQ  308
            MSLRPGTRTEVRKKSYK GVDADEARRRREDNL+EIRK+KREDNLLKKRRE L    QSQ
Sbjct  1    MSLRPGTRTEVRKKSYKTGVDADEARRRREDNLLEIRKNKREDNLLKKRREGLLFQSQSQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
             +LDA+Q  A  +K+LE +P+MVQGVWS+DP++Q+EATTQFRKLLSIERSPPID+VIKAG
Sbjct  61   PLLDAAQHAANIEKKLESLPMMVQGVWSDDPSLQLEATTQFRKLLSIERSPPIDDVIKAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVI+HGAVP F+QLLSS SDDVR
Sbjct  121  VVPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPMFVQLLSSGSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP+CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPSCRDLVLG  203



>ref|XP_011023801.1| PREDICTED: importin subunit alpha [Populus euphratica]
Length=537

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 188/203 (93%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL----QSQ  308
            MSLRPGTRTEVRKKSYK GVDADEARRRREDNL+EIRK+KREDNLLKKRRE L    QSQ
Sbjct  1    MSLRPGTRTEVRKKSYKTGVDADEARRRREDNLLEIRKNKREDNLLKKRREGLLFQSQSQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
             +LDA+Q  A  +K+LE +P+MVQGVWS+DP++Q+EATTQFRKLLSIERSPPID+VIKAG
Sbjct  61   PLLDAAQHAANIEKKLESLPVMVQGVWSDDPSLQLEATTQFRKLLSIERSPPIDDVIKAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVI+HGAVP F+QLLSS SDDVR
Sbjct  121  VVPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPMFVQLLSSGSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP+CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPSCRDLVLG  203



>gb|AAK38726.1|AF369706_1 importin alpha 1 [Capsicum annuum]
Length=535

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 184/201 (92%), Gaps = 3/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL---QSQH  311
            MSLRP TRTEVRKK+YKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE L     Q 
Sbjct  1    MSLRPSTRTEVRKKAYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLFHSQQQ  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            + DA+Q+P A +KRLE IP+MVQGVWSEDPA QIEATT FRKLLSIERSPPIDEVIKAGV
Sbjct  61   LPDAAQTPDAIEKRLESIPVMVQGVWSEDPAAQIEATTHFRKLLSIERSPPIDEVIKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            +PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVI+HGAVP F+QLLSS SDDVRE
Sbjct  121  IPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPMFVQLLSSASDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVL  734
            QAVWALGNVAGDSP+CRDLVL
Sbjct  181  QAVWALGNVAGDSPSCRDLVL  201



>ref|XP_008246117.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=533

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 183/201 (91%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL--QSQHV  314
            MSLRPGTRTEVRKKSYK GVDAD+ARRRREDNLVEIRK+KREDNLLKKRRE L    Q +
Sbjct  1    MSLRPGTRTEVRKKSYKTGVDADQARRRREDNLVEIRKNKREDNLLKKRREGLPPSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD +Q+    +KRLE IP MVQGVWS+DPA+Q+EATTQFRKLLSIERSPPIDEVIKAG V
Sbjct  61   LDGTQTAVVFEKRLESIPSMVQGVWSDDPALQLEATTQFRKLLSIERSPPIDEVIKAGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+D+PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRHDMPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPMFVQLLSSGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP+CRDLVLG
Sbjct  181  AVWALGNVAGDSPSCRDLVLG  201


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI   V+PR  Q L +N    ++ EA W ++N+ +G     + VIE   +   +QLL   
Sbjct  325  VIDNQVLPRLHQLLTQNHKKSIKKEACWTISNITAGNKIQIQAVIEADIILPLVQLLQHA  384

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  385  EFDIKKEAAWAISN  398



>ref|XP_010267916.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RT+VRKKSYK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQ+Q   
Sbjct  1    MSLRPSSRTDVRKKSYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQAQQPA  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
            + SQ+ +  +K+LE +P+MVQGVWS++PA+Q+EATTQFRKLLSIERSPPI+EVIKAGVVP
Sbjct  61   ELSQATSGTEKKLESLPVMVQGVWSDNPALQLEATTQFRKLLSIERSPPIEEVIKAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FLER+DLPQLQFEAAWALTN+ASGTSEHTRVVI+HGAVPKF+QLLSS SDDVREQA
Sbjct  121  RFVEFLERHDLPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPKFVQLLSSSSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVLG  737
            VWALGNVAGDSPTCRDLVLG
Sbjct  181  VWALGNVAGDSPTCRDLVLG  200



>ref|XP_007205030.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
 gb|EMJ06229.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
Length=533

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 183/201 (91%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL--QSQHV  314
            MSLRPGTRTEVRKKSYK GVDAD+ARRRREDNLVEIRK+KREDNLLKKRRE L    Q +
Sbjct  1    MSLRPGTRTEVRKKSYKTGVDADQARRRREDNLVEIRKNKREDNLLKKRREGLPPSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD +Q+    +KRLE IP MVQGVWS+DPA+Q+EATTQFRKLLSIERSPPIDEVIKAG V
Sbjct  61   LDGTQTAVVFEKRLESIPSMVQGVWSDDPALQLEATTQFRKLLSIERSPPIDEVIKAGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+D+PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRHDMPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPMFVQLLSSGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP+CRDLVLG
Sbjct  181  AVWALGNVAGDSPSCRDLVLG  201



>gb|KJB26294.1| hypothetical protein B456_004G235800 [Gossypium raimondii]
Length=537

 Score =   316 bits (809),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 185/202 (92%), Gaps = 3/202 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE---VLQSQH  311
            MSLRPG+RTEVRKKSYK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE   +   Q 
Sbjct  1    MSLRPGSRTEVRKKSYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQQP  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            +LDA Q+ AA +KRLE IPLMVQGVWSEDPA Q+EATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   LLDAVQNAAAIEKRLESIPLMVQGVWSEDPASQLEATTQFRKLLSIERSPPIDEVIKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  121  VPRFVEFLGRQDVPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSASDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVLG  737
            QAVWALGNVAGDSP+CRDLVLG
Sbjct  181  QAVWALGNVAGDSPSCRDLVLG  202



>ref|XP_011092170.1| PREDICTED: importin subunit alpha [Sesamum indicum]
Length=540

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 184/207 (89%), Gaps = 8/207 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP +RT+VRKKSYKIGVDA+EARRRREDNLVEIRK+KREDNLLKKRRE L S     
Sbjct  1    MSLRPSSRTDVRKKSYKIGVDAEEARRRREDNLVEIRKNKREDNLLKKRREGLLSGSFPL  60

Query  315  ------LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEV  476
                  LD  QS AA +K+LE IPLMVQGVWS DP+ Q+EATTQFRKLLSIERSPPIDEV
Sbjct  61   QPQLFPLDPVQSSAAIEKKLESIPLMVQGVWSNDPSAQVEATTQFRKLLSIERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKF+QLLSS S
Sbjct  121  IKAGVIPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFVQLLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVLG  737
            DDVREQAVWALGNVAGDSP+CRDLVLG
Sbjct  181  DDVREQAVWALGNVAGDSPSCRDLVLG  207


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 48/94 (51%), Gaps = 3/94 (3%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI   V+P   Q L +N    ++ EA W ++N+ +G     + VI+   +P  +QLL   
Sbjct  331  VIDNQVLPCLQQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIQADIIPPLVQLLEHA  390

Query  654  SDDVREQAVWALGN-VAGDSPTCRDLVLGMVHSC  752
              +++++A WA+ N  +G SP    + L   H C
Sbjct  391  EFEIKKEAAWAIFNATSGGSPA--QIRLLASHGC  422



>ref|XP_008370371.1| PREDICTED: importin subunit alpha-like [Malus domestica]
Length=532

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS--QHV  314
            MSLRPGTRT+VRKKSYK GVDA+EARRRREDNLVEIRK+KRED+LLKKRRE L    Q +
Sbjct  1    MSLRPGTRTDVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDSLLKKRREGLSQSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD SQS    +KRLE IP +VQGVWS+DPA+Q+EATTQFRKLLSIERSPPIDEV KAG V
Sbjct  61   LDGSQSAVVLEKRLESIPALVQGVWSDDPALQLEATTQFRKLLSIERSPPIDEVJKAGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLS+ SDDVREQ
Sbjct  121  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSAGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP CRDLVLG
Sbjct  181  AVWALGNVAGDSPNCRDLVLG  201



>ref|XP_007031183.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY11685.1| Importin alpha isoform 1 [Theobroma cacao]
Length=536

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 184/202 (91%), Gaps = 3/202 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE---VLQSQH  311
            MSLRP TRTEVRKK YK GVDA+EARRRREDNLVEIRK+KREDNLLKKRRE   +   Q 
Sbjct  1    MSLRPSTRTEVRKKGYKTGVDAEEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQQP  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            +LDA+Q+ AA +KRLE IPLMVQGVWS+DPA Q+EATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   LLDAAQNAAAIEKRLESIPLMVQGVWSDDPASQLEATTQFRKLLSIERSPPIDEVIKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  121  VPRFVEFLGRQDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSASDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVLG  737
            QAVWALGNVAGDSP+CRDLVLG
Sbjct  181  QAVWALGNVAGDSPSCRDLVLG  202


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI+  V+P   Q L +N    ++ EA W ++N+ +G     + VIE   +   + LL   
Sbjct  326  VIENKVLPHLYQLLVQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILPLVHLLQHA  385

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  386  EFDIKKEAAWAISN  399



>ref|XP_007031184.1| Importin alpha isoform 2 [Theobroma cacao]
 gb|EOY11686.1| Importin alpha isoform 2 [Theobroma cacao]
Length=540

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 184/202 (91%), Gaps = 3/202 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE---VLQSQH  311
            MSLRP TRTEVRKK YK GVDA+EARRRREDNLVEIRK+KREDNLLKKRRE   +   Q 
Sbjct  1    MSLRPSTRTEVRKKGYKTGVDAEEARRRREDNLVEIRKNKREDNLLKKRREGLLLQSQQP  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            +LDA+Q+ AA +KRLE IPLMVQGVWS+DPA Q+EATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   LLDAAQNAAAIEKRLESIPLMVQGVWSDDPASQLEATTQFRKLLSIERSPPIDEVIKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  121  VPRFVEFLGRQDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSASDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVLG  737
            QAVWALGNVAGDSP+CRDLVLG
Sbjct  181  QAVWALGNVAGDSPSCRDLVLG  202


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI+  V+P   Q L +N    ++ EA W ++N+ +G     + VIE   +   + LL   
Sbjct  330  VIENKVLPHLYQLLVQNHKKSIKKEACWTISNITAGNRTQIQAVIEANIILPLVHLLQHA  389

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  390  EFDIKKEAAWAISN  403



>ref|XP_009373302.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009373303.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=534

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 180/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS--QHV  314
            MSLRPGTRT+VRKKSYK GVDA+EARRRREDNLVEIRK+KRED+LLKKRRE L    Q +
Sbjct  1    MSLRPGTRTDVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDSLLKKRREGLSQSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD SQS    +KRLE IP MVQGVWS DPA+Q++ATTQFRKLLSIERSPPIDEVIK G V
Sbjct  61   LDGSQSTVVLEKRLESIPSMVQGVWSNDPALQLDATTQFRKLLSIERSPPIDEVIKTGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP CRDLVLG
Sbjct  181  AVWALGNVAGDSPNCRDLVLG  201



>ref|XP_009337642.1| PREDICTED: importin subunit alpha-like isoform X2 [Pyrus x bretschneideri]
Length=532

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS--QHV  314
            MSLRPGTRT+VRKKSYK GVDA+EARRRREDNLVEIRK+KRED+LLKKRRE L    Q +
Sbjct  1    MSLRPGTRTDVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDSLLKKRREGLSQSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD SQS    +KRLE IP +VQGVWS DPA+Q+EATTQFRKLLSIERSPPIDEVIKAG V
Sbjct  61   LDGSQSGVVLEKRLESIPSLVQGVWSNDPALQLEATTQFRKLLSIERSPPIDEVIKAGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLS+ SDDVREQ
Sbjct  121  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSAGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP CRDLVLG
Sbjct  181  AVWALGNVAGDSPNCRDLVLG  201



>ref|XP_008388467.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=534

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 179/201 (89%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS--QHV  314
            MSLRPGTR +VRKKSYK GVDA+EARRRREDNLVEIRK+KRED+LLKKRRE L    Q +
Sbjct  1    MSLRPGTRADVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDSLLKKRREGLSQSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD SQS    +KRLE IP MVQGVWS DPA+Q+EATTQFRKLLSIERSPPIDE IKAG V
Sbjct  61   LDGSQSTFVLEKRLESIPSMVQGVWSNDPALQLEATTQFRKLLSIERSPPIDEXIKAGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP CRDLVLG
Sbjct  181  AVWALGNVAGDSPNCRDLVLG  201



>ref|XP_008453295.1| PREDICTED: importin subunit alpha [Cucumis melo]
Length=536

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP TRT+VRKKSYK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +L SQ +
Sbjct  1    MSLRPTTRTDVRKKSYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLHSQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LDA+Q+  A +KRLE IP++VQGVWS D A Q+EATTQFRKLLSIERSPPIDEVIKAGVV
Sbjct  61   LDAAQNAVAAEKRLESIPVLVQGVWSADTAGQLEATTQFRKLLSIERSPPIDEVIKAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            P+FV+FL R+DLPQLQFEAAWALTN+ASGTSEHTRVVI+HGAVP F+QLLSS SDDVREQ
Sbjct  121  PKFVEFLGRHDLPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPIFVQLLSSGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  181  AVWALGNVAGDSPSCRDLVL  200



>ref|XP_004144743.1| PREDICTED: importin subunit alpha-4 [Cucumis sativus]
 gb|KGN61011.1| hypothetical protein Csa_2G034640 [Cucumis sativus]
Length=537

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 184/200 (92%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP TRT+VRKKSYK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE  +L SQ +
Sbjct  1    MSLRPTTRTDVRKKSYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLHSQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LDA+Q+  A +KRLE IP++VQGVWS D A Q+EATTQFRKLLSIERSPPIDEVIKAGVV
Sbjct  61   LDAAQNAVAAEKRLESIPVLVQGVWSADTAGQLEATTQFRKLLSIERSPPIDEVIKAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            P+FV+FL R+DLPQLQFEAAWALTN+ASGTSEHTRVVI+HGAVP F+QLLSS SDDVREQ
Sbjct  121  PKFVEFLGRHDLPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPIFVQLLSSGSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  181  AVWALGNVAGDSPSCRDLVL  200



>ref|XP_004302281.1| PREDICTED: importin subunit alpha-4 [Fragaria vesca subsp. vesca]
Length=531

 Score =   311 bits (797),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +RTE RKKSYK GVDAD+ARRRREDNLVEIRK+KRED+LLKKRRE L +  +LD
Sbjct  1    MSLRPNSRTESRKKSYKSGVDADDARRRREDNLVEIRKNKREDSLLKKRREGLSNSQLLD  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S +P   +KRLE IP MVQG+WS DPA+Q+EATTQFRKLLSIERSPPIDEVIKAG VPR
Sbjct  61   GSANPVVVEKRLESIPAMVQGIWSNDPALQLEATTQFRKLLSIERSPPIDEVIKAGAVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVREQAV
Sbjct  121  FVEFLGRQDMPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPLFVQLLSSGSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP+CRDLVL
Sbjct  181  WALGNVAGDSPSCRDLVL  198


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI+ GV+P   Q L +N    ++ EA W ++N+ +G     + VI+   +   +QLL   
Sbjct  323  VIENGVLPCLYQLLNQNHKKSIKKEACWTISNITAGNKAQIQAVIDAQIINPLVQLLQHA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396



>gb|EYU38410.1| hypothetical protein MIMGU_mgv1a004192mg [Erythranthe guttata]
Length=540

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 181/205 (88%), Gaps = 6/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL------Q  302
            MSLRP +R EVRKK YK GVDA++ARRRREDNLVEIRK+KRED+LLKKRRE L      Q
Sbjct  1    MSLRPNSRAEVRKKGYKTGVDAEDARRRREDNLVEIRKNKREDSLLKKRREGLPNGSFPQ  60

Query  303  SQHVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
               + D SQ+PAA +K+LE IPLMVQGVWSEDP  Q+EATTQFRKLLSIERSPPIDEVIK
Sbjct  61   QPQLFDPSQTPAAIEKKLESIPLMVQGVWSEDPNAQLEATTQFRKLLSIERSPPIDEVIK  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            AGV+PRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDD
Sbjct  121  AGVIPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPNFVQLLSSASDD  180

Query  663  VREQAVWALGNVAGDSPTCRDLVLG  737
            VREQAVWALGNVAGDSPT RDLVLG
Sbjct  181  VREQAVWALGNVAGDSPTYRDLVLG  205


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI   V+P   Q L +N    ++ EA W ++N+ +G     + VI+   +   +QLL   
Sbjct  329  VIDNQVLPYLQQLLTQNHKKSIKKEACWTISNITAGNRAQIQAVIQADILLPLVQLLQHA  388

Query  654  SDDVREQAVWALGN-VAGDSP  713
              D++++A WA+ N  +G SP
Sbjct  389  EFDIKKEAAWAISNATSGGSP  409



>ref|XP_010270837.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYK GVD DEARRRREDNLVEIRK+KREDNLLKKRRE  LQ+Q   
Sbjct  1    MSLRPNSRTEVRKKSYKTGVDGDEARRRREDNLVEIRKNKREDNLLKKRREGFLQAQQPT  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
            + SQ+    +K+LE +PLMVQGVWS++PA Q+EATTQFRKLLSIERSPPI+EVIKAGVVP
Sbjct  61   ELSQAAPGIEKKLESLPLMVQGVWSDNPASQLEATTQFRKLLSIERSPPIEEVIKAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R+DLPQLQFEAAWALTN+ASGTSEHTRVVI+HGAVPKF+QLLSS SDDVREQA
Sbjct  121  RFVEFLGRHDLPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPKFVQLLSSSSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVLG  737
            VWALGNVAGDSP CRDLVLG
Sbjct  181  VWALGNVAGDSPQCRDLVLG  200



>ref|XP_010914627.1| PREDICTED: importin subunit alpha isoform X2 [Elaeis guineensis]
Length=533

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSATAA  60

Query  321  ASQ--SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            A+Q   P A +K+LE +P MVQGVWS+DPAVQ+EATTQFRKLLSIERSPPI+EVIK GVV
Sbjct  61   AAQLDHPTAIEKKLESLPGMVQGVWSDDPAVQLEATTQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLL+SPSDDVREQ
Sbjct  121  PRFVEFLARYDMPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLTSPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSPTCRD VL
Sbjct  181  AVWALGNVAGDSPTCRDFVL  200


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = +3

Query  333  PAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQF  512
            PA  D+    +P++ Q + S D  V  +A       LS   +  I  VI+AGV PR ++ 
Sbjct  237  PAPFDQTKVALPVLRQLIHSTDEEVLTDACWAL-SYLSDGTNDKIQSVIEAGVCPRLIEL  295

Query  513  LERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWAL  689
            L  +  P +   A   + N+ +G    T+VVI++ A+P   QLL+ +    ++++A W +
Sbjct  296  L-LHPSPTVLIPALRTVGNIVTGDDAQTQVVIDNQALPCLFQLLTQNHKKSIKKEACWTI  354

Query  690  GNV-AGD  707
             N+ AG+
Sbjct  355  SNITAGN  361



>ref|XP_009337641.1| PREDICTED: importin subunit alpha-like isoform X1 [Pyrus x bretschneideri]
Length=533

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 181/202 (90%), Gaps = 3/202 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS--QHV  314
            MSLRPGTRT+VRKKSYK GVDA+EARRRREDNLVEIRK+KRED+LLKKRRE L    Q +
Sbjct  1    MSLRPGTRTDVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDSLLKKRREGLSQSQQQL  60

Query  315  LDASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            LD SQS    +KR LE IP +VQGVWS DPA+Q+EATTQFRKLLSIERSPPIDEVIKAG 
Sbjct  61   LDGSQSGVVLEKRQLESIPSLVQGVWSNDPALQLEATTQFRKLLSIERSPPIDEVIKAGA  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLS+ SDDVRE
Sbjct  121  VPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSAGSDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVLG  737
            QAVWALGNVAGDSP CRDLVLG
Sbjct  181  QAVWALGNVAGDSPNCRDLVLG  202



>gb|KDO81642.1| hypothetical protein CISIN_1g016714mg [Citrus sinensis]
Length=384

 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 180/201 (90%), Gaps = 5/201 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVL-  317
            MSLRP TR EVRKK YK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE L  Q    
Sbjct  1    MSLRPSTRAEVRKKGYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQPQQQ  60

Query  318  --DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
              DASQ+  A +K+LE IP MVQGVWSEDPA+Q+EATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   GLDASQN--AIEKKLESIPSMVQGVWSEDPALQLEATTQFRKLLSIERSPPIDEVIKAGV  118

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+D+PQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  119  VPRFVEFLGRHDMPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSGSDDVRE  178

Query  672  QAVWALGNVAGDSPTCRDLVL  734
            QAVWALGNVAGDSP+CRDLVL
Sbjct  179  QAVWALGNVAGDSPSCRDLVL  199



>ref|XP_008801731.1| PREDICTED: importin subunit alpha-1a isoform X4 [Phoenix dactylifera]
Length=437

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSATAA  60

Query  321  ASQ--SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            A+Q       +K+LE +P MVQGVWS+DPA+Q+EATTQFRKLLSIERSPPI+EVIK GVV
Sbjct  61   AAQLDHSTGIEKKLESLPGMVQGVWSDDPAMQLEATTQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLL+SPSDDVREQ
Sbjct  121  PRFVEFLSRYDMPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLTSPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRD VL
Sbjct  181  AVWALGNVAGDSPSCRDFVL  200



>ref|XP_008801730.1| PREDICTED: importin subunit alpha-1a isoform X3 [Phoenix dactylifera]
Length=443

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSATAA  60

Query  321  ASQ--SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            A+Q       +K+LE +P MVQGVWS+DPA+Q+EATTQFRKLLSIERSPPI+EVIK GVV
Sbjct  61   AAQLDHSTGIEKKLESLPGMVQGVWSDDPAMQLEATTQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLL+SPSDDVREQ
Sbjct  121  PRFVEFLSRYDMPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLTSPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRD VL
Sbjct  181  AVWALGNVAGDSPSCRDFVL  200



