BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4821

Length=1250
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACL00957.1|  sucrose synthase                                        415   2e-134   Ipomoea batatas [batate]
dbj|BAP82380.1|  sucrose synthase                                       372   3e-124   Phelipanche aegyptiaca
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        380   2e-120   Sesamum indicum [beniseed]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        379   8e-120   Nicotiana tomentosiformis
gb|ABV02029.1|  sucrose sythase                                         379   1e-119   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           378   2e-119   
ref|NP_001274911.1|  sucrose synthase 2                                 378   2e-119   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    378   2e-119   Solanum tuberosum [potatoes]
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        378   3e-119   Nicotiana sylvestris
gb|AEN79500.1|  sucrose synthase 1                                      377   6e-119   Phelipanche ramosa
ref|NP_001275286.1|  sucrose synthase                                   377   6e-119   Solanum tuberosum [potatoes]
ref|XP_009625446.1|  PREDICTED: sucrose synthase                        377   6e-119   Nicotiana tomentosiformis
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    377   6e-119   Solanum tuberosum [potatoes]
gb|AAA97571.1|  sucrose synthase                                        377   6e-119   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            377   7e-119   Solanum tuberosum [potatoes]
gb|AHL84158.1|  sucrose synthase                                        377   7e-119   Nicotiana tabacum [American tobacco]
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        375   5e-118   Nicotiana sylvestris
emb|CAI56307.1|  sucrose synthase                                       373   2e-117   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       373   2e-117   Coffea arabica [arabica coffee]
gb|ABI17891.1|  sucrose synthase                                        373   2e-117   Coffea canephora [robusta coffee]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             373   2e-117   
ref|NP_001234804.1|  sucrose synthase                                   373   2e-117   
ref|NP_001234655.1|  sucrose synthase                                   372   5e-117   
emb|CAA09681.1|  sucrose synthase                                       372   6e-117   Solanum lycopersicum
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        365   1e-114   
gb|AFO84090.1|  sucrose synthase                                        354   3e-110   Actinidia chinensis
gb|ABD61653.1|  sucrose synthase                                        353   1e-109   Cichorium intybus [radicchio]
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                345   5e-106   Erythranthe guttata [common monkey flower]
gb|AHL29281.1|  sucrose synthase 1                                      339   2e-104   Camellia sinensis [black tea]
gb|KDO73787.1|  hypothetical protein CISIN_1g003661mg                   330   2e-103   Citrus sinensis [apfelsine]
ref|XP_010107074.1|  Sucrose synthase                                   336   3e-103   Morus notabilis
emb|CAN82840.1|  hypothetical protein VITISV_024563                     335   4e-103   Vitis vinifera
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    335   4e-103   Daucus carota [carrots]
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        335   5e-103   Vitis vinifera
gb|AJW82916.1|  sucrose synthase                                        335   7e-103   Dimocarpus longan [longan]
gb|AAD09568.1|  sucrose synthase                                        323   3e-102   Gossypium hirsutum [American cotton]
gb|KDO73786.1|  hypothetical protein CISIN_1g003661mg                   330   5e-102   Citrus sinensis [apfelsine]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             330   4e-101   Citrus clementina [clementine]
dbj|BAA89049.1|  sucrose synthase                                       330   4e-101   Citrus unshiu [satsuma mandarin]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        330   4e-101   Citrus sinensis [apfelsine]
gb|KJB54540.1|  hypothetical protein B456_009G038000                    323   5e-101   Gossypium raimondii
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       330   5e-101   
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       330   9e-101   Theobroma cacao [chocolate]
gb|AFY03624.1|  sucrose synthase                                        313   9e-101   Eucalyptus globulus [blue gum]
gb|AEK81522.1|  sucrose synthase isoform D                              329   1e-100   Gossypium hirsutum [American cotton]
gb|AEV40460.1|  sucrose synthase 1                                      329   1e-100   Gossypium arboreum [tree cotton]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    329   1e-100   Gossypium raimondii
gb|KHG00606.1|  Sucrose synthase                                        329   2e-100   Gossypium arboreum [tree cotton]
gb|KJB82967.1|  hypothetical protein B456_013G222400                    329   2e-100   Gossypium raimondii
dbj|BAA88905.1|  sucrose synthase                                       327   6e-100   Citrus unshiu [satsuma mandarin]
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        327   9e-100   Cucumis melo [Oriental melon]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        326   1e-99    Malus domestica [apple tree]
gb|ADY68846.1|  sucrose synthase                                        326   2e-99    Gossypium herbaceum subsp. africanum
gb|AEN71063.1|  sucrose synthase Sus1                                   326   2e-99    Gossypium mustelinum
gb|ADY68848.1|  sucrose synthase                                        326   2e-99    Gossypium hirsutum [American cotton]