>ref|XP_010931776.1| PREDICTED: importin subunit alpha-like [Elaeis guineensis]
Length=533

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 181/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE +LQS  V 
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSAAVA  60

Query  318  DAS-QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             A    PA  +K+LE +P MVQGVWS+ PA+Q+EAT+QFRKLLSIERSPPI+EVIK GVV
Sbjct  61   TAQIDHPAGIEKKLESLPGMVQGVWSDVPAMQLEATSQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLLSSP+DDVREQ
Sbjct  121  PRFVEFLSRYDMPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLSSPNDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVLG  737
            AVWALGNVAGDSP+CRD VLG
Sbjct  181  AVWALGNVAGDSPSCRDFVLG  201



>ref|XP_010501391.1| PREDICTED: importin subunit alpha-1a-like [Camelina sativa]
Length=256

 Score =   294 bits (753),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 176/205 (86%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQH---  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  QH   
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQHQQP  60

Query  312  ----VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LD  Q+ AA +KRLE IP+MVQG++S+DP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   LGGVGLDGPQNAAAAEKRLEGIPMMVQGLYSDDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLSS SD
Sbjct  121  KAGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205



>ref|XP_008806719.1| PREDICTED: importin subunit alpha-1a-like [Phoenix dactylifera]
Length=324

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSL+P  RTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLQPTMRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQPAAAA  60

Query  321  AS----QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
            A       PA  +K+LE +P MVQGVWS DPA+Q+EATTQFRKLLSIERSPPI+EVIK G
Sbjct  61   AVAVQIDHPAGIEKKLESLPEMVQGVWSNDPAMQLEATTQFRKLLSIERSPPIEEVIKTG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D+PQLQFEAAWALTNVASGTSEHT VVI+HGAVPKF+QLLSSP+DDVR
Sbjct  121  VVPRFVEFLSRHDMPQLQFEAAWALTNVASGTSEHTHVVIDHGAVPKFVQLLSSPNDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP+CRD VLG
Sbjct  181  EQAVWALGNVAGDSPSCRDFVLG  203



>ref|XP_008801728.1| PREDICTED: importin subunit alpha-1a isoform X1 [Phoenix dactylifera]
Length=539

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSATAA  60

Query  321  ASQ--SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            A+Q       +K+LE +P MVQGVWS+DPA+Q+EATTQFRKLLSIERSPPI+EVIK GVV
Sbjct  61   AAQLDHSTGIEKKLESLPGMVQGVWSDDPAMQLEATTQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLL+SPSDDVREQ
Sbjct  121  PRFVEFLSRYDMPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLTSPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRD VL
Sbjct  181  AVWALGNVAGDSPSCRDFVL  200



>ref|XP_008801729.1| PREDICTED: importin subunit alpha-1a isoform X2 [Phoenix dactylifera]
Length=533

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSATAA  60

Query  321  ASQ--SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            A+Q       +K+LE +P MVQGVWS+DPA+Q+EATTQFRKLLSIERSPPI+EVIK GVV
Sbjct  61   AAQLDHSTGIEKKLESLPGMVQGVWSDDPAMQLEATTQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLL+SPSDDVREQ
Sbjct  121  PRFVEFLSRYDMPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLTSPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRD VL
Sbjct  181  AVWALGNVAGDSPSCRDFVL  200



>ref|NP_001275782.1| importin alpha [Citrus sinensis]
 gb|ACU56981.1| importin alpha [Citrus sinensis]
Length=535

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 182/201 (91%), Gaps = 5/201 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE---VLQSQH  311
            MSLRP TR EVRKK YK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE   +   Q 
Sbjct  1    MSLRPSTRAEVRKKGYKTGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLLQPQQQ  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            +LDASQ+  A +K+LE IP MVQGVWSEDPA+Q+EATTQFRKLLSIERSPPIDEVIKAGV
Sbjct  61   LLDASQN--AIEKKLESIPSMVQGVWSEDPALQLEATTQFRKLLSIERSPPIDEVIKAGV  118

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+D+PQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  119  VPRFVEFLGRHDMPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSGSDDVRE  178

Query  672  QAVWALGNVAGDSPTCRDLVL  734
            QAVWALGNVAGDSP+CRDLVL
Sbjct  179  QAVWALGNVAGDSPSCRDLVL  199


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  GV+P   Q L  N    ++ EA W ++N+ +G     + VIE   +   + LL   
Sbjct  324  VIDNGVLPCLYQLLTHNHKKSIKKEACWTISNITAGNRAQIQAVIEANIILPLVHLLQHA  383

Query  654  SDDVREQAVWALGN  695
              +++++A WA+ N
Sbjct  384  EFEIKKEAAWAISN  397



>ref|XP_009414157.1| PREDICTED: importin subunit alpha-1a-like [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 178/207 (86%), Gaps = 14/207 (7%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRPGTR EVRKKSYK GVD DE RRRRE NL+EIRKSKRED+L KKRREVL     L 
Sbjct  1    MSLRPGTRAEVRKKSYKAGVDVDEGRRRREGNLIEIRKSKREDSLTKKRREVL-----LQ  55

Query  321  ASQ---------SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE  473
            A+Q         SP+  DK++E +  MVQGVWSE+P  Q+EATTQFRKLLSIERSPPI+E
Sbjct  56   AAQQAIGEPPALSPSGVDKKIENLQGMVQGVWSENPNTQLEATTQFRKLLSIERSPPIEE  115

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VIKAGVVPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFI+LLSSP
Sbjct  116  VIKAGVVPRFVEFLSRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIELLSSP  175

Query  654  SDDVREQAVWALGNVAGDSPTCRDLVL  734
            +DDVREQAVWALGNVAGDSP+CRDLVL
Sbjct  176  NDDVREQAVWALGNVAGDSPSCRDLVL  202



>gb|KDO72000.1| hypothetical protein CISIN_1g009700mg [Citrus sinensis]
Length=528

 Score =   300 bits (768),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 183/200 (92%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRPG+RTEVRKKSYK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE  +LQSQ V
Sbjct  1    MSLRPGSRTEVRKKSYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGLILQSQPV  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             +A+   A+ +K+LE IP MVQGV SE+  +Q+EATTQFRKLLSIER PPI+EVI+AGVV
Sbjct  61   TEAN---ASIEKKLESIPSMVQGVLSENSGLQLEATTQFRKLLSIERCPPIEEVIRAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL+R+DLPQLQFEAAWALTN+ASGTSEHTRVVIEHGAVPKF+QLL S SDDVREQ
Sbjct  118  PRFVEFLDRHDLPQLQFEAAWALTNIASGTSEHTRVVIEHGAVPKFVQLLGSASDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  178  AVWALGNVAGDSPSCRDLVL  197



>ref|XP_006488809.1| PREDICTED: importin subunit alpha-1b-like [Citrus sinensis]
Length=528

 Score =   300 bits (768),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 183/200 (92%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRPG+RTEVRKKSYK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE  +LQSQ V
Sbjct  1    MSLRPGSRTEVRKKSYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGLILQSQPV  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             +A+   A+ +K+LE IP MVQGV SE+  +Q+EATTQFRKLLSIER PPI+EVI+AGVV
Sbjct  61   TEAN---ASIEKKLESIPSMVQGVLSENSGLQLEATTQFRKLLSIERCPPIEEVIRAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL+R+DLPQLQFEAAWALTN+ASGTSEHTRVVIEHGAVPKF+QLL S SDDVREQ
Sbjct  118  PRFVEFLDRHDLPQLQFEAAWALTNIASGTSEHTRVVIEHGAVPKFVQLLGSASDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  178  AVWALGNVAGDSPSCRDLVL  197



>ref|XP_010549392.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=537

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS----Q  308
            MSLRP TR E+RKK YK GVDAD+ARRRREDNLVEIRK+KRED+LLKKRRE +       
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADDARRRREDNLVEIRKNKREDSLLKKRREGMTQLPSLA  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
              LDASQ+ AA +KRLE +P+MVQGVWS+DP  Q+EATTQFRKLLSIERSPPIDEVIKAG
Sbjct  61   PGLDASQNAAAVEKRLEGVPMMVQGVWSDDPQAQLEATTQFRKLLSIERSPPIDEVIKAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTNVASGTS+HTRVVI+HGAVP F+QLLSS SDDVR
Sbjct  121  VVPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIDHGAVPIFVQLLSSASDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVL  734
            EQAVWALGNVAGDSPTCR+LVL
Sbjct  181  EQAVWALGNVAGDSPTCRNLVL  202


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  GV+P     L +N    ++ EA W ++N+ +G     + V++ G V   + LL   
Sbjct  327  VIDNGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNRVQIQAVVDAGIVLPLVHLLQHA  386

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  387  EFDIKKEAAWAISN  400



>ref|XP_010674568.1| PREDICTED: importin subunit alpha-1a [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 179/200 (90%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP +RTEVRKKSYKIGVDADEARRRREDN+VEIRK+KREDNLLKKRRE  V QSQ  
Sbjct  1    MSLRPNSRTEVRKKSYKIGVDADEARRRREDNMVEIRKNKREDNLLKKRREGMVNQSQPQ  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
               + +P   +K+LE IPLMVQGV S DP +Q+EATTQFRKLLSIER PPIDEVI AGVV
Sbjct  61   PLVNDAPQNIEKKLESIPLMVQGVASADPGIQLEATTQFRKLLSIERCPPIDEVISAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            P+FV+FL+R+D+PQLQFEAAWALTNVASGTSEHTRVVI+HGAVPKF+QLL S SDDVREQ
Sbjct  121  PKFVEFLDRHDVPQLQFEAAWALTNVASGTSEHTRVVIDHGAVPKFVQLLGSASDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  181  AVWALGNVAGDSPSCRDLVL  200


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 2/117 (2%)
 Frame = +3

Query  366  PLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQF  545
            P ++Q +    P V I A      +++ + S     V+   V+P   Q L +N    ++ 
Sbjct  290  PRLMQLLLHPSPTVLIPALRTVGNIVTGDDSQ-TQYVLDNNVLPCLHQLLTQNHKKSIKK  348

Query  546  EAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAGDSP  713
            EA W ++N+ +G     + V+E G V   +QLL +   D++++A WA+ N  +G +P
Sbjct  349  EACWTISNITAGNKAQIQAVVEAGLVQPLVQLLQNAEFDIKKEAAWAISNATSGGAP  405



>ref|XP_010544159.1| PREDICTED: importin subunit alpha-1b-like [Tarenaya hassleriana]
Length=540

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 180/205 (88%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS--QHV  314
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +    Q  
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMQLPQQA  60

Query  315  -----LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LDASQ+ AA +KRLE IP+MVQGV S+DP VQ+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   PLGPGLDASQNAAAAEKRLEGIPMMVQGVLSDDPQVQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R+D PQLQFEAAWALTNVASGTS+HTRVVI+HGAVP F+QLLSS SD
Sbjct  121  KAGVVPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIDHGAVPIFVQLLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSPTCR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPTCRNLVL  205



>ref|XP_006417589.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
 gb|ESQ35942.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
Length=539

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 178/204 (87%), Gaps = 6/204 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQH-  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE  +LQ Q  
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQP  60

Query  312  ---VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                LD  Q+ AA +KRLE IP+MVQGV+SEDP  Q+EATTQFRKLLSIERSPPIDEVIK
Sbjct  61   LGTALDGPQNAAAVEKRLEGIPMMVQGVYSEDPQAQLEATTQFRKLLSIERSPPIDEVIK  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            AGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS SDD
Sbjct  121  AGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSASDD  180

Query  663  VREQAVWALGNVAGDSPTCRDLVL  734
            VREQAVWALGNVAGDSP CR+LVL
Sbjct  181  VREQAVWALGNVAGDSPNCRNLVL  204


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G +   + LL + 
Sbjct  329  IINSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKAQIEAVVGAGIILPLVHLLQTA  388

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  389  EFDIKKEAAWAISN  402



>ref|XP_010095558.1| Importin subunit alpha [Morus notabilis]
 gb|EXB60957.1| Importin subunit alpha [Morus notabilis]
Length=628

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 174/200 (87%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ--SQHV  314
            MSLRP +RTE RKKSYK GVDADEARRRREDNL EIRK+KREDNL KKRR+ L    Q +
Sbjct  1    MSLRPSSRTEARKKSYKTGVDADEARRRREDNLFEIRKNKREDNLQKKRRDGLNLSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD  Q+ A  +KRLE IP MV GVWS+DPA Q+EATTQFRKLLSIERSPPIDEVIKAGVV
Sbjct  61   LDGVQNAAFVEKRLESIPAMVHGVWSDDPAAQLEATTQFRKLLSIERSPPIDEVIKAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D PQLQFEAAWALTNVASGTSEHTRVVI+ GAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLARQDQPQLQFEAAWALTNVASGTSEHTRVVIDQGAVPMFVQLLSSASDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  181  AVWALGNVAGDSPSCRDLVL  200



>ref|XP_010914626.1| PREDICTED: importin subunit alpha isoform X1 [Elaeis guineensis]
Length=557

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 179/224 (80%), Gaps = 26/224 (12%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVRKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE L       
Sbjct  1    MSLRPTTRTEVRKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREALLQSATAA  60

Query  321  ASQ--SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            A+Q   P A +K+LE +P MVQGVWS+DPAVQ+EATTQFRKLLSIERSPPI+EVIK GVV
Sbjct  61   AAQLDHPTAIEKKLESLPGMVQGVWSDDPAVQLEATTQFRKLLSIERSPPIEEVIKTGVV  120

Query  495  PRFVQFLERNDLPQLQ------------------------FEAAWALTNVASGTSEHTRV  602
            PRFV+FL R D+PQLQ                        FEAAWALTNVASGTSEHTRV
Sbjct  121  PRFVEFLARYDMPQLQVWYILVCNMVSYVSLGNYTCPFLQFEAAWALTNVASGTSEHTRV  180

Query  603  VIEHGAVPKFIQLLSSPSDDVREQAVWALGNVAGDSPTCRDLVL  734
            VI+HGAVPKF+QLL+SPSDDVREQAVWALGNVAGDSPTCRD VL
Sbjct  181  VIDHGAVPKFVQLLTSPSDDVREQAVWALGNVAGDSPTCRDFVL  224


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 66/127 (52%), Gaps = 4/127 (3%)
 Frame = +3

Query  333  PAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQF  512
            PA  D+    +P++ Q + S D  V  +A       LS   +  I  VI+AGV PR ++ 
Sbjct  261  PAPFDQTKVALPVLRQLIHSTDEEVLTDACWAL-SYLSDGTNDKIQSVIEAGVCPRLIEL  319

Query  513  LERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWAL  689
            L  +  P +   A   + N+ +G    T+VVI++ A+P   QLL+ +    ++++A W +
Sbjct  320  L-LHPSPTVLIPALRTVGNIVTGDDAQTQVVIDNQALPCLFQLLTQNHKKSIKKEACWTI  378

Query  690  GNV-AGD  707
             N+ AG+
Sbjct  379  SNITAGN  385



>ref|XP_010458211.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Camelina 
sativa]
Length=540

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 176/205 (86%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQH---  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  QH   
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQHQQP  60

Query  312  ----VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LD  Q+ AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   LGGVGLDGPQNAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLSS SD
Sbjct  121  KAGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       ++  G +   + LL + 
Sbjct  330  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKGQIEAMVGAGIILPLVHLLQTA  389

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  390  EFDIKKEAAWAISN  403



>ref|XP_010458212.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Camelina 
sativa]
Length=540

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 176/205 (86%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQH---  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  QH   
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQHQQP  60

Query  312  ----VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LD  Q+ AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   LGGVGLDGPQNAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLSS SD
Sbjct  121  KAGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       ++  G +   + LL + 
Sbjct  330  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAMVGAGIILPLVHLLQTA  389

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  390  EFDIKKEAAWAISN  403



>ref|XP_010489893.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=544

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 176/205 (86%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQH---  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  QH   
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQHQQP  60

Query  312  ----VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LD  Q+ AA +KRLE IP+MVQG++S+DP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   LGGVGLDGPQNAAAAEKRLEGIPMMVQGLYSDDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLSS SD
Sbjct  121  KAGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G      VVIE GAVP F+QLLSS 
Sbjct  330  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEVVIEQGAVPIFVQLLSSA  389

Query  654  SDDVREQ  674
            SDDVREQ
Sbjct  390  SDDVREQ  396



>gb|ABO21639.1| importin alpha-like protein [Brassica napus]
 gb|ABO21640.1| importin alpha-like protein [Brassica napus]
Length=542

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 176/206 (85%), Gaps = 8/206 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ------  302
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +       
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  303  --SQHVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEV  476
                  LDA QS AA +KRLE IP+MVQGV+SEDP  Q+EATTQFRKLLSIERSPPIDEV
Sbjct  61   PLGAAGLDALQSAAAVEKRLEGIPMMVQGVYSEDPQAQLEATTQFRKLLSIERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS S
Sbjct  121  IKAGVIPRFVEFLRRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVL  734
            DDVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DDVREQAVWALGNVAGDSPNCRNLVL  206


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  331  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNA  390

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  391  EFDIKKEAAWAISN  404



>emb|CDX94988.1| BnaC05g06830D [Brassica napus]
Length=540

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 177/205 (86%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  Q    
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  315  -----LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LDA QS AA +KRLE IP+MVQGV+SEDP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   PLGAGLDALQSAAAVEKRLEGIPMMVQGVYSEDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS SD
Sbjct  121  KAGVIPRFVEFLRRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  330  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNA  389

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  390  EFDIKKEAAWAISN  403



>emb|CDX93514.1| BnaA06g05340D [Brassica napus]
Length=542

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 176/206 (85%), Gaps = 8/206 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ------  302
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +       
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  303  --SQHVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEV  476
                  LDA QS AA +KRLE IP+MVQGV+SEDP  Q+EATTQFRKLLSIERSPPIDEV
Sbjct  61   PLGAAGLDALQSAAAVEKRLEGIPMMVQGVYSEDPQAQLEATTQFRKLLSIERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS S
Sbjct  121  IKAGVIPRFVEFLRRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVL  734
            DDVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DDVREQAVWALGNVAGDSPNCRNLVL  206


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  331  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNA  390

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  391  EFDIKKEAAWAISN  404



>ref|XP_010475758.1| PREDICTED: importin subunit alpha-1a-like [Camelina sativa]
Length=540

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 176/205 (86%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQH---  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  QH   
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQHQQP  60

Query  312  ----VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LD  Q+ AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   LGGVGLDGPQNAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLS+ SD
Sbjct  121  KAGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSAASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G +   + LL + 
Sbjct  330  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKGQIEAVVGAGIILPLVHLLQNA  389

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  390  EFDIKKEAAWAISN  403



>ref|XP_010024140.1| PREDICTED: importin subunit alpha [Eucalyptus grandis]
 gb|KCW60572.1| hypothetical protein EUGRSUZ_H03303 [Eucalyptus grandis]
Length=542

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 176/209 (84%), Gaps = 14/209 (7%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE---------  293
            MSLRP TR E RKK+YK GVDA+EARRRREDNLVEIRKSKREDNLLKKRRE         
Sbjct  1    MSLRPSTRNEARKKAYKTGVDAEEARRRREDNLVEIRKSKREDNLLKKRREGLPQQQLQQ  60

Query  294  --VLQSQHVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPI  467
                  Q  +D SQ+    +KRLE +P +VQGVWS+D A Q+EATTQFRKLLSIERSPPI
Sbjct  61   QQQQPPQQFVDGSQNI---EKRLESLPTLVQGVWSDDSASQLEATTQFRKLLSIERSPPI  117

Query  468  DEVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS  647
            DEVIKAGVVPRFV+FL+RNDLPQLQFEAAWALTNVASGTSEHTRVVIE GAVP F+QLLS
Sbjct  118  DEVIKAGVVPRFVEFLQRNDLPQLQFEAAWALTNVASGTSEHTRVVIESGAVPMFVQLLS  177

Query  648  SPSDDVREQAVWALGNVAGDSPTCRDLVL  734
            S SDDVREQAVWALGNVAGDSP+CRDLVL
Sbjct  178  SASDDVREQAVWALGNVAGDSPSCRDLVL  206



>ref|XP_002889740.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65999.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 178/203 (88%), Gaps = 5/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE  +LQ Q +
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQPL  60

Query  315  ---LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKA  485
               LD  Q+ AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVIKA
Sbjct  61   GAGLDGPQNAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIKA  120

Query  486  GVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDV  665
            GVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLSS SDDV
Sbjct  121  GVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSSASDDV  180

Query  666  REQAVWALGNVAGDSPTCRDLVL  734
            REQAVWALGNVAGDSP CR+LVL
Sbjct  181  REQAVWALGNVAGDSPNCRNLVL  203


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +3

Query  339  APDKRLECI------PLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             P+ +++ +      P +V+ +  + P V I A      +++ + S     +I +GV+P 
Sbjct  278  GPNNKIQAVIQAGVCPRLVELLGHQSPTVLIPALRTVGNIVTGDDSQ-TQFIIDSGVLPH  336

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
                L +N    ++ EA W ++N+ +G       V+  G +   + LL +   D++++A 
Sbjct  337  LYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVAAGIILPLVHLLQNAEFDIKKEAA  396

Query  681  WALGN  695
            WA+ N
Sbjct  397  WAISN  401



>ref|XP_009148181.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
Length=542

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 176/206 (85%), Gaps = 8/206 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ------  302
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIR++KRED+LLKKRRE +       
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRRNKREDSLLKKRREGMMLQQQQQ  60

Query  303  --SQHVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEV  476
                  LDA QS AA +KRLE IP+MVQGV+SEDP  Q+EATTQFRKLLSIERSPPIDEV
Sbjct  61   PLGAAGLDALQSAAAVEKRLEGIPMMVQGVYSEDPQAQLEATTQFRKLLSIERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS S
Sbjct  121  IKAGVIPRFVEFLRRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVL  734
            DDVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DDVREQAVWALGNVAGDSPNCRNLVL  206


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  331  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIVLPLVHLLQNA  390

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  391  EFDIKKEAAWAISN  404



>emb|CDY31102.1| BnaA08g26520D [Brassica napus]
Length=542

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 177/206 (86%), Gaps = 8/206 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ------  302
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +       
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  303  --SQHVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEV  476
              +   LDA QS AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEV
Sbjct  61   QPTGAGLDALQSAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS S
Sbjct  121  IKAGVIPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVL  734
            DDVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DDVREQAVWALGNVAGDSPNCRNLVL  206


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  331  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNQAQIEAVVGAGLVLPLVHLLQNA  390

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  391  EFDIKKEAAWAISN  404



>ref|XP_009110839.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Brassica 
rapa]
 ref|XP_009110840.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Brassica 
rapa]
Length=542

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 176/206 (85%), Gaps = 8/206 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  Q    
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  315  ------LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEV  476
                  LDA QS AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEV
Sbjct  61   QPLGAGLDALQSAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS S
Sbjct  121  IKAGVIPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVL  734
            DDVREQAVWALGNVAGDSP CR+L L
Sbjct  181  DDVREQAVWALGNVAGDSPNCRNLFL  206


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  331  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNQAQIEAVVGAGLVLPLVHLLQNA  390

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  391  EFDIKKEAAWAISN  404



>ref|XP_006304709.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
 gb|EOA37607.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
Length=540

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 175/205 (85%), Gaps = 7/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  Q    
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  315  -----LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVI  479
                 LD  Q+ AA +KRLE IP+MVQGV+SEDP  Q+EATTQFRKLLSIERSPPIDEVI
Sbjct  61   PLGAGLDGPQNAAAVEKRLEGIPMMVQGVYSEDPQAQLEATTQFRKLLSIERSPPIDEVI  120

Query  480  KAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSD  659
            KAGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F+QLLSS SD
Sbjct  121  KAGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVQLLSSASD  180

Query  660  DVREQAVWALGNVAGDSPTCRDLVL  734
            DVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DVREQAVWALGNVAGDSPNCRNLVL  205


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G +   + LL + 
Sbjct  330  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIILPLVHLLQNA  389

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  390  EFDIKKEAAWAISN  403



>ref|XP_008781168.1| PREDICTED: importin subunit alpha-like isoform X2 [Phoenix dactylifera]
Length=536

 Score =   290 bits (742),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 181/201 (90%), Gaps = 3/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQS--QH  311
            MSLRP TR E RKK+YK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQ+  Q 
Sbjct  1    MSLRPTTRMEGRKKAYKAGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQAGQQA  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
                SQ+P+  +K+L+ +P MVQGVWSE+ A+Q+EA TQFRKLLSIER+PPI+EV+KAGV
Sbjct  61   TETPSQAPSGIEKKLDNLPAMVQGVWSENAAMQLEAATQFRKLLSIERNPPIEEVLKAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+D+PQLQFEAAWALTNV+SGTSEHT+VVIE GAVPKF++LLSSP+DDVRE
Sbjct  121  VPRFVEFLSRHDIPQLQFEAAWALTNVSSGTSEHTQVVIEQGAVPKFVELLSSPNDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVL  734
            QAVWALGN+AGDSP+CRDLVL
Sbjct  181  QAVWALGNIAGDSPSCRDLVL  201


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  GV+P  +Q L +     ++ EA W ++N+ +G     + VI+   +   +QLL   
Sbjct  326  VIDNGVLPNLLQLLTQQYRKSIKKEACWTISNITAGNRAQIQAVIDANIIGPLVQLLQHA  385

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  386  EFDIKKEAAWAISN  399



>ref|NP_172398.1| importin alpha isoform 4 [Arabidopsis thaliana]
 ref|NP_849623.1| importin alpha isoform 4 [Arabidopsis thaliana]
 sp|O80480.1|IMPA4_ARATH RecName: Full=Importin subunit alpha-4; Short=IMPa-4 [Arabidopsis 
thaliana]
 gb|AAC24079.1| Match to mRNA for importin alpha-like protein 4 (impa4) gb|Y14616 
from A. thaliana. ESTs gb|N96440, gb|N37503, gb|N37498 
and gb|T42198 come from this gene [Arabidopsis thaliana]
 gb|AAM13992.1| putative importin alpha protein [Arabidopsis thaliana]
 gb|AAM51388.1| putative importin alpha protein [Arabidopsis thaliana]
 dbj|BAH19416.1| AT1G09270 [Arabidopsis thaliana]
 gb|AEE28421.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28422.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=538

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 178/204 (87%), Gaps = 6/204 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQ--  308
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE  +LQ Q  
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQLP  60

Query  309  --HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                LD  Q+ AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVIK
Sbjct  61   LGAGLDGPQTAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIK  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            AGV+PRFV+FL R+D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F++LL+S SDD
Sbjct  121  AGVIPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVKLLTSASDD  180

Query  663  VREQAVWALGNVAGDSPTCRDLVL  734
            VREQAVWALGNVAGDSP CR+LVL
Sbjct  181  VREQAVWALGNVAGDSPNCRNLVL  204


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 55/110 (50%), Gaps = 1/110 (1%)
 Frame = +3

Query  366  PLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQF  545
            P +V+ +  + P V I A      +++ + S     +I++GV+P     L +N    ++ 
Sbjct  294  PRLVELLGHQSPTVLIPALRTVGNIVTGDDSQ-TQFIIESGVLPHLYNLLTQNHKKSIKK  352

Query  546  EAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            EA W ++N+ +G       V+  G +   + LL +   D++++A WA+ N
Sbjct  353  EACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISN  402



>ref|XP_010093918.1| Importin subunit alpha [Morus notabilis]
 gb|EXB54870.1| Importin subunit alpha [Morus notabilis]
Length=840

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 174/200 (87%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ--SQHV  314
            MSLRP +RTE RKKSYK GVDADEARRRREDNL EIRK+KREDNL KKRR+ L    Q +
Sbjct  1    MSLRPSSRTEARKKSYKTGVDADEARRRREDNLFEIRKNKREDNLQKKRRDGLNLSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD  Q+ A  +KRLE IP MV GVWS+DPA Q+EATTQFRKLLSIERSPPIDEVIKAGVV
Sbjct  61   LDGVQNAAFVEKRLESIPAMVHGVWSDDPAAQLEATTQFRKLLSIERSPPIDEVIKAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D PQLQFEAAWALTNVASGTSEHTRVVI+ GAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLARQDQPQLQFEAAWALTNVASGTSEHTRVVIDQGAVPMFVQLLSSASDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  181  AVWALGNVAGDSPSCRDLVL  200



>gb|KFK43224.1| hypothetical protein AALP_AA1G096500 [Arabis alpina]
Length=539

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 178/204 (87%), Gaps = 6/204 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL---QSQH  311
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +   Q Q 
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLTQQQP  60

Query  312  V---LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
            +   LD  Q+ AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVIK
Sbjct  61   LGVGLDGPQNAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIK  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            AGVVPRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F++LLSS SDD
Sbjct  121  AGVVPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVELLSSASDD  180

Query  663  VREQAVWALGNVAGDSPTCRDLVL  734
            VREQAVWALGNVAGDSP+CR+LVL
Sbjct  181  VREQAVWALGNVAGDSPSCRNLVL  204


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G +   + LL + 
Sbjct  329  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKVQIEAVVGAGIILPLVHLLQTA  388

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  389  EFDIKKEAAWAISN  402



>ref|XP_001778004.1| predicted protein [Physcomitrella patens]
 gb|EDQ57217.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 175/200 (88%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP  R EVRKK +K+ +DADEARR+REDN+VEIRKSKRE++LLKKRR+  V   Q  
Sbjct  1    MSLRPNARVEVRKKGFKLAIDADEARRKREDNMVEIRKSKREESLLKKRRDGMVKLQQQF  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            + A+Q+ AA  K+LE +P MV GV+S+DPA Q+E+TTQFRKLLSIERSPPI+EVI AGVV
Sbjct  61   MPAAQTGAAEKKQLESLPAMVAGVYSDDPATQLESTTQFRKLLSIERSPPIEEVIAAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL RND PQLQFEAAWALTN+ASGTS+HTRVVI+HGAVP F+QLLSSPSDDVREQ
Sbjct  121  PRFVEFLVRNDFPQLQFEAAWALTNIASGTSDHTRVVIDHGAVPIFVQLLSSPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP CRDLVL
Sbjct  181  AVWALGNVAGDSPKCRDLVL  200



>emb|CAN64716.1| hypothetical protein VITISV_026717 [Vitis vinifera]
Length=523

 Score =   287 bits (734),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 174/202 (86%), Gaps = 15/202 (7%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRPG+RT+VRKKSYK GVDA+EARRRREDNLVEIRK+KREDNLLKKRRE  +LQSQ  
Sbjct  1    MSLRPGSRTDVRKKSYKTGVDAEEARRRREDNLVEIRKNKREDNLLKKRREGLILQSQQF  60

Query  315  L-DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
              DASQ+ A  +KRLE I LMVQGVWS+DPA Q+EATTQFRKLLSI            GV
Sbjct  61   SSDASQTTAVVEKRLESITLMVQGVWSDDPASQLEATTQFRKLLSI------------GV  108

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R+DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVP F+QLLSS SDDVRE
Sbjct  109  VPRFVEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPMFVQLLSSASDDVRE  168

Query  672  QAVWALGNVAGDSPTCRDLVLG  737
            QAVWALGNVAGDSP+CRDLVLG
Sbjct  169  QAVWALGNVAGDSPSCRDLVLG  190



>emb|CDY32165.1| BnaCnng06740D [Brassica napus]
Length=542

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 176/206 (85%), Gaps = 8/206 (4%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP TR E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE +  Q    
Sbjct  1    MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQQQ  60

Query  315  -----LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSI-ERSPPIDEV  476
                 LDA QS AA +KRLE IP+MVQGV+ +DP  Q+EATTQFRKLLSI ERSPPIDEV
Sbjct  61   PLGAGLDALQSAAAVEKRLEGIPMMVQGVYYDDPQAQLEATTQFRKLLSIAERSPPIDEV  120

Query  477  IKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS  656
            IKAGV+PRFV+FL R D PQLQFEAAWALTNVASGTS+HTRVVIEHGAVP F++LLSS S
Sbjct  121  IKAGVIPRFVEFLGRQDHPQLQFEAAWALTNVASGTSDHTRVVIEHGAVPIFVELLSSAS  180

Query  657  DDVREQAVWALGNVAGDSPTCRDLVL  734
            DDVREQAVWALGNVAGDSP CR+LVL
Sbjct  181  DDVREQAVWALGNVAGDSPNCRNLVL  206


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +GV+P     L +N    ++ EA W ++N+ +G       V+  G V   + LL + 
Sbjct  331  IIDSGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNQAQIEAVVGAGLVLPLVHLLQNA  390

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  391  EFDIKKEAAWAISN  404



>gb|KHN03320.1| Importin subunit alpha-1 [Glycine soja]
Length=487

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTE+R+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEIRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQQFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A    +  DK+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   APLQNSTVDKKLESLPAMVAGVWSDDNSIQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 54/111 (49%), Gaps = 2/111 (2%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V+S D  V  +A       LS   +  I  VI+AGV  R VQ L     P + 
Sbjct  245  LPALERLVFSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCARLVQLLIHPS-PSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
              A   + N+ +G    T+ VIE G V   + LL +   D++++A WA+ N
Sbjct  303  IPALRTVGNIVTGDDMQTQTVIEAGLVAPLVNLLQNAEFDIKKEAAWAISN  353



>ref|XP_011036930.1| PREDICTED: importin subunit alpha-1 isoform X1 [Populus euphratica]
Length=530

 Score =   285 bits (729),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK++RE++L KKRRE LQ+Q +  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNRREESLQKKRREGLQAQAIPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S AA  K+LE +P MV GVWSED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   ALHSSAAEKKQLEHLPSMVAGVWSEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F+QLL SPSDDVREQAV
Sbjct  121  FVQFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVQLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPRCRDLVLG  199


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 4/116 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +PL+ Q   +   ++   AT         +  PP D+V  A  +P   + +  ND  ++ 
Sbjct  204  LPLLAQLNENAKLSMLRNATWTLSNFCRGKPQPPFDQVKPA--LPALARLIHSND-EEVL  260

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAGD  707
             +A WAL+ ++ GT++  + VIE G  P+ ++LL  PS  V   A+  +GN V GD
Sbjct  261  TDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGD  316



>ref|XP_012084120.1| PREDICTED: importin subunit alpha-4-like [Jatropha curcas]
 gb|KDP27954.1| hypothetical protein JCGZ_19034 [Jatropha curcas]
Length=527

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 176/200 (88%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQHV  314
            MSLRP +RTE RKKSYK GVD DEARRRREDNLVEIRKSKRED+LLKKRRE  +LQSQ+ 
Sbjct  1    MSLRPSSRTESRKKSYKSGVDGDEARRRREDNLVEIRKSKREDSLLKKRREGLLLQSQNS  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
             D +   A  +K+LE +  MVQGV S++P +Q+EATTQFRKLLSIER PPIDEVIKAGVV
Sbjct  61   NDLN---AGIEKKLENLSAMVQGVLSDNPTLQLEATTQFRKLLSIERCPPIDEVIKAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            P FV+FL+++DLPQLQFEAAWALTN+ SGTSEHTRVVI+HGA+PKF+QLL S +DDVREQ
Sbjct  118  PCFVEFLDKHDLPQLQFEAAWALTNIVSGTSEHTRVVIDHGAIPKFVQLLGSANDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP+CRDLVL
Sbjct  178  AVWALGNVAGDSPSCRDLVL  197



>ref|XP_001760522.1| predicted protein [Physcomitrella patens]
 gb|EDQ74597.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP  R EVRKK YK+ VDADEARR+REDN+VEIRKSKRE++LLKKRR+ +LQ Q  +
Sbjct  1    MSLRPNARVEVRKKGYKLAVDADEARRKREDNMVEIRKSKREESLLKKRRDGMLQQQQRI  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             +  S  +  K+LE +P MV G+ S+DPA+Q+EATTQFRKLLSIERSPPI+EVI AGVVP
Sbjct  61   SSVTSSISDKKQLESLPGMVAGLHSDDPAIQLEATTQFRKLLSIERSPPIEEVISAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R+D PQLQFEAAWALTN+ASGTS+HTRVVIEHGAVP F+QLLSSPSDDVREQA
Sbjct  121  RFVEFLVRSDFPQLQFEAAWALTNIASGTSDHTRVVIEHGAVPIFVQLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPKCRDLVL  199



>ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=530

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTE+R+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEIRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQQFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A    +  DK+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   APLQNSTVDKKLESLPAMVAGVWSDDNSIQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G V   + LL + 
Sbjct  323  IINHGALPCLLNLLTNNHKKSIKKEACWTISNITAGNKEQIQTVIEAGLVAPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396



>gb|AAB57845.1| AtKAP-like protein, partial [Selaginella lepidophylla]
Length=198

 Score =   273 bits (698),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 168/199 (84%), Gaps = 5/199 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RT +RKK YK  VDADEARR+REDN+VEIRK+KRE+ L+KKRRE +Q+  VL 
Sbjct  1    MSLRPQDRTNLRKKIYKTTVDADEARRKREDNMVEIRKAKREEGLMKKRREGMQA--VLF  58

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S      +K+LE +P MV+GVWSED A Q+EATTQFR+LLSIERSPPI+EVI AGVVPR
Sbjct  59   GS---GLVEKKLERLPAMVRGVWSEDSAAQLEATTQFRRLLSIERSPPIEEVIAAGVVPR  115

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
             VQFL+R D PQLQFEAAWALTN+ASGTS+HT VVIE GAVP F+QLLSSPSDDVREQAV
Sbjct  116  LVQFLQRTDYPQLQFEAAWALTNIASGTSDHTAVVIEQGAVPIFVQLLSSPSDDVREQAV  175

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRD VLG
Sbjct  176  WALGNVAGDSPKCRDFVLG  194



>ref|XP_006378030.1| hypothetical protein POPTR_0010s00380g [Populus trichocarpa]
 gb|ERP55827.1| hypothetical protein POPTR_0010s00380g [Populus trichocarpa]
Length=340

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK+KRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLLKKRREGLQAQQFPP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S +  +K+LE +P MV GVWSED  +Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   AILSSSNVEKKLENLPSMVAGVWSEDGNLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPKCRDLVL  198



>gb|KDO87075.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=402

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ+   L 
Sbjct  1    MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPL-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + S A  +K+LE +P MV GVWS+D  +Q++ATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   -TNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPR  118

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            F++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LLSSP+DDVREQAV
Sbjct  119  FIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAV  178

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  179  WALGNVAGDSPKCRDLVL  196



>gb|KDO87076.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=415

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ+   L 
Sbjct  1    MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPL-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + S A  +K+LE +P MV GVWS+D  +Q++ATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   -TNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPR  118

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            F++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LLSSP+DDVREQAV
Sbjct  119  FIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAV  178

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  179  WALGNVAGDSPKCRDLVL  196



>ref|XP_004295110.1| PREDICTED: importin subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 173/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQ-FP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS  PA  +KRLE +P MV GVWS D A+Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASVQPANLEKRLESLPSMVAGVWSTDSALQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVIEHGAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLVREDYPQLQFEAAWALTNIASGTSDNTKVVIEHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 55/112 (49%), Gaps = 5/112 (4%)
 Frame = +3

Query  366  PLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE--VIKAGVVPRFVQFLERNDLPQL  539
            P +VQ +    PAV I A    R + +I     +    +I  G +P  +  L  N    +
Sbjct  287  PRLVQLLLHPSPAVLIPA---LRTVGNIVTGDDLQTQCIITNGALPCLLSLLTHNHKKSI  343

Query  540  QFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            + EA W ++N+ +G  E  + VIE G +   + LL +   +++++A WA+ N
Sbjct  344  KKEACWTISNITAGNREQIQHVIEAGLIGPLVNLLQTAEFEIKKEAAWAISN  395



>ref|XP_008223291.1| PREDICTED: importin subunit alpha-1-like [Prunus mume]
Length=529

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQSQ    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQSQQFAP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A Q P+  +K+LE +P MV GVWS++  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ALQ-PSNVEKKLESLPSMVSGVWSDNNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_007222489.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
 gb|EMJ23688.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
Length=529

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQSQ    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQSQQFAP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A Q P+  +K+LE +P MV GVWS++  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ALQ-PSNVEKKLESLPSMVSGVWSDNNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_002961054.1| hypothetical protein SELMODRAFT_266556 [Selaginella moellendorffii]
 gb|EFJ38593.1| hypothetical protein SELMODRAFT_266556 [Selaginella moellendorffii]
Length=527

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 5/199 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVRKK YK  VD DEARR+REDN+VEIRK+KR++NL+KKRRE +Q QH + 
Sbjct  1    MSLRPQARTEVRKKGYKNAVDPDEARRKREDNMVEIRKNKRDENLMKKRREGMQPQHFM-  59

Query  321  ASQSPAA-PDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
               +P +  +++LE +P+MV GVWS+DP +Q+EATTQFRKLLSIERSPPI+EVIKAGVVP
Sbjct  60   ---TPGSIVERKLESLPVMVSGVWSDDPNLQVEATTQFRKLLSIERSPPIEEVIKAGVVP  116

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL+R+D  QLQFEAAWALTN+ASGTS+HT VVI HGAVP F+QLLSSPS+DVREQA
Sbjct  117  RFVEFLKRHDFHQLQFEAAWALTNIASGTSDHTTVVINHGAVPIFVQLLSSPSEDVREQA  176

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  177  VWALGNVAGDSPKCRDLVL  195


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L       ++ EA W ++N+ +G  +  + VIE   +P  ++LL++ 
Sbjct  320  IINNGALPYLLHLLTNVYKKSIKKEACWTISNITAGNKDQIQAVIEANIIPPLVELLANA  379

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  380  EFDIKKEAAWAISN  393



>ref|XP_011079596.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 173/200 (87%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE+NLLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRSRYKVAVDAEEGRRRREDNMVEIRKNRREENLLKKRREGLQAQQFQP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A   P   DK+LE +P MV GVWS D A+Q+EATTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  61   AVNVPQL-DKKLESLPAMVAGVWSNDGALQLEATTQFRKLLSIERNPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R+D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLARDDYPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVRLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLGM  740
            WALGNVAGDSP CRDLVLG 
Sbjct  180  WALGNVAGDSPKCRDLVLGY  199



>ref|XP_011023747.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=529

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q +  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQAMPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +  S AA  K+LE +P MV G+W+ED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   SIHSSAAEKKQLEHLPSMVAGIWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F+QLL+SPSDDVREQAV
Sbjct  121  FVQFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVQLLASPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPRCRDLVLG  199


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  E  + VIE   +   + LL S 
Sbjct  323  IINHQALPCLLNLLANNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVNLLQSA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396



>ref|XP_009623312.1| PREDICTED: importin subunit alpha-like isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   278 bits (710),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 165/184 (90%), Gaps = 1/184 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
            D SQSPA  +KRLE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVVP
Sbjct  61   DTSQSPALLEKRLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ 
Sbjct  121  RFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQV  180

Query  678  VWAL  689
              AL
Sbjct  181  KPAL  184



>ref|XP_011036931.1| PREDICTED: importin subunit alpha-1 isoform X2 [Populus euphratica]
Length=529

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK++RE++L KKRRE LQ+Q +  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNRREESLQKKRREGLQAQAIPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S AA +K+LE +P MV GVWSED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   ALHSSAA-EKKLEHLPSMVAGVWSEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F+QLL SPSDDVREQAV
Sbjct  120  FVQFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVQLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 4/116 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +PL+ Q   +   ++   AT         +  PP D+V  A  +P   + +  ND  ++ 
Sbjct  203  LPLLAQLNENAKLSMLRNATWTLSNFCRGKPQPPFDQVKPA--LPALARLIHSND-EEVL  259

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAGD  707
             +A WAL+ ++ GT++  + VIE G  P+ ++LL  PS  V   A+  +GN V GD
Sbjct  260  TDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGD  315



>ref|XP_006382424.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|ERP60221.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK++RE++L KKRRE LQ+Q +  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNRREESLQKKRREGLQAQAIPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S AA +K+LE +P MV GVWSED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   ALHSSAA-EKKLEHLPSMVAGVWSEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F+QLL SPSDDVREQAV
Sbjct  120  FVQFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVQLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 4/116 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +PL+ Q   +   ++   AT         +  PP D+V  A  +P   + +  ND  ++ 
Sbjct  203  LPLLAQLNENAKLSMLRNATWTLSNFCRGKPQPPFDQVKPA--LPALARLIHSND-EEVL  259