gb|ADY68844.1|  sucrose synthase                                        326   2e-99    Gossypium barbadense [Egyptian cotton]
gb|AEV40462.1|  sucrose synthase 3                                      326   2e-99    Gossypium arboreum [tree cotton]
gb|AAD28641.1|  sucrose synthase                                        326   2e-99    Gossypium hirsutum [American cotton]
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   325   2e-99    
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   325   3e-99    
gb|KJB54542.1|  hypothetical protein B456_009G038000                    323   4e-99    Gossypium raimondii
gb|AIJ28960.1|  sucrose synthase                                        325   5e-99    Manihot esculenta subsp. flabellifolia
gb|AIJ28962.1|  sucrose synthase                                        325   6e-99    Manihot esculenta [manioc]
gb|AEV40463.1|  sucrose synthase 4                                      324   7e-99    Gossypium arboreum [tree cotton]
gb|AEN71059.1|  sucrose synthase Sus1                                   324   8e-99    Gossypium thurberi
gb|AEN71080.1|  sucrose synthase Sus1                                   324   8e-99    Gossypium gossypioides
gb|ADY68845.1|  sucrose synthase                                        324   8e-99    Gossypium barbadense [Egyptian cotton]
gb|AEN71078.1|  sucrose synthase Sus1                                   324   9e-99    Gossypium klotzschianum
gb|AEN71061.1|  sucrose synthase Sus1                                   324   9e-99    Gossypium schwendimanii
gb|AEK81520.1|  sucrose synthase isoform B                              324   9e-99    Gossypium hirsutum [American cotton]
gb|AEN71068.1|  sucrose synthase Sus1                                   324   9e-99    Gossypium tomentosum
gb|AEN71079.1|  sucrose synthase Sus1                                   324   9e-99    Gossypium aridum
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    324   1e-98    Alnus glutinosa
gb|AEN71060.1|  sucrose synthase Sus1                                   324   1e-98    Gossypium laxum
gb|KJB54541.1|  hypothetical protein B456_009G038000                    324   1e-98    Gossypium raimondii
gb|KJB54539.1|  hypothetical protein B456_009G038000                    324   2e-98    Gossypium raimondii
gb|ACV72640.1|  sucrose synthase 1                                      323   2e-98    Gossypium hirsutum [American cotton]
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       322   2e-98    Cucumis sativus [cucumbers]
gb|AIL23782.1|  sucrose synthase                                        323   2e-98    Prunus serrulata
ref|NP_001292638.1|  sucrose synthase                                   323   2e-98    Cucumis sativus [cucumbers]
ref|XP_004144053.1|  PREDICTED: sucrose synthase                        323   3e-98    Cucumis sativus [cucumbers]
gb|AFI57908.1|  sucrose synthase 1                                      322   4e-98    Prunus persica
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    322   4e-98    Vicia faba [broad bean]
dbj|BAM05652.1|  sucrose synthase 3                                     322   4e-98    Eucalyptus globulus subsp. globulus
dbj|BAM05649.1|  sucrose synthase 3                                     322   5e-98    Eucalyptus globulus subsp. globulus
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             322   5e-98    Prunus persica
gb|AEN71075.1|  sucrose synthase Sus1                                   322   5e-98    Gossypium armourianum
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        322   5e-98    Prunus mume [ume]
gb|KJB65375.1|  hypothetical protein B456_010G092300                    320   6e-98    Gossypium raimondii
emb|CAA09910.1|  sucrose synthase                                       322   6e-98    Pisum sativum [garden pea]
dbj|BAM05650.1|  sucrose synthase 3                                     322   6e-98    Eucalyptus pilularis
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        322   6e-98    Pisum sativum [garden pea]
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        322   8e-98    
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        322   8e-98    Cicer arietinum [garbanzo]
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        321   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   321   1e-97    Pyrus x bretschneideri [bai li]
gb|AGM14949.1|  sucrose synthase 4                                      321   1e-97    Hevea brasiliensis [jebe]
gb|AEN71066.1|  sucrose synthase Sus1                                   321   1e-97    Gossypium darwinii
gb|AGQ57012.1|  sucrose synthase 1                                      321   1e-97    Hevea brasiliensis [jebe]
dbj|BAA89232.1|  wsus                                                   321   1e-97    Citrullus lanatus [wild melon]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    321   1e-97    Gossypium raimondii
gb|KJB65372.1|  hypothetical protein B456_010G092300                    321   1e-97    Gossypium raimondii
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        321   1e-97    Cicer arietinum [garbanzo]
gb|AEF56625.1|  sucrose synthase                                        320   2e-97    Arachis hypogaea var. vulgaris [Spanish peanut]
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        321   3e-97    
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        320   4e-97    Eucalyptus grandis [rose gum]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        320   5e-97    Nelumbo nucifera [Indian lotus]
gb|AFY03626.1|  sucrose synthase                                        319   5e-97    Eucalyptus globulus [blue gum]
dbj|BAM05651.1|  sucrose synthase 3                                     319   6e-97    Eucalyptus pyrocarpa
ref|XP_012077131.1|  PREDICTED: sucrose synthase                        319   7e-97    