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAGD  707
             +A WAL+ ++ GT++  + VIE G  P+ I+LL  PS  V   A+  +GN V GD
Sbjct  260  TDACWALSYLSDGTNDKIQAVIEAGVCPRLIELLLHPSPSVLIPALRTVGNIVTGD  315



>gb|KHN02923.1| Importin subunit alpha-1 [Glycine soja]
Length=530

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+   L 
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAHQQLP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A    +  DK LE +P MV GVWS D ++Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   APLQNSTVDKNLESLPAMVAGVWSNDNSLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G V   + LL S 
Sbjct  323  IINHGALPCLLNLLTNNHKKSIKKEACWTISNITAGNKEQIQTVIEAGLVAPLVNLLQSA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEASWAISN  396


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V+S D  V  +A       LS   +  I  VI+AGV PR +Q L     P + 
Sbjct  245  LPALERLVFSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLMQLLMHPS-PSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP-SDDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+ +I HGA+P  + LL++     ++++A W + N+ AG+
Sbjct  303  IPALRTVGNIVTGDDMQTQCIINHGALPCLLNLLTNNHKKSIKKEACWTISNITAGN  359



>ref|XP_002318966.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE94889.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQ-AMP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVW+ED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASLHSSAAEKKLEHLPSMVAGVWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F+QLL+SPSDDVREQAV
Sbjct  120  FVQFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>emb|CDY22779.1| BnaA08g06090D [Brassica napus]
Length=534

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 173/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS----Q  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQS    Q
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQSTQQPQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                +  S  + +K+LE +P MV GVWSED  +Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVASATSVEKKLESLPSMVGGVWSEDRNLQLEATTQFRKLLSIERSPPIEEVIAAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL+R+D PQLQFEAAWALTN+ASGTSEHT+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLKRDDYPQLQFEAAWALTNIASGTSEHTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPQCRDLVLG  203



>ref|XP_008368355.1| PREDICTED: importin subunit alpha-1a-like [Malus domestica]
Length=368

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQPQQFAS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + Q P+  +K+LE +P MV GVWS+D  +Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLQ-PSNLEKKLESLPAMVAGVWSDDNNLQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSE+T+VVIE GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVAFLIREDFPQLQFEAAWALTNIASGTSENTKVVIEQGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>gb|EPS62504.1| hypothetical protein M569_12283, partial [Genlisea aurea]
Length=535

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 175/200 (88%), Gaps = 0/200 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRK++RE+NLLKKRRE LQ+Q    
Sbjct  6    MSLRPSAKTEVRRSRYKVAVDAEEGRRRREDNMVEIRKNRREENLLKKRREGLQNQQFPA  65

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A+ + +  DK+LE +P MV GVWS D A+Q+EATTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  66   AAVNVSLVDKKLENLPGMVAGVWSNDGALQLEATTQFRKLLSIERNPPIEEVIQSGVVPR  125

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R+D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  126  FVEFLARDDYPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVRLLTSPSDDVREQAV  185

Query  681  WALGNVAGDSPTCRDLVLGM  740
            WALGNVAGDSP CRDLVLG 
Sbjct  186  WALGNVAGDSPKCRDLVLGY  205



>ref|XP_011023748.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQ-AMP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV G+W+ED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASIHSSAAEKKLEHLPSMVAGIWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F+QLL+SPSDDVREQAV
Sbjct  120  FVQFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  E  + VIE   +   + LL S 
Sbjct  322  IINHQALPCLLNLLANNYKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVNLLQSA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>emb|CDY52043.1| BnaC08g48070D [Brassica napus]
Length=534

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS----Q  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQS    Q
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQSTQQPQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                +  S  + +K+LE +P MV GVWSED  +Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVASATSVEKKLESLPSMVGGVWSEDRNLQLEATTQFRKLLSIERSPPIEEVIAAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTSEHT+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLNRDDYPQLQFEAAWALTNIASGTSEHTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203



>ref|XP_009623317.1| PREDICTED: importin subunit alpha-like isoform X7 [Nicotiana 
tomentosiformis]
Length=348

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            D SQSPA  +KR LE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVV
Sbjct  61   DTSQSPALLEKRQLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ
Sbjct  121  PRFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQ  180

Query  675  AVWAL  689
               AL
Sbjct  181  VKPAL  185



>ref|XP_002966958.1| hypothetical protein SELMODRAFT_439828 [Selaginella moellendorffii]
 gb|EFJ31557.1| hypothetical protein SELMODRAFT_439828 [Selaginella moellendorffii]
Length=527

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 173/199 (87%), Gaps = 5/199 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVRKK YK  VD DEARR+REDN+VEIRK+KR++NL+KKRRE +Q QH + 
Sbjct  1    MSLRPQARTEVRKKGYKNAVDPDEARRKREDNMVEIRKNKRDENLMKKRREGMQPQHFM-  59

Query  321  ASQSPAA-PDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
               +P +  +++LE +P+MV GVWS+DP +Q+EATTQFRKLLSIER PPI+EVIKAGVVP
Sbjct  60   ---TPGSIVERKLESLPVMVSGVWSDDPNLQVEATTQFRKLLSIERRPPIEEVIKAGVVP  116

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL+R+D  QLQFEAAWALTN+ASGTS+HT VVI HGAVP F+QLLSSPS+DVREQA
Sbjct  117  RFVEFLKRHDFHQLQFEAAWALTNIASGTSDHTTVVINHGAVPIFVQLLSSPSEDVREQA  176

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  177  VWALGNVAGDSPKCRDLVL  195


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L       ++ EA W ++N+ +G  +  + VIE   +P  ++LL++ 
Sbjct  320  IINNGALPYLLHLLTNVYKKSIKKEACWTISNITAGNKDQIQAVIEANIIPPLVELLANA  379

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  380  EFDIKKEAAWAISN  393



>ref|XP_001773629.1| predicted protein [Physcomitrella patens]
 gb|EDQ61517.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 174/200 (87%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL-QSQHVL  317
            MSLRP  R E RKK YK+ VDADEARR+REDN+VEIRKSKRE++LLKKRR+ + Q    +
Sbjct  1    MSLRPNARVEGRKKGYKLAVDADEARRKREDNMVEIRKSKREESLLKKRRDGMPQLPQFV  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             ++QS  +  K+LE +P +V G++S+DPA Q+EATTQFRKLLSIERSPPI+EVI AGVVP
Sbjct  61   PSAQSSLSDKKQLESLPALVSGLYSDDPATQLEATTQFRKLLSIERSPPIEEVISAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R+D PQLQFEAAWALTN+ASGTS+HTRVVI+HGAVP F+QLLSSPSDDVREQA
Sbjct  121  RFVEFLVRSDFPQLQFEAAWALTNIASGTSDHTRVVIDHGAVPIFVQLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVLG  737
            VWALGNVAGDSP CRDLVLG
Sbjct  181  VWALGNVAGDSPKCRDLVLG  200



>gb|KJB28705.1| hypothetical protein B456_005G065400 [Gossypium raimondii]
Length=528

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPSTRTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQ-LS  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +  +K+LE +P MV GVWS + + Q+EATTQFRKLLSIERSPPIDEVI++GVVPR
Sbjct  60   ASLQSSNVEKKLESLPSMVAGVWSSNGSAQLEATTQFRKLLSIERSPPIDEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|XP_009623316.1| PREDICTED: importin subunit alpha-like isoform X6 [Nicotiana 
tomentosiformis]
Length=351

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            D SQSPA  +KR LE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVV
Sbjct  61   DTSQSPALLEKRQLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ
Sbjct  121  PRFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQ  180

Query  675  AVWAL  689
               AL
Sbjct  181  VKPAL  185



>ref|XP_009623313.1| PREDICTED: importin subunit alpha-like isoform X3 [Nicotiana 
tomentosiformis]
Length=371

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            D SQSPA  +KR LE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVV
Sbjct  61   DTSQSPALLEKRQLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ
Sbjct  121  PRFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQ  180

Query  675  AVWAL  689
               AL
Sbjct  181  VKPAL  185



>ref|XP_010268071.1| PREDICTED: importin subunit alpha-1-like [Nelumbo nucifera]
Length=529

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRPG RTE+R+  YK+ VDA+E RRRREDN+VEIRK++RE++LLKKRRE +Q+Q  L 
Sbjct  1    MSLRPGARTEIRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLLKKRREGMQAQQFLT  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  +    +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   AVHASTV-EKKLESLPSMVAGVWSDDGGLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLLREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_008355762.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1a-like, 
partial [Malus domestica]
Length=228

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ Q +  
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQPQQLSS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +  S    DK+LE +P MV GVW ++ ++Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   SLHSSGL-DKKLEHLPSMVSGVWGDEGSLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_011100802.1| PREDICTED: importin subunit alpha-1a-like [Sesamum indicum]
 ref|XP_011100804.1| PREDICTED: importin subunit alpha-1a-like [Sesamum indicum]
Length=527

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRPG R+EVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ Q    
Sbjct  1    MSLRPGARSEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQQQQ-FS  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P +V GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVV R
Sbjct  60   ASLQSSALEKKLESLPSIVNGVWSSDSNLQLEATTQFRKLLSIERSPPIEEVIQSGVVSR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHTRVVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPLFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>ref|XP_007154341.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
 gb|ESW26335.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
Length=529

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQQFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A    +  DK+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   APLQASTVDKKLESLPAMVAGVWSDDNNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (51%), Gaps = 1/110 (1%)
 Frame = +3

Query  366  PLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQF  545
            P +VQ + ++ P+V I A      +++ +       +I  G +P  +  L  N    ++ 
Sbjct  288  PTLVQLLLNQSPSVLIPALRTVGNIVTGDDMQ-TQSIINHGALPCLLNLLNHNHKKSIKK  346

Query  546  EAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            EA W ++N+ +G  E  + VIE G V   + LL +   D++++A WA+ N
Sbjct  347  EACWTISNITAGNKEQIQSVIEAGLVAPLVNLLQNAEFDIKKEAAWAVSN  396



>gb|EPS72719.1| hypothetical protein M569_02038, partial [Genlisea aurea]
Length=320

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRK++RE+NLLKKRRE LQ+Q    
Sbjct  1    MSLRPSAKTEVRRSRYKVAVDAEEGRRRREDNMVEIRKNRREENLLKKRREGLQTQQ-FP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A+ + +  +K+LE +P MV GVWS D ++Q+EATTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  60   AAVNASLLEKKLESLPAMVAGVWSNDGSLQLEATTQFRKLLSIERNPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R+D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LL+S SDDVREQAV
Sbjct  120  FVEFLARDDYPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVRLLTSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPKCRDLVLG  198



>gb|AES65063.2| importin subunit alpha-1b [Medicago truncatula]
Length=530

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQNQPQFT  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
              QS +  +K+LE +P MV GVWS+D   Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   PLQSSSIVEKKLESLPAMVAGVWSDDNNQQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVQFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  323  IIGHGSLPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WAL N
Sbjct  383  EFDIKKEAAWALSN  396



>gb|AAD09923.1| importin alpha homolog [Arabidopsis thaliana]
Length=404

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S S A+ DK+L+ +  MV GVWS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  60   PSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_009107883.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
Length=534

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 173/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS----Q  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQS    Q
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQSTQQPQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                +  S  + +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVASATSVEKKLESLPSMVGGVWSDDRNLQLEATTQFRKLLSIERSPPIEEVIAAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL+R+D PQLQFEAAWALTN+ASGTSEHT+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLKRDDYPQLQFEAAWALTNIASGTSEHTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPQCRDLVLG  203



>ref|XP_009623314.1| PREDICTED: importin subunit alpha-like isoform X4 [Nicotiana 
tomentosiformis]
Length=357

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            D SQSPA  +KR LE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVV
Sbjct  61   DTSQSPALLEKRQLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ
Sbjct  121  PRFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQ  180

Query  675  AVWAL  689
               AL
Sbjct  181  VKPAL  185



>ref|XP_006842676.1| PREDICTED: importin subunit alpha-1 [Amborella trichopoda]
 gb|ERN04351.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda]
Length=527

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 174/198 (88%), Gaps = 2/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +R EVRKK+YK+ VDADEARR+REDN+VEIRKSKRE++L KKRRE +Q+Q    
Sbjct  1    MSLRPNSRAEVRKKNYKVAVDADEARRKREDNMVEIRKSKREESLQKKRREGMQAQFA--  58

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             +  P+A DK+LE +P MV  ++SED A+Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  59   PTVQPSAMDKKLESLPNMVAKIYSEDSAMQLEATTQFRKLLSIERSPPIEEVIEAGVVPR  118

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTS++T+VVI+ GAVP F+QLLSSPSDDVREQAV
Sbjct  119  FVQFLTRQDFPQLQFEAAWALTNIASGTSDNTKVVIDQGAVPIFVQLLSSPSDDVREQAV  178

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  179  WALGNVAGDSPKCRDLVL  196


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  E  + VI+   +P  +QLL + 
Sbjct  321  IINNQALPCLLTLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIDANIIPPLVQLLQTA  380

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  381  EFDIKKEAAWAISN  394



>ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatula]
Length=561

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQNQPQFT  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
              QS +  +K+LE +P MV GVWS+D   Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   PLQSSSIVEKKLESLPAMVAGVWSDDNNQQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVQFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198



>gb|EYU44000.1| hypothetical protein MIMGU_mgv1a004419mg [Erythranthe guttata]
Length=528

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRPG R EVR+  YK+ VDADE RRRREDN+VEIRK+KRE++LLKKRRE +Q      
Sbjct  1    MSLRPGARAEVRRSRYKVAVDADEGRRRREDNMVEIRKNKREESLLKKRREGVQQPQQFS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI+AGV+P+
Sbjct  61   ASLQSSPLEKKLESLPSMVNGVWSPDAGLQLEATTQFRKLLSIERSPPIEEVIQAGVIPK  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPNCRDLVLG  199



>ref|XP_009623315.1| PREDICTED: importin subunit alpha-like isoform X5 [Nicotiana 
tomentosiformis]
Length=354

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            D SQSPA  +KR LE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVV
Sbjct  61   DTSQSPALLEKRQLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ
Sbjct  121  PRFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQ  180

Query  675  AVWAL  689
               AL
Sbjct  181  VKPAL  185



>ref|XP_009796163.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana sylvestris]
Length=528

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQPQQPFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A+   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ANLHTSTVEKKLESLPSMVTGVWSNDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I+ G +   +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  323  IIEHGALTCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396



>ref|XP_006480039.1| PREDICTED: importin subunit alpha-like [Citrus sinensis]
 gb|KDO87073.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87074.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=529

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 173/198 (87%), Gaps = 2/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ+   L 
Sbjct  1    MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPL-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + S A  +K+LE +P MV GVWS+D  +Q++ATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   -TNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPR  118

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            F++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LLSSP+DDVREQAV
Sbjct  119  FIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAV  178

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  179  WALGNVAGDSPKCRDLVL  196



>ref|XP_010098874.1| Importin subunit alpha-1a [Morus notabilis]
 gb|EXB75966.1| Importin subunit alpha-1a [Morus notabilis]
Length=359

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRRED++VEIRKS+RE++L KKRRE LQ Q  L 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDHMVEIRKSRREESLQKKRREGLQPQQ-LP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWS+D A+Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   ASVPTSALEKKLEHLPSMVAGVWSDDSALQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>gb|AII99829.1| importin alpha [Nicotiana tabacum]
Length=528

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSL+P  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ Q    
Sbjct  1    MSLKPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQPQQPFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A+   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ANLHTSTVEKKLESLPSMVAGVWSNDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R+D PQLQFEAAWALTN+ASGTSEHT+VVIE GAVP F++LL SPSDDVREQAV
Sbjct  121  FVQFLVRDDFPQLQFEAAWALTNIASGTSEHTKVVIESGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPKCRDLVL  198


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I+ G +   +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  323  IIEHGALTCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396



>emb|CDP17235.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRPG+R E+R+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+  V+ 
Sbjct  1    MSLRPGSRAELRRGRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQNAFVVQ  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +  S    +K+LE +  MV GVW++D ++Q+EATTQFRKLLSIERSPPI EVI+AGVVPR
Sbjct  61   SDTSSV--EKKLENLQAMVAGVWTDDGSLQLEATTQFRKLLSIERSPPIQEVIQAGVVPR  118

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F+QLLSSPSDDVREQAV
Sbjct  119  FVQFLMREDFPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVQLLSSPSDDVREQAV  178

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  179  WALGNVAGDSPKCRDLVLG  197



>ref|XP_002512485.1| importin alpha, putative [Ricinus communis]
 gb|EEF49937.1| importin alpha, putative [Ricinus communis]
Length=531

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQP-MP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASLHSSAVEKKLEHLPSMVAGVWSDDSNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPKCRDLVLG  198



>ref|XP_007138966.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
 gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
Length=529

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQTQQQFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
                 +  +K+LE +P MV GVWS+D + Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   TPLQTSIVEKKLESLPAMVAGVWSDDNSQQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPRCRDLVLG  199


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  323  IINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNREQIQAVIEAGLIAPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396



>ref|XP_010098873.1| Importin subunit alpha-1a [Morus notabilis]
 gb|EXB75965.1| Importin subunit alpha-1a [Morus notabilis]
Length=393

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRRED++VEIRKS+RE++L KKRRE LQ Q  L 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDHMVEIRKSRREESLQKKRREGLQPQQ-LP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWS+D A+Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   ASVPTSALEKKLEHLPSMVAGVWSDDSALQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|XP_009623311.1| PREDICTED: importin subunit alpha-like isoform X1 [Nicotiana 
tomentosiformis]
Length=377

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTEVRKKSYKIGVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQSQ + 
Sbjct  1    MSLRPSSRTEVRKKSYKIGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQSQQLP  60

Query  318  DASQSPAAPDKR-LECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            D SQSPA  +KR LE IP MVQGV SEDPA QIEATT FRKLLSIERSPPIDEVI AGVV
Sbjct  61   DTSQSPALLEKRQLESIPAMVQGVCSEDPATQIEATTHFRKLLSIERSPPIDEVINAGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRF +FL R+DLPQLQFEAAWALTNVASGTSEHTRVV+EHGAVPKFIQLLSS SDDVREQ
Sbjct  121  PRFAEFLGRHDLPQLQFEAAWALTNVASGTSEHTRVVMEHGAVPKFIQLLSSASDDVREQ  180

Query  675  AVWAL  689
               AL
Sbjct  181  VKPAL  185



>ref|XP_011046400.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Populus euphratica]
Length=529

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK+KRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLLKKRREGLQAQQFPP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S +  +K+LE +P MV GVWSED  +Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   ALLSSSNVEKKLESLPSMVAGVWSEDGNLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLVREDXPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPKCRDLVL  198


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE+G +   + LL + 
Sbjct  323  IINTGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIENGLIGPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAVSN  396



>ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum]
Length=529

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NL KKRRE LQ+     
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLQKKRREGLQANQQF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A    A  +K+LE +P MV GVW+ED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   AVPVQATVEKKLENLPAMVAGVWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R+D PQLQFEAAWALTN+ASGTSEHT+VVIE GAVP F++LLSSPSDDVREQAV
Sbjct  120  FVQFLMRDDFPQLQFEAAWALTNIASGTSEHTKVVIESGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>ref|XP_001773628.1| predicted protein [Physcomitrella patens]
 gb|EDQ61516.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR K YK+ VDA EARR+RED +VEIRKSKR++NL KKRRE  Q      
Sbjct  1    MSLRPSARTEVRMKGYKLAVDAMEARRKREDGMVEIRKSKRDENLQKKRREGSQLHQQFT  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             +QS ++  K+LE +P MV  + S+DPA Q+EATTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  61   PAQSASSEKKQLESLPGMVAAICSDDPATQLEATTQFRKLLSIERSPPIEEVISAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
             V+FL R D PQLQFEAAWALTN+ASGTS+HTRVVI+HGAVP F+QLLSSPSDDVREQAV
Sbjct  121  IVEFLVRGDFPQLQFEAAWALTNIASGTSDHTRVVIDHGAVPIFVQLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGN+AGDSP CRDLVLG
Sbjct  181  WALGNIAGDSPKCRDLVLG  199



>ref|XP_010486198.1| PREDICTED: importin subunit alpha-1 isoform X1 [Camelina sativa]
 ref|XP_010486199.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486200.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486201.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
Length=534

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS-QHVL  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+ Q   
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQDFS  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             AS +P A  K+LE +P MV G+WS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVP
Sbjct  61   LASSAPHAASKKLESLPDMVAGIWSDDPALQLESTTQFRKLLSIERSPPIEEVIGAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL++ + P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQA
Sbjct  121  RFVEFLKKEEYPAIQFEAAWALTNIASGTSDHTKVVIDHDAVPIFVQLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPQCRDLVL  199


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI +G +P     L +N    ++ EA W ++N+ +G  +  + V+E   +   + LL + 
Sbjct  324  VINSGALPCLANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVEANLITPLVNLLQNA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>ref|XP_008458386.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
 ref|XP_008458387.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
Length=530

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPTARTEVRRNRYKVSVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFPS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  +    +K+LE +P MV GVWS++ ++Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   AVHTSTV-EKKLESLPSMVAGVWSDNSSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLVREDFPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSPTCRDLVL
Sbjct  180  WALGNVAGDSPTCRDLVL  197


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +P  + LL + 
Sbjct  322  IINDGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIPPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_002519178.1| importin alpha, putative [Ricinus communis]
 gb|EEF43042.1| importin alpha, putative [Ricinus communis]
Length=488

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK+KRE+NL KKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREENLQKKRREGLQAQQFPA  60

Query  321  A-SQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
            A + + +  +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   AVNLTSSNMEKKLESLPAMVAGVWSDDKSLQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL+SPSDDVREQA
Sbjct  121  RFVEFLVREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPKCRDLVL  199



>ref|XP_004150082.1| PREDICTED: importin subunit alpha-1 [Cucumis sativus]
 gb|KGN47403.1| hypothetical protein Csa_6G312550 [Cucumis sativus]
Length=530

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPTARTEVRRNRYKVSVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFPS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  +    +K+LE +P MV GVWS++ ++Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   AVHTSTV-EKKLESLPSMVAGVWSDNSSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLVREDFPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSPTCRDLVL
Sbjct  180  WALGNVAGDSPTCRDLVL  197



>ref|XP_012084020.1| PREDICTED: importin subunit alpha-2 isoform X2 [Jatropha curcas]
 gb|KDP27876.1| hypothetical protein JCGZ_18956 [Jatropha curcas]
Length=529

 Score =   277 bits (709),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTE R+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEARRNRYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLQAQQFPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + S AA +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   TALSSAA-EKKLESLPSMVAGVWSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            F++FL R D PQLQFEAAWALTN+ASGTSEHTRVVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  120  FIEFLVREDFPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  322  VISYGALPYLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_007031101.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 4 [Theobroma 
cacao]
 gb|EOY11603.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 4 [Theobroma 
cacao]
Length=530

 Score =   277 bits (709),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQP-MP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWSED  +Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASLHSSAVEKKLENLPAMVAGVWSEDSNLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_007031099.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 ref|XP_007031100.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11601.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11602.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
Length=529

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQP-MP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWSED  +Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASLHSSAVEKKLENLPAMVAGVWSEDSNLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_006380206.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
 gb|ERP58003.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
Length=383

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRT+VR+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE L +Q    
Sbjct  1    MSLRPSTRTDVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLLAQQFPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S +  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   AVLSSSNMEKKLESLPSMVSGVWSDDSNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+ L R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVELLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPKCRDLVL  198



>ref|XP_012082851.1| PREDICTED: importin subunit alpha-like [Jatropha curcas]
 gb|KDP28222.1| hypothetical protein JCGZ_13993 [Jatropha curcas]
Length=535

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 175/203 (86%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK+KRE+NL KKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNKYKVAVDADEGRRRREDNMVEIRKNKREENLQKKRREGLQAQQQQQ  60

Query  315  --LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
              L +S + +A DK+LE +P+MV GVWSE+   Q+EATT FRKLLSIERSPPI+EV++AG
Sbjct  61   QQLTSSFTNSANDKKLESLPVMVAGVWSEEQNSQLEATTHFRKLLSIERSPPINEVVQAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRF++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LLSSP+DDVR
Sbjct  121  VVPRFIEFLARDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLSSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGN+AGDSP CRDLVLG
Sbjct  181  EQAVWALGNIAGDSPKCRDLVLG  203



>gb|KJB41863.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=429

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLAQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSTAGSEKKLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VVPRFVEFLNRDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum]
Length=531

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQPQFP  60

Query  321  AS-QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             S QS +  +++LE +P M+ GVWS+D + Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   TSVQSSSIVERKLESLPAMIAGVWSDDNSQQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQA
Sbjct  121  RFVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPRCRDLVL  199


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  324  IINHGSLPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>ref|XP_006355403.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006355404.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Solanum 
tuberosum]
Length=529

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV-L  317
            MSLRP  RTEVR+  YK+ VDADE RRRREDNLVEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSDRTEVRRNRYKVAVDADEGRRRREDNLVEIRKSKREESLLKKRREGLQAQQQQF  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             A+   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   PANLQTSTVEKKLESLPSMVAGVWSNDNNMQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL+SPSDDVREQA
Sbjct  121  RFVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPRCRDLVL  199



>ref|XP_011082432.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE+NLLKKRRE LQ+Q +  
Sbjct  1    MSLRPSARTEVRRSRYKVAVDAEEGRRRREDNMVEIRKNRREENLLKKRREGLQAQQLQP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
                P   DK+LE +P MV G+WS D A+Q+EATTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  61   TVNVPQL-DKKLESLPAMVAGLWSNDGALQLEATTQFRKLLSIERNPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R+D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSS SDDVREQAV
Sbjct  120  FVEFLARDDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVRLLSSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>ref|XP_009146474.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
 emb|CDY32215.1| BnaA01g17690D [Brassica napus]
Length=530

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ+  +  
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQATQLPQ  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + + ++ +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  61   VTSAASSVEKKLESLPSMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+H AVP F+QLL+S SDDVREQAV
Sbjct  121  FVEFLMREDYPQLQFEAAWALTNIASGTSEHTKVVIQHDAVPIFVQLLASQSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPQCRDLVL  198



>ref|XP_007035723.1| Importin subunit alpha-1a isoform 3 [Theobroma cacao]
 gb|EOY06649.1| Importin subunit alpha-1a isoform 3 [Theobroma cacao]
Length=416

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPSTRTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFAA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + QS  A +K+LE +P +V GVWS++   Q+E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SMQSSNA-EKKLESLPSLVAGVWSDNGTAQLEGTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  120  FVEFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|XP_008340751.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=529

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQPQQFAS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + Q P+  +K+LE +P MV GVWS+D  +Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLQ-PSNLEKKLESLPAMVAGVWSDDNNLQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSE+T+VVIE GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVAFLIREDFPQLQFEAAWALTNIASGTSENTKVVIEQGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + VIE G +   + LL   
Sbjct  322  IINNGSLPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSVIEAGLIGPLVNLLQHA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_010094009.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55043.1| Importin subunit alpha-1 [Morus notabilis]
Length=530

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++L KKRRE LQ Q  L 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLQKKRREGLQPQQ-LP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWS+D A+Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   ASVPTSALEKKLEHLPSMVAGVWSDDSALQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|XP_008797160.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++L KKRRE +Q+Q    
Sbjct  1    MSLRPSERAEVRRNKYKVAVDAEEGRRRREDNMVEIRKSRREESLQKKRREGMQAQPFPP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +S   +A +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   SSIHTSALEKKLESLPAMVAGVYSDDSTLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPRCRDLVLG  199



>ref|XP_010444089.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS-QHVL  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+ Q   
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQDFP  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             AS +P A  K+LE +P MV G+WS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVP
Sbjct  61   LASSAPHAASKKLESLPDMVAGIWSDDPALQLESTTQFRKLLSIERSPPIEEVIGAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL++ + P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQA
Sbjct  121  RFVEFLKKEEHPAIQFEAAWALTNIASGTSDHTKVVIDHDAVPIFVQLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPQCRDLVL  199



>ref|XP_007051048.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 ref|XP_007051049.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95205.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95206.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
Length=534

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLAQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S AA +K+LE +P MV GVWSED   Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSTAASEKKLESLPAMVAGVWSEDRNAQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VVPRFVEFLARDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>gb|KDO71826.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
 gb|KDO71827.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
Length=368

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 170/204 (83%), Gaps = 11/204 (5%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDADE RRRREDN+VEIRK+KRE++LLKKRRE LQSQ    
Sbjct  1    MSLRPNARAEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLLKKRREGLQSQQF--  58

Query  321  ASQSPAAP------DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                P AP        +LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI+
Sbjct  59   ---PPPAPASNLNLQTKLESLPAMVAGVWSDDSSLQLEATTQFRKLLSIERSPPIEEVIQ  115

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDD
Sbjct  116  SGVVPRFVEFLMREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDD  175

Query  663  VREQAVWALGNVAGDSPTCRDLVL  734
            VREQAVWALGNVAGDSP CRDLVL
Sbjct  176  VREQAVWALGNVAGDSPRCRDLVL  199


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 4/116 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            IPL+ Q       ++   AT         +  PP D+V  A  +P   Q +  ND  ++ 
Sbjct  205  IPLLAQLNERAKLSMLRNATWTLSNFCRGKPQPPFDQVRPA--LPALAQLVHSND-EEVL  261

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAGD  707
             +A WAL+ ++ GT++  + VIE G  P+ ++LL  PS  V   A+  +GN V GD
Sbjct  262  TDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLGHPSPSVLIPALRTVGNIVTGD  317



>ref|XP_012088940.1| PREDICTED: importin subunit alpha-2 [Jatropha curcas]
 gb|KDP23418.1| hypothetical protein JCGZ_23251 [Jatropha curcas]
Length=528

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 172/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ    + 
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQP---MP  57

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  58   ASIHSSAVEKKLEHLPSMVAGVWSDDSSLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  117

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL SPSDDVREQAV
Sbjct  118  FVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLGSPSDDVREQAV  177

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  178  WALGNVAGDSPKCRDLVLG  196


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  320  IINHQALPCLLNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVIEAGIIGPLVHLLQNA  379

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  380  EFDIKKEAAWAISN  393


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +3

Query  459  PPIDEVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQ  638
            PP D+V  A  +P   + +  ND  ++  +A WAL+ ++ GT++  + VIE G  P+ ++
Sbjct  233  PPFDQVKPA--LPALARLIHSND-EEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVE  289

Query  639  LLSSPSDDVREQAVWALGN-VAGD  707
            LL  PS  V   A+  +GN V GD
Sbjct  290  LLLHPSPSVLIPALRTVGNIVTGD  313



>gb|KJB82641.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
 gb|KJB82642.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
Length=529

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 175/198 (88%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPNSRTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQP-MP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVW++D  +Q+EATTQFRKLLSIERSPPID+VI+AGVVPR
Sbjct  60   ASLHSSAVEKKLENLPAMVAGVWADDSNMQLEATTQFRKLLSIERSPPIDQVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            F++FL R+D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  120  FIEFLARDDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I   V+P  +  L  N    ++ EA W ++N+ +G  E  + VIE   +   + LL + 
Sbjct  322  IINHQVLPCLLNLLTNNFKKSIKKEACWTISNITAGNKEQIQAVIEANIISPLVHLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>emb|CDY34430.1| BnaC01g22030D [Brassica napus]
Length=530

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ+  +  
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQATQLPQ  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + + ++ +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  61   VTSAASSVEKKLESLPSMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIGAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+H AVP F+QLL+S SDDVREQAV
Sbjct  121  FVDFLMREDYPQLQFEAAWALTNIASGTSEHTKVVIQHDAVPIFVQLLASQSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPQCRDLVL  198



>ref|NP_187328.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 ref|NP_850524.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 sp|Q96321.2|IMPA1_ARATH RecName: Full=Importin subunit alpha-1; Short=IMPa-1; AltName: 
Full=Karyopherin subunit alpha-1; Short=KAP-alpha-1 [Arabidopsis 
thaliana]
 gb|AAC27644.1| importin alpha [Arabidopsis thaliana]
 gb|AAF63826.1| importin alpha [Arabidopsis thaliana]
 gb|AAM19769.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAM67050.1| importin alpha [Arabidopsis thaliana]
 gb|AAM78039.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AEE74447.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 gb|AEE74448.1| Importin subunit alpha-1 [Arabidopsis thaliana]
Length=532

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S S A+ DK+L+ +  MV GVWS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  60   PSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE--VIKAGVVPRFVQFLERNDLPQ  536
            +P +V+ +    P+V I A    R + +I     I    VI +G +P     L +N    
Sbjct  286  VPKLVELLLHHSPSVLIPA---LRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKS  342

Query  537  LQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            ++ EA W ++N+ +G  +  + V+E   +   + LL +   D++++A WA+ N
Sbjct  343  IKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISN  395



>emb|CAA74966.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=528

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 171/195 (88%), Gaps = 6/195 (3%)
 Frame = +3

Query  168  EVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE--VLQSQ----HVLDASQ  329
            E+RKK YK GVDADEARRRREDNLVEIRK+KRED+LLKKRRE  +LQ Q      LD  Q
Sbjct  1    ELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQLPLGAGLDGPQ  60

Query  330  SPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQ  509
            + AA +KRLE IP+MVQGV+S+DP  Q+EATTQFRKLLSIERSPPIDEVIKAGV+PRFV+
Sbjct  61   TAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIKAGVIPRFVE  120

Query  510  FLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWAL  689
            FL R+D PQLQFEAAWALTNVASGTS+HTRVVIE GAVP F++LL+S SDDVREQAVWAL
Sbjct  121  FLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVKLLTSASDDVREQAVWAL  180

Query  690  GNVAGDSPTCRDLVL  734
            GNVAGDSP CR+LVL
Sbjct  181  GNVAGDSPNCRNLVL  195



>ref|XP_004244944.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=529

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 171/203 (84%), Gaps = 11/203 (5%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NL KKRRE LQ      
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLQKKRREGLQ------  54

Query  321  ASQSPAAP-----DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKA  485
            A+Q  + P     +K+LE +P MV GVW+ED  +Q+EATTQFRKLLSIERSPPI+EVI+A
Sbjct  55   ANQQFSVPVQSTVEKKLENLPAMVAGVWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQA  114

Query  486  GVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDV  665
            GVVPRFVQFL R+D PQLQFEAAWALTN+ASGTSEHT+VVIE GAVP F++LLSSPSDDV
Sbjct  115  GVVPRFVQFLIRDDFPQLQFEAAWALTNIASGTSEHTKVVIESGAVPIFVKLLSSPSDDV  174

Query  666  REQAVWALGNVAGDSPTCRDLVL  734
            REQAVWALGNVAGDSP CRDLVL
Sbjct  175  REQAVWALGNVAGDSPKCRDLVL  197



>ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 ref|XP_010649542.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 emb|CBI22923.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A+ +    +K+LE +P MV GVWS++ ++Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   AAHASTV-EKKLESLPSMVAGVWSDNSSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  322  IINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGVIAPLVHLLQTA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_008388495.1| PREDICTED: importin subunit alpha-1b-like [Malus domestica]
Length=530

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQTQQ-LP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +S   A  DK+LE +P MV GVW ++  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   SSLHSAGLDKKLEHLPSMVAGVWGDEGTMQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I+   +P  +  L  N    ++ EA W ++N+ +G  E  R V+E   +   + LL + 
Sbjct  322  IIQHQALPCLLNLLTNNYKKSIKKEACWTISNITAGNKEQIRAVVEANIIGPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>gb|AAB72116.2| AtKAP alpha [Arabidopsis thaliana]
Length=532

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S S A+ DK+L+ +  MV GVWS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  60   PSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE--VIKAGVVPRFVQFLERNDLPQ  536
            +P +V+ +    P+V I A    R + +I     I    VI +G +P     L +N    
Sbjct  286  VPKLVELLLHHSPSVLIPA---LRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKS  342

Query  537  LQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            ++ EA W ++N+ +G  +  + V+E   +   + LL +   D++++A WA+ N
Sbjct  343  IKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISN  395



>ref|XP_009347771.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009347772.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQFAP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + Q P+  +K+LE +P MV GVWS+D ++Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLQ-PSNLEKKLESLPAMVAGVWSDDNSLQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSE+T+VVIE GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVAFLMREDFPQLQFEAAWALTNIASGTSENTKVVIEQGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + VIE G +   + LL   
Sbjct  322  IINNGSLPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSVIEAGLIGPLVNLLQHA  381

Query  654  SDDVREQAVWALGN-VAGDSP  713
              D++++A WA+ N  +G +P
Sbjct  382  EFDIKKEAAWAISNATSGGTP  402



>ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006586905.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 ref|XP_006586906.1| PREDICTED: importin subunit alpha-1-like isoform X3 [Glycine 
max]
Length=531

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQQFP  60

Query  321  AS-QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
               Q+ +  +K+LE +P MV GVWS+D + Q+EATTQFRKLLSIERSPPI+EVI+AGVVP
Sbjct  61   TPLQAASIVEKKLESLPAMVAGVWSDDNSQQLEATTQFRKLLSIERSPPIEEVIQAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQA
Sbjct  121  RFVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPKCRDLVL  199


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + V+E G +   + LL + 
Sbjct  324  IINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVVEAGLIAPLVNLLQNA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>tpg|DAA53968.1| TPA: hypothetical protein ZEAMMB73_409958 [Zea mays]
Length=318

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++LLK+RRE LQ+Q    
Sbjct  1    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKRRREGLQAQ----  56

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
                P+  +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVIK+GVVPR
Sbjct  57   VPAPPSGVEKKLESLPAMVSGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIKSGVVPR  116

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQ L R DLPQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  117  FVQLLTREDLPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSGSDDVREQAV  176

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  177  WALGNVAGDSPKCRDLVLA  195



>ref|XP_012084019.1| PREDICTED: importin subunit alpha-2 isoform X1 [Jatropha curcas]
Length=531

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTE R+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEARRNRYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLQAQQFPA  60

Query  321  ASQSPAAPDK-RLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             + S AA  K +LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   TALSSAAEKKFQLESLPSMVAGVWSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RF++FL R D PQLQFEAAWALTN+ASGTSEHTRVVI+HGAVP F++LL+SPSDDVREQA
Sbjct  121  RFIEFLVREDFPQLQFEAAWALTNIASGTSEHTRVVIDHGAVPIFVKLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPKCRDLVL  199


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  324  VISYGALPYLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQNA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>gb|KHG29743.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=556

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 175/198 (88%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPNSRTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQP-MP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVW++D  +Q+EATTQFRKLLSIERSPPID+VI+AGVVPR
Sbjct  60   ASLHSSAVEKKLENLPAMVAGVWADDSNMQLEATTQFRKLLSIERSPPIDQVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            F++FL R+D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  120  FIEFLARDDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|XP_001763761.1| predicted protein [Physcomitrella patens]
 gb|EDQ71403.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR K YK+ VDA EARR+RED +VEIRK+KR+++L KKRRE  Q      
Sbjct  1    MSLRPNARTEVRMKGYKLAVDALEARRKREDGMVEIRKTKRDESLQKKRREGSQLHQQFA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             +QS  A  K+LE +P  V  ++++DPA Q+EATT FRKLLSIERSPPIDEVI AGVVPR
Sbjct  61   PTQSSTADRKQLESLPASVSAIYTDDPATQLEATTHFRKLLSIERSPPIDEVIAAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS+HTRVVI+HGAVP F+QLL SPSDDVREQAV
Sbjct  121  FVEFLGRGDFPQLQFEAAWALTNIASGTSDHTRVVIDHGAVPIFVQLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPKCRDLVLG  199



>ref|XP_009369966.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQFAP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + Q P+  +K+LE +P MV GVWS+D ++Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLQ-PSNLEKKLESLPAMVAGVWSDDNSLQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSE+T+VVIE GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVAFLMREDFPQLQFEAAWALTNIASGTSENTKVVIEQGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + VIE G +   + LL   
Sbjct  322  IINNGSLPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQSVIEAGLIGPLVNLLQHA  381

Query  654  SDDVREQAVWALGN-VAGDSP  713
              D++++A WA+ N  +G +P
Sbjct  382  EFDIKKEAAWAISNATSGGTP  402



>ref|XP_009631847.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis]
Length=529

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ-SQHVL  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ  Q   
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQPQQQPF  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             A+   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   PANLHTSTVEKKLESLPSMVAGVWSNDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL SPSDDVREQA
Sbjct  121  RFVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLGSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPRCRDLVL  199


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I+ G +   +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  324  IIEHGALTCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>gb|KJB12652.1| hypothetical protein B456_002G029800, partial [Gossypium raimondii]
Length=462

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTE R+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  57   MSLRPSTRTEARRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQ-FA  115

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +  +K+LE +P MV GVWS++ A Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  116  ASLHSSNVEKKLESLPSMVAGVWSDNGAAQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  175

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+ GAVP F++LL+SPSDDVREQAV
Sbjct  176  FVEFLGREDFPQLQFEAAWALTNIASGTSDNTKVVIDLGAVPIFVKLLASPSDDVREQAV  235

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  236  WALGNIAGDSPRCRDLVL  253



>ref|XP_007031098.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
 gb|EOY11600.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
Length=599

 Score =   277 bits (708),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  + 
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQP-MP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +A +K+LE +P MV GVWSED  +Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   ASLHSSAVEKKLENLPAMVAGVWSEDSNLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198



>ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006597715.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
Length=531

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQQFP  60

Query  321  AS-QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
               Q+ +  +K+LE +P MV GVWS+D + Q+EATTQFRKLLSIERSPPI+EVI+AGVVP
Sbjct  61   TPLQASSIVEKKLESLPAMVAGVWSDDNSQQLEATTQFRKLLSIERSPPIEEVIQAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQA
Sbjct  121  RFVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPRCRDLVL  199


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + VIE G +   + LL + 
Sbjct  324  IINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVIEAGLIAPLVNLLQNA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera]
 emb|CBI39567.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPSARTEVRRNRYKVSVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQ-TLP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   AA +K+LE +P MV GVW++D  +Q+EATTQFRKLLSIER PPI+EVI++GVVPR
Sbjct  60   ASIHSAAVEKKLEFLPSMVAGVWTDDSNIQLEATTQFRKLLSIERCPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLVREDFPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPVFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  E  + VIE   +   + LL + 
Sbjct  322  IINHQALPCLLNLLTNNHKKSIKKEACWTISNITAGNKEQIQAVIEANIIGPLVHLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>gb|AAL06825.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=532

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S S A+ DK+L+ +  MV GVWS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  60   PSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WA GNVAGDSP CRDLVLG
Sbjct  180  WAFGNVAGDSPRCRDLVLG  198


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE--VIKAGVVPRFVQFLERNDLPQ  536
            +P +V+ +    P+V I A    R + +I     I    VI +G +P     L +N    
Sbjct  286  VPKLVELLLHHSPSVLIPA---LRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKS  342

Query  537  LQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            ++ EA W ++N+ +G  +  + V+E   +   + LL +   D++++A WA+ N
Sbjct  343  IKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISN  395



>ref|XP_008360253.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Malus domestica]
Length=485

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQFAP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + Q  +  +K+LE +P MV GVWS+D ++Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLQX-SNLEKKLESLPAMVAGVWSDDNSLQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSE+T+VVIE GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVAFLMREDFPQLQFEAAWALTNIASGTSENTKVVIEQGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|NP_001154239.1| importin alpha isoform 2 [Arabidopsis thaliana]
 ref|NP_567485.4| importin alpha isoform 2 [Arabidopsis thaliana]
 sp|F4JL11.1|IMPA2_ARATH RecName: Full=Importin subunit alpha-2; Short=IMPa-2 [Arabidopsis 
thaliana]
 gb|AEE83699.1| importin alpha isoform 2 [Arabidopsis thaliana]
 gb|AEE83700.1| importin alpha isoform 2 [Arabidopsis thaliana]
Length=535

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+  +  
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ  60

Query  321  ASQSP----AAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
             + SP    +  +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSPVPASSTVEKKLESLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203



>ref|XP_010259399.1| PREDICTED: importin subunit alpha-1 [Nelumbo nucifera]
Length=529

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE +Q+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGMQAQQFPT  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  + A  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   AIHASAV-EKKLENLPSMVAGVWSDDSGLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLLREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  +  + VIE   +   +QLL + 
Sbjct  322  IINHNALPCLLSLLTHNHKKSIKKEACWTISNITAGNKDQIQAVIEANIIGPLVQLLQTA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_009621534.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
 ref|XP_009621540.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
Length=529

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 169/200 (85%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ--SQHV  314
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NL KKRRE LQ   Q  
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLQKKRREGLQPNQQFT  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            L A  +    +K+LE +P MV GVW+ED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVV
Sbjct  61   LPAHTTV---EKKLENLPAMVAGVWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFVQFL R+D PQLQFEAAWALTN+ASGTSEHT+VVIE GAVP F++LL SPSDDVREQ
Sbjct  118  PRFVQFLVRDDFPQLQFEAAWALTNIASGTSEHTKVVIESGAVPIFVKLLGSPSDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP CRDLVL
Sbjct  178  AVWALGNVAGDSPKCRDLVL  197


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  322  IINHQSLPCLLNLLNGNHKKSIKKEACWTISNITAGNREQIQSVIETGIIGPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>gb|ABM05488.1| Impa2 [Nicotiana benthamiana]
Length=529

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ-SQHVL  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ  Q   
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQPQQQPF  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             A+   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   PANLHTSTVEKKLESLPSMVAGVWSNDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SPSDDVREQA
Sbjct  121  RFVEFLMREDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPRCRDLVL  199


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I+ G +   +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  324  IIEHGALTCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIAPLVNLLQTA  383

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  384  EFDIKKEAAWAISN  397



>ref|XP_006407910.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
 gb|ESQ49363.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
Length=536

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 172/201 (86%), Gaps = 3/201 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS-QHVL  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALPDFP  60

Query  318  DASQSPAAP--DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
             +S S  AP  DK+LE +P MV GVWS+DP++Q+E+TTQFRKLLSIERSPPIDEVI +GV
Sbjct  61   PSSTSSHAPAFDKKLESLPDMVAGVWSDDPSLQLESTTQFRKLLSIERSPPIDEVIGSGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL++ D PQLQFEAAWALTN+ASGTS+HT+VVI+H AV  F+QLL SPSDDVRE
Sbjct  121  VPRFVEFLKKEDYPQLQFEAAWALTNIASGTSDHTKVVIDHNAVSIFVQLLVSPSDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVL  734
            QAVWALGNVAGDSP CRDLVL
Sbjct  181  QAVWALGNVAGDSPQCRDLVL  201


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI +G +P     L +N    ++ EA W ++N+ +G  E  + V+E   +P  + LL + 
Sbjct  326  VISSGALPCLANLLTQNYKKSIKKEACWTISNITAGNKEQIQKVVEANLIPPLVNLLQNA  385

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  386  EFDIKKEAAWAISN  399



>emb|CAA75513.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=532

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S S A+ DK+L+ +  MV GVWS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  60   PSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D P +QFEAAWALTN+ASGTS++T+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDYPAIQFEAAWALTNIASGTSDYTKVVIDHNAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE--VIKAGVVPRFVQFLERNDLPQ  536
            +P +V+ +    P+V I A    R + +I     I    VI +G +P     L +N    
Sbjct  286  VPKLVELLLHHSPSVLIPA---LRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKS  342

Query  537  LQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN  695
            ++ EA W ++N+ +G  +  + V+E   +   + LL +   D++++A WA+ N
Sbjct  343  IKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISN  395



>ref|XP_009781699.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Nicotiana 
sylvestris]
Length=529

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 169/200 (85%), Gaps = 5/200 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQ--SQHV  314
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NL KKRRE LQ   Q  
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLQKKRREGLQPNQQFS  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            L A  +    +K+LE +P MV GVW+ED  +Q+EATTQFRKLLSIERSPPI+EVI+AGVV
Sbjct  61   LPAHTTV---EKKLENLPAMVAGVWTEDGNLQLEATTQFRKLLSIERSPPIEEVIQAGVV  117

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFVQFL R+D PQLQFEAAWALTN+ASGTSEHT+VVIE GAVP F++LL SPSDDVREQ
Sbjct  118  PRFVQFLVRDDFPQLQFEAAWALTNIASGTSEHTKVVIESGAVPIFVKLLGSPSDDVREQ  177

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP CRDLVL
Sbjct  178  AVWALGNVAGDSPKCRDLVL  197


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +PR +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  322  IINHQSLPRLLNLLNGNHKKSIKKEACWTISNITAGNREQIQSVIEAGIIGPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>gb|AAK32824.1|AF361811_1 AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAL31160.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=535

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+  +  
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ  60

Query  315  LDASQSPAAP--DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
               S  PA+   +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVPASSTVEKKLESLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203



>gb|KJB41862.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=535

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLAQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSTAGSEKKLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VVPRFVEFLNRDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>emb|CAA74965.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=535

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+  +  
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ  60

Query  315  LDASQSPAAP--DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
               S  PA+   +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVPASSTVEKKLESLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 61/123 (50%), Gaps = 12/123 (10%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDE-----VIKAGVVPRFVQFLERND  527
            +P +V+ +  + P+V I A      L SI  +   D+     VIK+   P  +  L  N 
Sbjct  291  VPRLVELLQHQSPSVLIPA------LRSIGNNVTGDDLQTQCVIKSCAPPSLLGLLTHNH  344

Query  528  LPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAG  704
               ++ EA W ++N+ +G  +  + V E G +   + LL +   D++++A WA+ N  +G
Sbjct  345  KKSIKKEACWTISNITAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISNATSG  404

Query  705  DSP  713
             SP
Sbjct  405  GSP  407



>gb|KHG01621.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
 gb|KJB41859.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41860.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41864.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41865.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=534

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLAQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSTAGSEKKLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VVPRFVEFLNRDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>ref|XP_010094336.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55756.1| Importin subunit alpha-1 [Morus notabilis]
Length=529

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFTP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A   P+  +K+LE +P MV GVWS++ ++Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   APH-PSNLEKKLESLPQMVAGVWSDNTSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D  QLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLVREDFHQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I +G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  322  IINSGALPCLLSLLTHNHKKSIKKEACWTISNITAGNREQIQAVIEAGLIGPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|NP_001042611.1| Os01g0253300 [Oryza sativa Japonica Group]
 sp|Q71VM4.2|IMA1A_ORYSJ RecName: Full=Importin subunit alpha-1a [Oryza sativa Japonica 
Group]
 dbj|BAA31165.1| NLS receptor [Oryza sativa]
 dbj|BAA31166.1| NLS receptor [Oryza sativa Japonica Group]
 dbj|BAA87855.1| putative importin alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF04525.1| Os01g0253300 [Oryza sativa Japonica Group]
 gb|EAZ11274.1| hypothetical protein OsJ_01128 [Oryza sativa Japonica Group]
 dbj|BAG90815.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGT42316.1| NLS receptor [Oryza sativa Japonica Group]
Length=526

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++LLKKRRE LQ+Q  + 
Sbjct  1    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS +    DK+LE +P M+ GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ASAATGV-DKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  120  FVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>gb|EAY73331.1| hypothetical protein OsI_01208 [Oryza sativa Indica Group]
Length=526

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++LLKKRRE LQ+Q  + 
Sbjct  1    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS +    DK+LE +P M+ GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ASAATGV-DKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  120  FVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>gb|KJB12655.1| hypothetical protein B456_002G029800 [Gossypium raimondii]
Length=529

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTE R+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSTRTEARRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQ-FA  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +  +K+LE +P MV GVWS++ A Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   ASLHSSNVEKKLESLPSMVAGVWSDNGAAQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+ GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLGREDFPQLQFEAAWALTNIASGTSDNTKVVIDLGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  180  WALGNIAGDSPRCRDLVL  197


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 60/117 (51%), Gaps = 3/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V S D  V  +A       LS   +  I  VI+AGV PR V+ L  N  P + 
Sbjct  244  LPALERLVHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIQAGVCPRLVELLLSNPSPSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP-SDDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+ +I+HGA+   + LL++     ++++A W + N+ AG+
Sbjct  303  IPALRTVGNIVTGDDLQTQCIIDHGALACLMNLLTNNYKKSIKKEACWTISNITAGN  359


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +   +  L  N    ++ EA W ++N+ +G  E  + VI  G +   + LL + 
Sbjct  323  IIDHGALACLMNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVINAGLIGPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              DV+++A WA+ N
Sbjct  383  EFDVKKEAAWAISN  396



>gb|KJB12653.1| hypothetical protein B456_002G029800 [Gossypium raimondii]
 gb|KJB12654.1| hypothetical protein B456_002G029800 [Gossypium raimondii]
Length=528

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTE R+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSTRTEARRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQ-FA  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS   +  +K+LE +P MV GVWS++ A Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   ASLHSSNVEKKLESLPSMVAGVWSDNGAAQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+ GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVEFLGREDFPQLQFEAAWALTNIASGTSDNTKVVIDLGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  180  WALGNIAGDSPRCRDLVL  197


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +   +  L  N    ++ EA W ++N+ +G  E  + VI  G +   + LL + 
Sbjct  322  IIDHGALACLMNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVINAGLIGPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              DV+++A WA+ N
Sbjct  382  EFDVKKEAAWAISN  395



>gb|KDO81731.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
Length=417

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP ++ + R+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNSKADSRRNKYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLQNQQPLA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
               +     K+LE +P+MV GVWS D  VQ E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   NDVNAPGTAKKLENLPVMVAGVWSNDSGVQYECTTQFRKLLSIERSPPIEEVIRSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLLREDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLYSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  181  WALGNIAGDSPRCRDLVL  198



>gb|AAQ13406.1|AF005265_1 importin [Oryza sativa]
Length=526

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++LLKKRRE LQ+Q  + 
Sbjct  1    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS +    DK+LE +P M+ GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   ASAATGV-DKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  120  FVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>ref|XP_010914512.1| PREDICTED: importin subunit alpha-1b-like [Elaeis guineensis]
Length=531

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++L KKRRE +Q+Q    
Sbjct  1    MSLRPSERAEVRRNKYKVAVDAEEGRRRREDNMVEIRKSRREESLQKKRREGMQAQPFPP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +S   +A +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   SSIHTSALEKKLESLPAMVAGVYSDDSTLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLTREDFPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  181  WALGNVAGDSPRCRDLVLA  199



>gb|KDO81732.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
Length=405

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP ++ + R+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNSKADSRRNKYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLQNQQPLA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
               +     K+LE +P+MV GVWS D  VQ E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   NDVNAPGTAKKLENLPVMVAGVWSNDSGVQYECTTQFRKLLSIERSPPIEEVIRSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLLREDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLYSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  181  WALGNIAGDSPRCRDLVL  198


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 58/117 (50%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P +   + S D  V  +A       LS   +  I  VI+AGV PR  +FL     P + 
Sbjct  245  LPALAHLIHSNDDEVLTDACWAL-SYLSDGTNDKIQAVIEAGVFPRLAEFLMHPS-PSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+ VIE+ A+P  + LLS +    ++++A W + N+ AG+
Sbjct  303  IPALRTVGNIVTGDDMQTQCVIEYQALPCLLNLLSGNYKKSIKKEACWTVSNITAGN  359



>ref|XP_008360251.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Malus domestica]
Length=528

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQFAP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + Q  +  +K+LE +P MV GVWS+D ++Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLQX-SNLEKKLESLPAMVAGVWSDDNSLQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV FL R D PQLQFEAAWALTN+ASGTSE+T+VVIE GAVP F++LL+SPSDDVREQAV
Sbjct  120  FVAFLMREDFPQLQFEAAWALTNIASGTSENTKVVIEQGAVPIFVKLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>pdb|4B8J|A Chain A, Rimp_alpha1a
Length=528

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++LLKKRRE LQ+Q  + 
Sbjct  3    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVP  62

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            AS +    DK+LE +P M+ GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  63   ASAATGV-DKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  121

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQFL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  122  FVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  181

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  182  WALGNVAGDSPKCRDLVL  199



>ref|XP_010546997.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=535

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 174/203 (86%), Gaps = 7/203 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK+KRE++L+KKRR  +Q+  + D
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLMKKRRGGMQA--LQD  58

Query  321  ASQSPAAP-----DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKA  485
               S AAP     +K+LE +P M+ GVWS+DP++Q+E+TTQFRKLLSIERSPPI+EVI++
Sbjct  59   FPPSSAAPQASAVEKKLESLPAMISGVWSDDPSLQLESTTQFRKLLSIERSPPIEEVIQS  118

Query  486  GVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDV  665
            GVVPRFV+FL++ D PQLQFEAAWALTN+ASGTSEHT+VVI+H AVP F QLL+SPSDDV
Sbjct  119  GVVPRFVEFLKKEDFPQLQFEAAWALTNIASGTSEHTKVVIDHEAVPIFAQLLASPSDDV  178

Query  666  REQAVWALGNVAGDSPTCRDLVL  734
            REQAVWALGNVAGDSP CRDLVL
Sbjct  179  REQAVWALGNVAGDSPQCRDLVL  201


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI +G +P     L +N    ++ EA W ++N+ +G  E  + VIE G V   + LL + 
Sbjct  326  VINSGALPCLANLLTQNYKKSIKKEACWTISNITAGNKEQIQAVIEAGLVAPLVNLLQNA  385

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  386  EFDIKKEAAWAISN  399



>ref|XP_007035721.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY06647.1| Importin alpha isoform 1 [Theobroma cacao]
Length=531

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPSTRTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFAA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + QS  A +K+LE +P +V GVWS++   Q+E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SMQSSNA-EKKLESLPSLVAGVWSDNGTAQLEGTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  120  FVEFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197



>ref|XP_007035722.1| Importin alpha isoform 2 [Theobroma cacao]
 gb|EOY06648.1| Importin alpha isoform 2 [Theobroma cacao]
Length=532

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPSTRTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQFAA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            + QS  A +K+LE +P +V GVWS++   Q+E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SMQSSNA-EKKLESLPSLVAGVWSDNGTAQLEGTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  120  FVEFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPRCRDLVL  197


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 3/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V S D  V +  T      LS   +  I  VI+ GV PR V+ L  N  P + 
Sbjct  244  LPALERLVHSNDEEV-LTDTCWALSYLSDGTNDKIQAVIEVGVCPRLVELLLSNPSPSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+ +I+HGA+   + LL+ +    ++++A W + N+ AG+
Sbjct  303  IPALRTVGNIVTGDDLQTQCIIDHGALACLLSLLTHNHKKSIKKEACWTISNITAGN  359



>ref|XP_006380207.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
 gb|ERP58004.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
Length=529

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRT+VR+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE L +Q    
Sbjct  1    MSLRPSTRTDVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLLAQQFPA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A  S +  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   AVLSSSNMEKKLESLPSMVSGVWSDDSNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+ L R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVELLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPKCRDLVL  198


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  323  IINTGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIGPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAVSN  396



>ref|XP_008453860.1| PREDICTED: importin subunit alpha-1 [Cucumis melo]
Length=529

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDADE RRRREDN+VEIRK++RE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNERAEVRRNRYKVAVDADEGRRRREDNMVEIRKNRREESLQKKRREGLQAQQ-LQ  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S   +A +K+LE +P MV GVWS+D ++Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   TSTHSSAVEKKLEHLPSMVAGVWSDDGSLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDS  CRDLVLG
Sbjct  180  WALGNVAGDSSRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L  +  P + 
Sbjct  244  LPALARLIHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLVELL-MHPAPSVL  301

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS-DDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+V+I+H A+P  + LL++     ++++A W + N+ AG+
Sbjct  302  IPALRTVGNIVTGDDLQTQVIIQHNALPCLLNLLTNNHKKSIKKEACWTISNITAGN  358



>ref|XP_009393195.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=530

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE +Q+Q +  
Sbjct  1    MSLRPSERAEVRRNKYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGMQAQPLPQ  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             +   +  +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   TATHASVIEKKLESLPAMVAGVYSDDSTLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPRCRDLVLG  199



>ref|XP_010931697.1| PREDICTED: importin subunit alpha-1b [Elaeis guineensis]
Length=531

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++L KKRRE +Q+Q    
Sbjct  1    MSLRPSERAEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLQKKRREGMQAQPFPP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S   +A +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   PSMHASALEKKLESLPAMVAGVYSDDSTLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  181  WALGNVAGDSPRCRDLVLA  199



>ref|XP_006375444.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
 gb|ABK95987.1| unknown [Populus trichocarpa]
 gb|ERP53241.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
Length=419

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 172/205 (84%), Gaps = 6/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  R EVR+  YK+ VDADE RRRREDNLVEIRK+KRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARVEVRRNKYKVAVDADEGRRRREDNLVEIRKNKREESLLKKRREGLQAQQQQQ  60

Query  315  ----LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                + +S + +A DK L+ +P M+ GVWS+D  +Q E TT FRKLLSIERSPPI+EVI+
Sbjct  61   QQQQVTSSLNISASDKPLDTLPAMIAGVWSDDKNIQFEGTTHFRKLLSIERSPPINEVIQ  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRF++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGA+P F++LLSSP++D
Sbjct  121  SGVVPRFIEFLARDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAIPIFVKLLSSPAED  180

Query  663  VREQAVWALGNVAGDSPTCRDLVLG  737
            VREQAVWALGNVAGDSP CRDLVLG
Sbjct  181  VREQAVWALGNVAGDSPKCRDLVLG  205


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = +3

Query  345  DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERN  524
            D+    +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L R+
Sbjct  245  DQTKPALPALERLIHSNDNEVLTDACWAL-SYLSDGSNEKIQAVIEAGVCPRLVELL-RH  302

Query  525  DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP-SDDVREQAVWALGNV-  698
              P +   A  A+ N+ +G    T+ +I H A+P  + LL++     ++++A W + NV 
Sbjct  303  QSPTVLIPALRAVGNIVTGDDMQTQCMINHQALPCLLNLLTNNYKKSIKKEACWTISNVT  362

Query  699  AGDS  710
            AG++
Sbjct  363  AGNA  366



>ref|XP_008781167.1| PREDICTED: importin subunit alpha-like isoform X1 [Phoenix dactylifera]
Length=567

 Score =   273 bits (698),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 181/232 (78%), Gaps = 34/232 (15%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQS--QH  311
            MSLRP TR E RKK+YK GVDADEARRRREDNLVEIRK+KREDNLLKKRRE +LQ+  Q 
Sbjct  1    MSLRPTTRMEGRKKAYKAGVDADEARRRREDNLVEIRKNKREDNLLKKRREGLLQAGQQA  60

Query  312  VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
                SQ+P+  +K+L+ +P MVQGVWSE+ A+Q+EA TQFRKLLSIER+PPI+EV+KAGV
Sbjct  61   TETPSQAPSGIEKKLDNLPAMVQGVWSENAAMQLEAATQFRKLLSIERNPPIEEVLKAGV  120

Query  492  VPRFVQFLERNDLPQLQ-------------------------------FEAAWALTNVAS  578
            VPRFV+FL R+D+PQLQ                               FEAAWALTNV+S
Sbjct  121  VPRFVEFLSRHDIPQLQVCFNCFFTYFIWGGTLFNVDNKLSILVFSTQFEAAWALTNVSS  180

Query  579  GTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGNVAGDSPTCRDLVL  734
            GTSEHT+VVIE GAVPKF++LLSSP+DDVREQAVWALGN+AGDSP+CRDLVL
Sbjct  181  GTSEHTQVVIEQGAVPKFVELLSSPNDDVREQAVWALGNIAGDSPSCRDLVL  232


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  GV+P  +Q L +     ++ EA W ++N+ +G     + VI+   +   +QLL   
Sbjct  357  VIDNGVLPNLLQLLTQQYRKSIKKEACWTISNITAGNRAQIQAVIDANIIGPLVQLLQHA  416

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  417  EFDIKKEAAWAISN  430



>ref|XP_002882488.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58747.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQDF-  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S S A+ DK+LE +  M+ GV S+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVPR
Sbjct  60   PSASAASVDKKLESLQDMIAGVLSDDPALQLESTTQFRKLLSIERSPPIEEVIAAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D P +QFEAAWALTN+ASGTS+HT+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI +G +P     L +N    ++ EA W ++N+ +G  +  + V+E   +   + LL + 
Sbjct  322  VINSGALPCLANLLTQNYKKSIKKEACWTISNITAGNKDQIQTVVEANLIAPLVSLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395



>ref|XP_009338212.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=530

 Score =   272 bits (695),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ Q  L 
Sbjct  1    MSLRPNARVEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQPQQ-LP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +S   +  DK+LE +P MV GVW ++ ++Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   SSLHSSGLDKKLEHLPSMVSGVWGDEGSLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +3

Query  459  PPIDEVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQ  638
            PP D+V  A  +P   + +  ND  ++  +A WAL+ ++ GT++  + VIE G  P+ ++
Sbjct  235  PPFDQVKPA--LPALARLIHSND-EEVLTDACWALSYLSDGTNDKIQAVIESGVCPRLVE  291

Query  639  LLSSPSDDVREQAVWALGN-VAGD  707
            LL  PS  V   A+  +GN V GD
Sbjct  292  LLMHPSPSVLIPALRTVGNIVTGD  315



>ref|XP_002868159.1| AT3g06720/F3E22_14 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44418.1| AT3g06720/F3E22_14 [Arabidopsis lyrata subsp. lyrata]
Length=583

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+  +  
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ  60

Query  315  LDASQSPAAP--DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
               S  PA+   +K+LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVPASSTVEKKLESLPSMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203



>emb|CDY09716.1| BnaC07g33450D [Brassica napus]
Length=535

 Score =   272 bits (695),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 173/203 (85%), Gaps = 5/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ+  +  
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQATQLPQ  60

Query  315  ---LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKA  485
                  + + ++ +KRLE +P MV GVWSED ++Q+EATTQFRKLLSIERSPPI+EVI+A
Sbjct  61   FDPSSLAAAASSVEKRLESLPSMVGGVWSEDRSLQLEATTQFRKLLSIERSPPIEEVIEA  120

Query  486  GVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDV  665
            GVVPRFV+FL+R D PQLQFEAAWALTN+ASGTS+HT+VVIEHGAVP F+ LL+S SDDV
Sbjct  121  GVVPRFVEFLKRGDYPQLQFEAAWALTNIASGTSDHTKVVIEHGAVPIFVGLLASQSDDV  180

Query  666  REQAVWALGNVAGDSPTCRDLVL  734
            REQAVWALGNVAGDSP CRDLVL
Sbjct  181  REQAVWALGNVAGDSPRCRDLVL  203



>gb|KHG15238.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=534

 Score =   271 bits (694),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ V A+E RRRREDN+VEIRK+KRE+NLLKKRRE L +Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVGAEEGRRRREDNMVEIRKNKREENLLKKRREGLLAQQPQP  60

Query  321  AS----QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S    + +LE +P MV GVWS+D   Q+EATTQFRKLLSIERSPPI+EV++AG
Sbjct  61   QQQQMLSSGVGSENKLESLPAMVVGVWSDDKNAQLEATTQFRKLLSIERSPPINEVVQAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VVPRFVEFLNRDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>gb|KJB49857.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
 gb|KJB49858.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
Length=534

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE L +Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLAQQPQP  60

Query  321  AS----QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S    + +LE +P MV GVWS+D   Q+EATTQFRKLLSIERSPPI+EV++AG
Sbjct  61   QQQQMLSSGVGSENKLESLPAMVVGVWSDDKNAQLEATTQFRKLLSIERSPPINEVVQAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VVPRFVEFLNRDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>ref|XP_006488879.1| PREDICTED: importin subunit alpha-1-like [Citrus sinensis]
Length=532

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 170/204 (83%), Gaps = 11/204 (5%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDADE RRRREDN+VEIRK+KRE++LLKKRRE LQSQ    
Sbjct  1    MSLRPNARAEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLLKKRREGLQSQQF--  58

Query  321  ASQSPAAP------DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                P AP        +LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI+
Sbjct  59   ---PPPAPASNLNLQTKLESLPAMVAGVWSDDSSLQLEATTQFRKLLSIERSPPIEEVIQ  115

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDD
Sbjct  116  SGVVPRFVEFLMREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDD  175

Query  663  VREQAVWALGNVAGDSPTCRDLVL  734
            VREQAVWALGNVAGDSP CRDLVL
Sbjct  176  VREQAVWALGNVAGDSPRCRDLVL  199



>ref|XP_010551087.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
 ref|XP_010551088.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=534

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 173/202 (86%), Gaps = 4/202 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL----QSQ  308
            MSLRP  RT+VR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRREVL    Q Q
Sbjct  1    MSLRPNARTDVRRNRYKVSVDAEEGRRRREDNMVEIRKSKREESLQKKRREVLPASQQPQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                A+ + +A +K+LE +P MV G+WS+D  +Q+EATTQFRKLLSIERSPPI+EVI+AG
Sbjct  61   FPPSAAPALSAVEKKLESLPSMVSGIWSDDRNLQLEATTQFRKLLSIERSPPIEEVIQAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDDVR
Sbjct  121  VVPRFVEFLRREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVL  734
            EQAVWALGNVAGDSP CRDLVL
Sbjct  181  EQAVWALGNVAGDSPRCRDLVL  202


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  327  VISHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNREQIQAVIEAGLIGPLVNLLQTA  386

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  387  EFDIKKEASWAVSN  400


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V S D  V  +A       LS   +  I  VI+AGVVPR V+ L  +  P + 
Sbjct  249  LPALERLVHSTDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVVPRLVELL-LHPSPSVL  306

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+ VI HGA+P  + LL+ +    ++++A W + N+ AG+
Sbjct  307  IPALRTVGNIVTGDDVQTQCVISHGALPCLLSLLTHNHKKSIKKEACWTISNITAGN  363



>gb|KDO71823.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
 gb|KDO71824.1| hypothetical protein CISIN_1g009544mg [Citrus sinensis]
Length=532

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 170/204 (83%), Gaps = 11/204 (5%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDADE RRRREDN+VEIRK+KRE++LLKKRRE LQSQ    
Sbjct  1    MSLRPNARAEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLLKKRREGLQSQQF--  58

Query  321  ASQSPAAP------DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                P AP        +LE +P MV GVWS+D ++Q+EATTQFRKLLSIERSPPI+EVI+
Sbjct  59   ---PPPAPASNLNLQTKLESLPAMVAGVWSDDSSLQLEATTQFRKLLSIERSPPIEEVIQ  115

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDD
Sbjct  116  SGVVPRFVEFLMREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDD  175

Query  663  VREQAVWALGNVAGDSPTCRDLVL  734
            VREQAVWALGNVAGDSP CRDLVL
Sbjct  176  VREQAVWALGNVAGDSPRCRDLVL  199


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 4/116 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            IPL+ Q       ++   AT         +  PP D+V  A  +P   Q +  ND  ++ 
Sbjct  205  IPLLAQLNERAKLSMLRNATWTLSNFCRGKPQPPFDQVRPA--LPALAQLVHSND-EEVL  261

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAVWALGN-VAGD  707
             +A WAL+ ++ GT++  + VIE G  P+ ++LL  PS  V   A+  +GN V GD
Sbjct  262  TDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLGHPSPSVLIPALRTVGNIVTGD  317



>ref|XP_004228994.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318783.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318786.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318791.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
Length=530

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 170/200 (85%), Gaps = 2/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  RTEVR+  YK+ VDADE RRRREDNLVEIRKSKRE++LLKKRRE LQ+     
Sbjct  1    MSLRPSDRTEVRRNRYKVAVDADEGRRRREDNLVEIRKSKREESLLKKRREGLQAAQQQQ  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
              A+   +  +K+LE +P MV GVWS D  +Q+EATTQFRKLLSIERSPPI+EVI++GVV
Sbjct  61   FPANLQTSTVEKKLESLPSMVAGVWSNDNNMQLEATTQFRKLLSIERSPPIEEVIQSGVV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL+SPSDDVREQ
Sbjct  121  PRFVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQ  180

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGNVAGDSP CRDLVL
Sbjct  181  AVWALGNVAGDSPRCRDLVL  200



>ref|XP_010464259.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 173/199 (87%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS-QHVL  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L+KKRRE +Q+ Q   
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQDFT  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             AS +P A  K+LE +P MV G+WS+DPA+Q+E+TTQFRKLLSIERSPPI+EVI AGVVP
Sbjct  61   PASSAPHAAAKKLESLPDMVAGIWSDDPALQLESTTQFRKLLSIERSPPIEEVIGAGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL++ + P +QFEAAWALTN+ASGTS+HT+VVIEH AVP F+QLL+SPSDDVREQA
Sbjct  121  RFVEFLKKEEYPAIQFEAAWALTNIASGTSDHTKVVIEHDAVPIFVQLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPQCRDLVL  199



>ref|XP_008810191.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810193.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810194.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++L KKRRE +Q+Q    
Sbjct  1    MSLRPSERAEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLQKKRREGMQAQPFPP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             +   +A +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   PALHASALEKKLESLPAMVAGVYSDDSTLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  181  WALGNVAGDSPRCRDLVLA  199



>ref|XP_009373267.1| PREDICTED: importin subunit alpha-1b [Pyrus x bretschneideri]
Length=530

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE +Q+Q  L 
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGIQTQQ-LP  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +S   A  DK+LE +P MV GVW ++  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   SSLHSAGLDKKLEHLPSMVAGVWGDEGTMQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI  GAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSDNTKVVIGQGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP+CRDLVLG
Sbjct  180  WALGNVAGDSPSCRDLVLG  198


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I+   +P  +  L  N    ++ EA W ++N+ +G  E  R V+E   +   + LL + 
Sbjct  322  IIQHQALPCLLNLLTNNYKKSIKKEACWTISNITAGNKEQIRAVVEANIIGPLVNLLQNA  381

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  382  EFDIKKEAAWAISN  395


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 7/133 (5%)
 Frame = +3

Query  321  ASQSPAAPDKRL---ECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
            A  SP+  D  L     +PL+ Q   +   ++   AT         +  PP D+V  A  
Sbjct  186  AGDSPSCRDLVLGNGALLPLLSQLNENAKLSMLRNATWTLSNFCRGKPQPPFDQVKPA--  243

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            +P   + +  ND  ++  +A WAL+ ++ G +E  + VIE G  P+ ++LL  PS  V  
Sbjct  244  LPALARLIHSND-EEVLTDACWALSYLSDGKNEKIQAVIESGVCPRLVELLMHPSPSVLI  302

Query  672  QAVWALGN-VAGD  707
             A+  +GN V GD
Sbjct  303  PALRTVGNIVTGD  315



>ref|XP_004144766.1| PREDICTED: importin subunit alpha-2 [Cucumis sativus]
 gb|KGN60977.1| hypothetical protein Csa_2G033320 [Cucumis sativus]
Length=529

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 170/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDADE RRRREDN+VEIRK++RE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNERAEVRRNRYKVAVDADEGRRRREDNMVEIRKNRREESLQKKRREGLQAQQ-LQ  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S   +  +K+LE +P MV G+WS+D ++Q+E+TTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  60   TSTHSSVVEKKLEYLPSMVAGIWSDDGSLQLESTTQFRKLLSIERSPPIEEVIQAGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDS  CRDLVLG
Sbjct  180  WALGNVAGDSSRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L  +  P + 
Sbjct  244  LPALARLIHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLVELL-MHPAPSVL  301

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPS-DDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+V+I+H A+P  + LL++     ++++A W + N+ AG+
Sbjct  302  IPALRTVGNIVTGDDLQTQVIIQHNALPCLLNLLTNNHKKSIKKEACWTISNITAGN  358



>gb|AAK38727.1|AF369707_1 importin alpha 2 [Capsicum annuum]
Length=529

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV-L  317
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQQQF  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             ++   +  +K+L  +P MV GVWS D  +Q+EA TQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   PSNLQTSTVEKKLASLPSMVAGVWSTDNNLQLEANTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+TRVVI+HGAVP F++LL SPSDDVREQA
Sbjct  121  RFVEFLLREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLGSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  181  VWALGNVAGDSPRCRDLVL  199


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = +3

Query  441  LSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGA  620
            LS   +  I  VI+AGV PR V+ L     P +   A   + N+ +G    T+ +IEHGA
Sbjct  271  LSDGTNDKIQAVIEAGVCPRLVELLVHPS-PSVLIPALRTVGNIVTGDDLQTQCIIEHGA  329

Query  621  VPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
            +P  + LL+ +    ++++A W + N+ AG+
Sbjct  330  LPCLLSLLTHNHKKSIKKEACWTISNITAGN  360



>ref|XP_010558435.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=526

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++L+KKRRE +Q+     
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREESLMKKRREGMQALQGFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + + AA +K+LE +P +V GVWS+D   Q+E+TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   PA-AAAAIEKKLESLPALVSGVWSDDRTSQLESTTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL++ D PQLQFEAAWALTN+ASGTSEHT+VVI+H AVP F+QLL+SPSDDVREQAV
Sbjct  120  FVEFLKKEDFPQLQFEAAWALTNIASGTSEHTKVVIDHEAVPIFVQLLASPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPQCRDLVL  197



>ref|XP_008245768.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=530

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ    L 
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQPPQ-LS  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            ++   +  +K+LE +P MV GVWSE+ ++Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   SNLHSSGLEKKLEHLPSMVAGVWSEESSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +3

Query  459  PPIDEVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQ  638
            PP D+V  A  +P   + +  ND  ++  +A WAL+ ++ GT++  + VIE G  P+ ++
Sbjct  235  PPFDQVKPA--LPALARLIHSND-EEVLTDACWALSYLSDGTNDKIQAVIESGVCPRLVE  291

Query  639  LLSSPSDDVREQAVWALGN-VAGD  707
            LL  PS  V   A+  +GN V GD
Sbjct  292  LLLHPSPSVLIPALRTVGNIVTGD  315



>ref|XP_010024115.1| PREDICTED: importin subunit alpha-1a [Eucalyptus grandis]
 gb|KCW60545.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
 gb|KCW60546.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
Length=531

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQAQQQTA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             S   +A +K+LE +P M+ GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   PSLHSSAVEKKLEHLPSMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VV++HGAVP F++LL+SPSDDVREQAV
Sbjct  121  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVVDHGAVPIFVKLLASPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  181  WALGNVAGDSPKCRDLVLA  199



>ref|XP_010670910.1| PREDICTED: importin subunit alpha-1 [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE LQ Q    
Sbjct  1    MSLRPNARTEVRRNRYKVTVDADEGRRRREDNMVEIRKSKREESLLKKRREGLQVQQPFA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
                 +  +K+LE +P MV GV S++  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   PPLHTSTVEKKLESLPNMVAGVCSDNNQMQLEATTQFRKLLSIERSPPIEEVIEAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL+R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDDVREQAV
Sbjct  121  FVEFLQREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198



>gb|AIU34461.1| putative importin subunit alpha-2, partial [Taraxacum brevicorniculatum]
Length=531

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 170/200 (85%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV-L  317
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRK+KRE+NLLKKR+ V  SQ +  
Sbjct  1    MSLRPSARTEVRRNRYKVAVDADEGRRRREDNMVEIRKNKREENLLKKRQVVPSSQPLST  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
             A    A  +K+LE +P MV GV+S D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVP
Sbjct  61   GAPIQTATTEKKLESLPSMVAGVYSNDNNMQLEATTQFRKLLSIERSPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDDVREQA
Sbjct  121  RFVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLASPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVLG  737
            VWALGN+AGDSP CRDLVLG
Sbjct  181  VWALGNIAGDSPKCRDLVLG  200



>emb|CDO98800.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRRED +VEIRKSKRE+NLLKKRRE LQ      
Sbjct  1    MSLRPTERTEVRRNRYKVAVDAEEGRRRREDQMVEIRKSKREENLLKKRREGLQMSQPFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            A       +K+LE +PLMV GV+S D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   APVPSNNIEKKLESLPLMVNGVYSNDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D  QLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLMREDFHQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  181  WALGNVAGDSPRCRDLVLG  199


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE   +   + LL + 
Sbjct  323  IIDHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAQLIGPLVNLLQTA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAISN  396


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 60/117 (51%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V S D  V  +A       LS   +  I  VI+AGV PR V+ L     P + 
Sbjct  245  LPALQRLVHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLVELLVHPS-PSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
              A   + N+ +G    T+ +I+HGA+P  + LL+ +    ++++A W + N+ AG+
Sbjct  303  IPALRTVGNIVTGDDYQTQCIIDHGALPCLLSLLTHNHKKSIKKEACWTISNITAGN  359



>ref|XP_009136744.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
 emb|CDX90544.1| BnaA03g42370D [Brassica napus]
Length=540

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 174/209 (83%), Gaps = 10/209 (5%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE LQ   +  
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKTKREESLLKKRREGLQPTQLPQ  60

Query  315  --------LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPID  470
                      A+ + ++ +KRLE +P MV GVWSED ++Q+EATTQFRKLLSIERSPPI+
Sbjct  61   FDPSSLASAAAAGASSSVEKRLESLPSMVGGVWSEDRSLQLEATTQFRKLLSIERSPPIE  120

Query  471  EVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSS  650
            EVI+AGVVPRFV+FL+R D PQLQFEAAWALTN+ASGTS+HT+VVIEHGAVP F+ LL+S
Sbjct  121  EVIEAGVVPRFVEFLKREDYPQLQFEAAWALTNIASGTSDHTKVVIEHGAVPIFVLLLAS  180

Query  651  PSDDVREQAVWALGNVAGDSPTCRDLVLG  737
             SDDVREQAVWALGNVAGDSP CRDLVLG
Sbjct  181  QSDDVREQAVWALGNVAGDSPRCRDLVLG  209



>ref|XP_010434881.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010440203.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010449846.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  +TEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++L KKRRE LQ+  +  
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ  60

Query  315  LDASQSPAAP--DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
               S  PA+   +K+LE +P MV GV SED  +Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVPASSTVEKKLESLPSMVGGVLSEDRGLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203



>ref|NP_001234006.1| importin subunit alpha [Solanum lycopersicum]
 sp|O22478.2|IMA_SOLLC RecName: Full=Importin subunit alpha; AltName: Full=Karyopherin 
subunit alpha; Short=KAP alpha [Solanum lycopersicum]
 gb|AAC23722.1| importin alpha [Solanum lycopersicum]
Length=527

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +RTE R+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE L       
Sbjct  1    MSLRPNSRTEARRSRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLQAQQFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            ++ + +  DK+LE +P ++ GVWS+D ++Q+E TTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  61   STAAVSHLDKKLETLPELIAGVWSDDSSLQLECTTQFRKLLSIERNPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R+D PQLQFEAAWALTN+ASGTSE+T+VVI++G+VP FI+LLSSPSDDVREQAV
Sbjct  121  FVEFLARDDYPQLQFEAAWALTNIASGTSENTKVVIDYGSVPIFIRLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGN+AGDSP  RDLVLG
Sbjct  181  WALGNIAGDSPKYRDLVLG  199



>ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412112.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412113.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE +Q+  +  
Sbjct  1    MSLRPSERAEVRRNKYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGMQALSLPQ  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             +   +  +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   TTTHASTIEKKLESLPAMVAGVYSDDSTLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL+R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLKREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPRCRDLVL  198



>ref|XP_006472169.1| PREDICTED: importin subunit alpha-1b-like [Citrus sinensis]
 gb|KDO81727.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
 gb|KDO81728.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
 gb|KDO81729.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
 gb|KDO81730.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
Length=530

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP ++ + R+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNSKADSRRNKYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLQNQQPLA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
               +     K+LE +P+MV GVWS D  VQ E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   NDVNAPGTAKKLENLPVMVAGVWSNDSGVQYECTTQFRKLLSIERSPPIEEVIRSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLLREDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLYSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  181  WALGNIAGDSPRCRDLVL  198



>ref|XP_008673870.1| PREDICTED: importin subunit alpha-1a [Zea mays]
 tpg|DAA53967.1| TPA: importin alpha-1b subunit [Zea mays]
Length=526

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRKS+RE++LLK+RRE LQ+Q    
Sbjct  1    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKRRREGLQAQ----  56

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
                P+  +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIERSPPI+EVIK+GVVPR
Sbjct  57   VPAPPSGVEKKLESLPAMVSGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIKSGVVPR  116

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FVQ L R DLPQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S SDDVREQAV
Sbjct  117  FVQLLTREDLPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSGSDDVREQAV  176

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  177  WALGNVAGDSPKCRDLVLA  195


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I    +PR +  L +N    ++ EA W ++N+ +G  +  + VI  G +   +QLL   
Sbjct  319  IIDHQALPRLLNLLTQNHKKSIKKEACWTISNITAGNKDQIQAVISAGIIAPLLQLLQGA  378

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  379  EFDIKKEAAWAISN  392


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 62/117 (53%), Gaps = 4/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L  +  P + 
Sbjct  241  LPALARLIHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLVELL-LHPSPSVL  298

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
              A   + N+ +G  + T+ +I+H A+P+ + LL+ +    ++++A W + N+ AG+
Sbjct  299  IPALRTVGNIVTGDDQQTQCIIDHQALPRLLNLLTQNHKKSIKKEACWTISNITAGN  355



>gb|KCW85238.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
Length=324

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 167/197 (85%), Gaps = 1/197 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDADE RRRREDN+VEIRKS+RE++LLKKRRE LQ+     
Sbjct  1    MSLRPNARTEVRRNRYKVAVDADEGRRRREDNMVEIRKSRREESLLKKRREGLQAPQASP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +  S A  +K+LE +P MV  V S D ++Q++ATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   SLHSSAV-EKKLENLPSMVAAVLSNDKSLQVDATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL + D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  120  FVEFLMKEDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLRSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLV  731
            WALGNVAGDSP CRDLV
Sbjct  180  WALGNVAGDSPKCRDLV  196



>gb|KHN14650.1| Importin subunit alpha-1 [Glycine soja]
Length=533

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 171/201 (85%), Gaps = 3/201 (1%)
 Frame = +3

Query  141  MSLRP--GTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV  314
            MS RP   +RTEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q  
Sbjct  1    MSYRPSGNSRTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQQ  60

Query  315  LDAS-QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGV  491
                 Q+ +  +K+LE +P MV GVWS+D + Q+EATTQFRKLLSIERSPPI+EVI+AGV
Sbjct  61   FPTPLQASSIVEKKLESLPAMVAGVWSDDNSQQLEATTQFRKLLSIERSPPIEEVIQAGV  120

Query  492  VPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVRE  671
            VPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVRE
Sbjct  121  VPRFVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVRE  180

Query  672  QAVWALGNVAGDSPTCRDLVL  734
            QAVWALGNVAGDSP CRDLVL
Sbjct  181  QAVWALGNVAGDSPRCRDLVL  201


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + VIE G +   + LL + 
Sbjct  326  IINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVIEAGLIAPLVNLLQNA  385

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  386  EFDIKKEAAWAISN  399



>gb|KDO81726.1| hypothetical protein CISIN_1g009184mg [Citrus sinensis]
Length=541

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP ++ + R+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE LQ+Q  L 
Sbjct  1    MSLRPNSKADSRRNKYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLQNQQPLA  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
               +     K+LE +P+MV GVWS D  VQ E TTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  61   NDVNAPGTAKKLENLPVMVAGVWSNDSGVQYECTTQFRKLLSIERSPPIEEVIRSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LL SPSDDVREQAV
Sbjct  121  FVEFLLREDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLYSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGN+AGDSP CRDLVL
Sbjct  181  WALGNIAGDSPRCRDLVL  198



>gb|ABM05487.1| Impa1 [Nicotiana benthamiana]
Length=532

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 173/200 (87%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTE R+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE +LQ+Q   
Sbjct  1    MSLRPNSRTEARRSRYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLLQAQQFS  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
              + + +  DK+LE +P M+ GVWS+D ++Q+E TTQFRKLLSIER+PPI+EVI++GVVP
Sbjct  61   STAAAVSQLDKKLENLPDMISGVWSDDSSMQLECTTQFRKLLSIERNPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI++G+VP F++LLSSPSDDVREQA
Sbjct  121  RFVEFLAREDYPQLQFEAAWALTNIASGTSENTKVVIDYGSVPIFVRLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVLG  737
            VWALGN+AGDSP  RDLVLG
Sbjct  181  VWALGNIAGDSPKYRDLVLG  200


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 60/119 (50%), Gaps = 3/119 (3%)
 Frame = +3

Query  357  ECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQ  536
            E +P + + + S D  V  +A       LS   +  I  VI+AGV PR ++ L  +  P 
Sbjct  244  EALPTLARLIHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLIELLLHSS-PS  301

Query  537  LQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNVAGDS  710
            +   A   + N+ +G    T+V+I+H A+P  + LL+ +    ++++A W + N+   S
Sbjct  302  VLIPALRTVGNIVTGDDIQTQVIIDHHALPCLLNLLTQNYKKSIKKEACWTISNITAGS  360



>ref|XP_009789105.1| PREDICTED: importin subunit alpha [Nicotiana sylvestris]
Length=532

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 173/200 (87%), Gaps = 1/200 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE-VLQSQHVL  317
            MSLRP +RTE R+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE +LQ+Q   
Sbjct  1    MSLRPNSRTEARRSRYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLLQAQQFS  60

Query  318  DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
              + + +  DK+LE +P M+ GVWS+D ++Q+E TTQFRKLLSIER+PPI+EVI++GVVP
Sbjct  61   STAAAVSQLDKKLENLPDMISGVWSDDSSMQLECTTQFRKLLSIERNPPIEEVIQSGVVP  120

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI++G+VP F++LLSSPSDDVREQA
Sbjct  121  RFVEFLAREDYPQLQFEAAWALTNIASGTSENTKVVIDYGSVPIFVRLLSSPSDDVREQA  180

Query  678  VWALGNVAGDSPTCRDLVLG  737
            VWALGN+AGDSP  RDLVLG
Sbjct  181  VWALGNIAGDSPKYRDLVLG  200


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 3/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L  +  P + 
Sbjct  246  LPTLARLIHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLVELLLHSS-PSVL  303

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNVAGDS  710
              A   + N+ +G    T+V+I+H A+P  + LL+ +    ++++A W + N+   S
Sbjct  304  IPALRTVGNIVTGDDIQTQVIIDHHALPCLLNLLTQNYKKSIKKEACWTISNITAGS  360



>ref|XP_007205032.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
 gb|EMJ06231.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
Length=530

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE LQ    L 
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQPPQ-LS  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            ++   +  +K+LE +P MV GVWS++ ++Q+EATTQFRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   SNLHSSGLEKKLEHLPSMVAGVWSDESSLQLEATTQFRKLLSIERSPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLMREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPRCRDLVLG  198


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (5%)
 Frame = +3

Query  459  PPIDEVIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQ  638
            PP D+V  A  +P   + +  ND  ++  +A WAL+ ++ GT++  + VIE G  P+ ++
Sbjct  235  PPFDQVKPA--LPALARLIHSND-EEVLTDACWALSYLSDGTNDKIQAVIESGVCPRLVE  291

Query  639  LLSSPSDDVREQAVWALGN-VAGD  707
            LL  PS  V   A+  +GN V GD
Sbjct  292  LLLHPSPSVLIPALRTVGNIVTGD  315



>ref|XP_007206524.1| hypothetical protein PRUPE_ppa019448mg [Prunus persica]
 gb|EMJ07723.1| hypothetical protein PRUPE_ppa019448mg [Prunus persica]
Length=192

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVL--QSQHV  314
            MSLRP T T VRKKSYK GVDAD+ARRR EDNLVEIRK+KRE+NLLKKR + L    Q +
Sbjct  1    MSLRPSTSTVVRKKSYKTGVDADQARRRSEDNLVEIRKNKREENLLKKRSQGLPPSQQQL  60

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
            LD +Q+      RLE IP MVQGVWS+DPA+Q+E TTQFRKLLSIERSPPIDEVIKAG V
Sbjct  61   LDGTQTTVVFQNRLESIPSMVQGVWSDDPALQLETTTQFRKLLSIERSPPIDEVIKAGAV  120

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R+D+PQLQFEAAWALTNVASGTS+HTRV IEHGAVP F+QLLSS SDDVREQ
Sbjct  121  PRFVEFLGRHDMPQLQFEAAWALTNVASGTSDHTRVAIEHGAVPMFVQLLSSGSDDVREQ  180

Query  675  AV  680
             V
Sbjct  181  VV  182



>gb|KHG28859.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=534

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLSQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSAAGSEKKLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            V+PRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VIPRFVEFLARDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>ref|XP_006355841.1| PREDICTED: importin subunit alpha-like [Solanum tuberosum]
Length=527

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +RTE R+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE L       
Sbjct  1    MSLRPNSRTEARRSRYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLLQAQQFP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            ++ + +  DK+LE +P ++ GVWS+D ++Q+E TTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  61   STAAVSHLDKKLETLPELIAGVWSDDSSLQLECTTQFRKLLSIERNPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R+D PQLQFEAAWALTN+ASGTSE+T+VVI++GAVP FI+LLSSPSDDVREQAV
Sbjct  121  FVEFLARDDYPQLQFEAAWALTNIASGTSENTKVVIDYGAVPIFIRLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGN+AGDSP  RDLVLG
Sbjct  181  WALGNIAGDSPKYRDLVLG  199



>ref|XP_011042196.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
 ref|XP_011042198.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
 ref|XP_011042199.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
 ref|XP_011042200.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
 ref|XP_011042201.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
 ref|XP_011042202.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
Length=538

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 168/205 (82%), Gaps = 6/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQH---  311
            MSLRP  R EVR+  YK+ VDADE RRRREDN+VEIRKSKRE++LLKKRRE L +Q    
Sbjct  1    MSLRPNARVEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLLKKRREGLHAQQRQQ  60

Query  312  ---VLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
               V  +    +A DK L+ +P M+ GVWSED   Q+E TT FRKLLSIER PPI+EVI+
Sbjct  61   QQQVTSSLNISSASDKPLDTLPGMIAGVWSEDKHSQLEGTTHFRKLLSIERCPPINEVIQ  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRFV+FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGA+P F++LLSSP+DD
Sbjct  121  SGVVPRFVEFLARDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAIPIFVKLLSSPADD  180

Query  663  VREQAVWALGNVAGDSPTCRDLVLG  737
            VREQAVWALGNVAGDSP CRDLVLG
Sbjct  181  VREQAVWALGNVAGDSPKCRDLVLG  205



>ref|XP_006414387.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
 gb|ESQ55840.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
Length=534

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 169/202 (84%), Gaps = 4/202 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQS----Q  308
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRK+KRE++L KKRRE LQ+    Q
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREESLQKKRREGLQATQQPQ  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                +    ++ +K+LE +P MV GVWSED  +Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVTGASSVEKKLESLPSMVGGVWSEDRNLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F++LL+S SDDVR
Sbjct  121  VVPRFVEFLMREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVKLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVL  734
            EQAVWALGNVAGDSP CRDLVL
Sbjct  181  EQAVWALGNVAGDSPRCRDLVL  202



>ref|XP_006285325.1| hypothetical protein CARUB_v10006712mg [Capsella rubella]
 gb|EOA18223.1| hypothetical protein CARUB_v10006712mg [Capsella rubella]
Length=533

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  +TEVR+  YK+ VDADE RRRREDN+VEIRKSKRE++L KKRRE LQ+  +  
Sbjct  1    MSLRPNAKTEVRRNRYKVAVDADEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ  60

Query  315  LDASQSPAAP--DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
               S  PA+   +K+LE +P M+ GV S+D ++Q+EATTQFRKLLSIERSPPI+EVI AG
Sbjct  61   FAPSSVPASSTVEKKLESLPSMIAGVLSDDRSLQLEATTQFRKLLSIERSPPIEEVIDAG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            VVPRFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVIEHGAVP F+QLL+S SDDVR
Sbjct  121  VVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPRCRDLVLG  203



>gb|KHG26190.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=530

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 171/200 (86%), Gaps = 3/200 (2%)
 Frame = +3

Query  141  MSLRPGTRTEV--RKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV  314
            MSLRP TRTE   R+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRRE LQ+Q  
Sbjct  1    MSLRPSTRTEAEARRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREGLQAQQ-  59

Query  315  LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVV  494
              AS   +  +K+LE +P MV GVWS++ A Q+EATTQFRKLLSIERSPPI+EVI++GVV
Sbjct  60   FAASLHSSNVEKKLESLPSMVAGVWSDNGAAQLEATTQFRKLLSIERSPPIEEVIQSGVV  119

Query  495  PRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQ  674
            PRFV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+ GAVP F++LL+SPSDDVREQ
Sbjct  120  PRFVEFLGREDFPQLQFEAAWALTNIASGTSDNTKVVIDLGAVPIFVKLLASPSDDVREQ  179

Query  675  AVWALGNVAGDSPTCRDLVL  734
            AVWALGN+AGDSP CRDLVL
Sbjct  180  AVWALGNIAGDSPRCRDLVL  199


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +   +  L  N    ++ EA W ++N+ +G  E  + VI  G +   + LL + 
Sbjct  324  IIDHGALACLMNLLTNNYKKSIKKEACWTISNITAGNKEQIQAVINAGLIGPLVNLLQNA  383

Query  654  SDDVREQAVWALGN  695
              DV+++A WA+ N
Sbjct  384  EFDVKKEAAWAISN  397



>ref|XP_002320318.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
 gb|EEE98633.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
Length=538

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 172/205 (84%), Gaps = 6/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHV--  314
            MSLRP  R EVR+  YK+ VDADE RRRREDNLVEIRK+KRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARVEVRRNKYKVAVDADEGRRRREDNLVEIRKNKREESLLKKRREGLQAQQQQQ  60

Query  315  ----LDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                + +S + +A DK L+ +P M+ GVWS+D  +Q E TT FRKLLSIERSPPI+EVI+
Sbjct  61   QQQQVTSSLNISASDKPLDTLPAMIAGVWSDDKNIQFEGTTHFRKLLSIERSPPINEVIQ  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRF++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGA+P F++LLSSP++D
Sbjct  121  SGVVPRFIEFLARDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAIPIFVKLLSSPAED  180

Query  663  VREQAVWALGNVAGDSPTCRDLVLG  737
            VREQAVWALGNVAGDSP CRDLVLG
Sbjct  181  VREQAVWALGNVAGDSPKCRDLVLG  205


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 62/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L R+  P + 
Sbjct  251  LPALERLIHSNDNEVLTDACWAL-SYLSDGSNEKIQAVIEAGVCPRLVELL-RHQSPTVL  308

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP-SDDVREQAVWALGNV-AGDS  710
              A  A+ N+ +G    T+ +I H A+P  + LL++     ++++A W + NV AG++
Sbjct  309  IPALRAVGNIVTGDDMQTQCMINHQALPCLLNLLTNNYKKSIKKEACWTISNVTAGNA  366



>gb|KHG28860.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=557

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLSQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSAAGSEKKLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            V+PRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VIPRFVEFLARDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>gb|AHJ25927.1| importin subunit alpha-1 [Senecio scandens]
Length=529

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RT+VR+  YK+ VDA+E RRRREDN+VEIRK++RE+NLLKKRRE LQ+Q    
Sbjct  1    MSLRPSARTDVRRSRYKVAVDAEEGRRRREDNMVEIRKTRREENLLKKRREGLQAQQFQP  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
                P   DK+LE +P +V G+WS D A+++EATTQ RKLLSIER+PPIDEVI++GVVPR
Sbjct  61   TVDVPQL-DKKLESLPAIVAGIWSNDRALRLEATTQARKLLSIERNPPIDEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTS++T+VVI+HGAVP F++LLS PSDDVREQAV
Sbjct  120  FVEFLAREDYPQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVKLLSFPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  180  WALGNVAGDSPKCRDLVL  197



>ref|XP_010548966.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=524

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDN+VEIRKSKRE++LLKKRREVLQ+     
Sbjct  1    MSLRPNARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLLKKRREVLQAAA---  57

Query  321  ASQSPA-APDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
              Q P  A +K+LE +  MV GV S+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVP
Sbjct  58   QQQFPLPAVEKKLESLTSMVSGVCSDDRNLQLEATTQFRKLLSIERSPPIEEVIQAGVVP  117

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL+SPSDDVREQA
Sbjct  118  RFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVRLLASPSDDVREQA  177

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  178  VWALGNVAGDSPRCRDLVL  196


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (53%), Gaps = 8/117 (7%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + V S D  V  +A       LS   +  I  VI+AGVVPR V+ L    LP L+
Sbjct  243  LPALERLVHSTDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVVPRLVELLLFWILPALR  301

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNV-AGD  707
                 ++ N+ +G    T+ VI HGA+P  + LLS +    ++++A W + N+ AG+
Sbjct  302  -----SVGNIVTGDDMQTQCVINHGALPCLLSLLSHNHKKSIKKEACWTISNITAGN  353


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            VI  G +P  +  L  N    ++ EA W ++N+ +G     + VIE G +   + LL + 
Sbjct  317  VINHGALPCLLSLLSHNHKKSIKKEACWTISNITAGNRNQIQAVIEAGLIGPLVNLLQNS  376

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  377  EFDIKKEAAWAISN  390



>gb|KHN12909.1| Importin subunit alpha-1 [Glycine soja]
Length=526

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 167/199 (84%), Gaps = 6/199 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK     DE RRRREDN+VEIRKSKRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPNARTEVRRNRYK-----DEGRRRREDNMVEIRKSKREESLQKKRREGLQAQQQFP  55

Query  321  AS-QSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVP  497
               Q+ +  +K+LE +P MV GVWS+D + Q+EATTQFRKLLSIERSPPI+EVI+AGVVP
Sbjct  56   TPLQAASIVEKKLESLPAMVAGVWSDDNSQQLEATTQFRKLLSIERSPPIEEVIQAGVVP  115

Query  498  RFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQA  677
            RFV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LLSSPSDDVREQA
Sbjct  116  RFVEFLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLSSPSDDVREQA  175

Query  678  VWALGNVAGDSPTCRDLVL  734
            VWALGNVAGDSP CRDLVL
Sbjct  176  VWALGNVAGDSPKCRDLVL  194


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + V+E G +   + LL + 
Sbjct  319  IINHGALPCLLSLLTHNHKKSIKKEACWTISNITAGNRDQIQAVVEAGLIAPLVNLLQNA  378

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  379  EFDIKKEAAWAISN  392



>gb|KJB24393.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=535

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLSQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSAAGSEKTLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            V+PRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VIPRFVEFLARDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>gb|KJB24392.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=534

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 4/203 (2%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRRE----VLQSQ  308
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK+KRE+NLLKKRRE      Q  
Sbjct  1    MSLRPNARAEVRRNRYKVAVDAEEGRRRREDNMVEIRKNKREENLLKKRREGLLSQQQQP  60

Query  309  HVLDASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAG  488
                   S A  +K LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EV+++G
Sbjct  61   QQQQLLSSAAGSEKTLESLPAMVAGVWSDDRNMQLEATTQFRKLLSIERSPPINEVVQSG  120

Query  489  VVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVR  668
            V+PRFV+FL R+D PQLQFEAAWALTN+ASGTS++TRVVI+HGAVP F++LL SP+DDVR
Sbjct  121  VIPRFVEFLARDDFPQLQFEAAWALTNIASGTSDNTRVVIDHGAVPIFVKLLGSPTDDVR  180

Query  669  EQAVWALGNVAGDSPTCRDLVLG  737
            EQAVWALGNVAGDSP CRDLVLG
Sbjct  181  EQAVWALGNVAGDSPKCRDLVLG  203



>ref|XP_011041680.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
Length=538

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 171/205 (83%), Gaps = 6/205 (3%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVL-  317
            MSLRP  R EVR+  YK+ VDADE RRRREDNLVEIRK+KRE++LLKKRRE LQ+Q    
Sbjct  1    MSLRPNARVEVRRNKYKVAVDADEGRRRREDNLVEIRKNKREESLLKKRREGLQAQQQQQ  60

Query  318  -----DASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIK  482
                  +S + +A DK L+ +P M+ GVWS+D  +Q E TT FRKLLSIERSPPI+EVI+
Sbjct  61   QQQQATSSLNISASDKPLDTLPAMIAGVWSDDKNIQFEGTTHFRKLLSIERSPPINEVIQ  120

Query  483  AGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDD  662
            +GVVPRF++FL R+D PQLQFEAAWALTN+ASGTSE+TRVVI+HGA+P F++LLSSP++D
Sbjct  121  SGVVPRFIEFLARDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAIPIFVKLLSSPAED  180

Query  663  VREQAVWALGNVAGDSPTCRDLVLG  737
            VREQAVWALGNVAGDSP CRDLVLG
Sbjct  181  VREQAVWALGNVAGDSPKCRDLVLG  205


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 64/124 (52%), Gaps = 4/124 (3%)
 Frame = +3

Query  345  DKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERN  524
            D+    +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L R+
Sbjct  245  DQTKPALPALERLIHSNDNEVLTDACWAL-SYLSDGSNEKIQAVIEAGVCPRLVELL-RH  302

Query  525  DLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP-SDDVREQAVWALGNV-  698
              P +   A  A+ N+ +G    T+ +I H A+P  + LL++     ++++A W + NV 
Sbjct  303  PSPTVLIPALRAVGNIVTGDDMQTQCMINHQALPCLLNLLTNNYKKSIKKEACWTISNVT  362

Query  699  AGDS  710
            AG++
Sbjct  363  AGNA  366



>ref|XP_002274422.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CAN75951.1| hypothetical protein VITISV_028605 [Vitis vinifera]
 emb|CBI36918.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 168/199 (84%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  RTEVR+  YK+ VDA+E RRRREDNLVEIRK+KRE++L KKRRE LQ+Q    
Sbjct  1    MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNLVEIRKNKREESLQKKRREGLQAQQ-FT  59

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
               S +  +++LE +P MV GVWSED  +Q+EATT FRKLLSIERSPPI+EVI++GVVPR
Sbjct  60   TPVSASTFERKLESLPAMVAGVWSEDSNLQLEATTYFRKLLSIERSPPINEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
             V+FL R+D PQLQFEAAWALTN+ASGTSE+T+VVI+HGAVP F++LL S +DDVREQAV
Sbjct  120  LVEFLGRDDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSQNDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVLG
Sbjct  180  WALGNVAGDSPKCRDLVLG  198


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  +  + VIE G +P  I LL + 
Sbjct  322  IINYGALPCLLNLLSHNYKKSIKKEACWTISNITAGNKDQIQSVIEAGIIPPLIYLLQNA  381

Query  654  SDDVREQAVWALGN  695
              +++++A WA+ N
Sbjct  382  EFEIKKEAAWAISN  395



>ref|XP_009401503.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=528

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP  R EVR+  YK+ VDA+E RRRREDN+VEIRK++RE++L KKRRE +Q+Q    
Sbjct  1    MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGMQAQPFPQ  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
               + A  +K+LE +P MV GV+S+D  +Q+EATTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  61   PIHASAV-EKKLESLPAMVSGVYSDDRTLQLEATTQFRKLLSIERNPPIEEVIQSGVVPR  119

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSEHT+VVI+HGAVP F++LLSSPSDDVREQAV
Sbjct  120  FVEFLTREDYPQLQFEAAWALTNIASGTSEHTKVVIDHGAVPIFVKLLSSPSDDVREQAV  179

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGNVAGDSP CRDLVL 
Sbjct  180  WALGNVAGDSPRCRDLVLA  198



>ref|XP_011013186.1| PREDICTED: importin subunit alpha-1-like [Populus euphratica]
Length=529

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP TRT+VR+  YK+ VDADE RRRREDN+VEIRK+KRE++L KKRRE L +Q    
Sbjct  1    MSLRPSTRTDVRRNRYKVAVDADEGRRRREDNMVEIRKNKREESLQKKRREGLLAQQFPS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
            +  S ++ +K+LE +P MV GVWS+D  +Q+EATTQFRKLLSIERSPPI+EVI+AGVVPR
Sbjct  61   SVLSSSSMEKKLESLPSMVSGVWSDDSNLQLEATTQFRKLLSIERSPPIEEVIQAGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+ L R D PQLQFEAAWALTN+ASGTSE+T+VVI+H AVP F++LL SPSDDVREQAV
Sbjct  121  FVELLVREDFPQLQFEAAWALTNIASGTSENTKVVIDHDAVPIFVKLLGSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVL  734
            WALGNVAGDSP CRDLVL
Sbjct  181  WALGNVAGDSPKCRDLVL  198


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +3

Query  474  VIKAGVVPRFVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSP  653
            +I  G +P  +  L  N    ++ EA W ++N+ +G  E  + VIE G +   + LL + 
Sbjct  323  IINTGALPCLLSLLTHNHKKSIKKEACWTISNITAGNKEQIQAVIEAGLIGPLVNLLQNA  382

Query  654  SDDVREQAVWALGN  695
              D++++A WA+ N
Sbjct  383  EFDIKKEAAWAVSN  396



>ref|XP_009606138.1| PREDICTED: importin subunit alpha [Nicotiana tomentosiformis]
Length=530

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  141  MSLRPGTRTEVRKKSYKIGVdadearrrredNLVEIRKSKREDNLLKKRREVLQSQHVLD  320
            MSLRP +RTE R+  YK+ VDA+E RRRREDN+VEIRK+KRE++LLKKRRE L       
Sbjct  1    MSLRPNSRTEARRSRYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLLQAQFSS  60

Query  321  ASQSPAAPDKRLECIPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPR  500
             + + +  DK+LE +P M+ GVWS+D ++Q+E TTQFRKLLSIER+PPI+EVI++GVVPR
Sbjct  61   TAAAVSQLDKKLENLPDMISGVWSDDSSMQLECTTQFRKLLSIERNPPIEEVIQSGVVPR  120

Query  501  FVQFLERNDLPQLQFEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLSSPSDDVREQAV  680
            FV+FL R D PQLQFEAAWALTN+ASGTSE+T+VVI++G+VP F++LLSSPSDDVREQAV
Sbjct  121  FVEFLAREDYPQLQFEAAWALTNIASGTSENTKVVIDYGSVPIFVRLLSSPSDDVREQAV  180

Query  681  WALGNVAGDSPTCRDLVLG  737
            WALGN+AGDSP  RDLVLG
Sbjct  181  WALGNIAGDSPKYRDLVLG  199


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 3/117 (3%)
 Frame = +3

Query  363  IPLMVQGVWSEDPAVQIEATTQFRKLLSIERSPPIDEVIKAGVVPRFVQFLERNDLPQLQ  542
            +P + + + S D  V  +A       LS   +  I  VI+AGV PR V+ L  +  P + 
Sbjct  245  LPTLARLIHSNDEEVLTDACWAL-SYLSDGTNDKIQAVIEAGVCPRLVELLLHSS-PSVL  302

Query  543  FEAAWALTNVASGTSEHTRVVIEHGAVPKFIQLLS-SPSDDVREQAVWALGNVAGDS  710
              A   + N+ +G    T+V+I+H A+P  + LL+ +    ++++A W + N+   S
Sbjct  303  IPALRTVGNIVTGDDIQTQVIIDHHALPCLLNLLTQNYKKSIKKEACWTISNITAGS  359



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1510973279075