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   319   8e-97    Pyrus x bretschneideri [bai li]
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   319   9e-97    Pyrus x bretschneideri [bai li]
gb|ABF50715.1|  sucrose synthase                                        319   1e-96    Viscum album subsp. album
gb|AGV22112.1|  sucrose synthase 2                                      318   1e-96    Betula luminifera [liang ye hua]
gb|AES92143.2|  sucrose synthase                                        317   1e-96    Medicago truncatula
ref|XP_002516210.1|  sucrose synthase, putative                         317   1e-96    
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        318   2e-96    
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   318   2e-96    
gb|AII19313.1|  sucrose synthase 1                                      318   2e-96    Ricinus communis
ref|NP_001289655.1|  sucrose synthase                                   318   2e-96    Eucalyptus grandis [rose gum]
gb|AEN71067.1|  sucrose synthase Sus1                                   318   2e-96    Gossypium tomentosum
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        318   2e-96    
ref|XP_003609949.1|  Sucrose synthase                                   317   3e-96    Medicago truncatula
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        317   3e-96    Nelumbo nucifera [Indian lotus]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    317   3e-96    Medicago sativa [alfalfa]
gb|AGH29112.1|  sucrose synthase                                        317   4e-96    Jatropha curcas
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   317   6e-96    Eucalyptus grandis [rose gum]
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     317   6e-96    Eucalyptus grandis [rose gum]
ref|NP_001289661.1|  sucrose synthase-like                              317   6e-96    Eucalyptus grandis [rose gum]
ref|NP_001237525.1|  sucrose synthase                                   316   1e-95    Glycine max [soybeans]
ref|XP_003609946.1|  Sucrose synthase                                   317   1e-95    
gb|ACR08725.1|  sucrose synthase                                        298   1e-95    Vigna luteola
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        315   1e-95    Fragaria vesca subsp. vesca
dbj|BAH56282.1|  sucrose synthase                                       315   2e-95    Vigna angularis [azuki bean]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    315   2e-95    Vigna radiata var. radiata [golden gram]
gb|AIJ28959.1|  sucrose synthase                                        315   3e-95    Manihot esculenta subsp. flabellifolia
gb|AIJ28961.1|  sucrose synthase                                        315   3e-95    Manihot esculenta [manioc]
gb|ABD96570.1|  sucrose synthase                                        315   3e-95    Manihot esculenta [manioc]
gb|KHN17754.1|  Sucrose synthase                                        315   3e-95    Glycine soja [wild soybean]
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        315   3e-95    
gb|ABP88869.1|  sucrose synthase                                        315   4e-95    Medicago falcata [sickle alfalfa]
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 314   5e-95    Tarenaya hassleriana [spider flower]
gb|AFS17277.1|  sucrose synthase 1                                      313   8e-95    Amaranthus cruentus/Amaranthus hypocondriacus mixed library
emb|CAB40795.1|  sucrose synthase                                       313   8e-95    Medicago truncatula
gb|AAR19769.1|  sucrose synthase                                        312   2e-94    Beta vulgaris [beet]
dbj|BAE99649.1|  sucrose synthase like protein                          299   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             310   1e-93    Phaseolus vulgaris [French bean]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        310   2e-93    
gb|AAN76498.1|AF315375_1  sucrose synthase                              310   2e-93    Phaseolus vulgaris [French bean]
gb|ADW80550.1|  sucrose synthase 1                                      309   4e-93    Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      309   4e-93    Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      309   4e-93    Populus tomentosa [Chinese white poplar]
gb|AAA63685.1|  sucrose synthase                                        289   4e-93    Solanum tuberosum [potatoes]
gb|AEV40464.1|  sucrose synthase 5                                      309   5e-93    Gossypium arboreum [tree cotton]
gb|ADW80555.1|  sucrose synthase 1                                      308   9e-93    Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      308   1e-92    Populus tomentosa [Chinese white poplar]
gb|ADR81996.1|  sucrose synthase 1                                      308   1e-92    Populus trichocarpa [western balsam poplar]
gb|ADW80552.1|  sucrose synthase 1                                      308   2e-92    Populus tomentosa [Chinese white poplar]
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        308   2e-92    Populus euphratica
gb|ADW80541.1|  sucrose synthase 1                                      307   3e-92    Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      307   3e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      307   3e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      306   3e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      306   3e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      306   3e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80545.1|  sucrose synthase 1                                      306   3e-92    Populus tomentosa [Chinese white poplar]
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        306   6e-92    Populus euphratica
ref|XP_002324136.2|  sucrose synthase family protein                    306   6e-92    
gb|ADW80562.1|  sucrose synthase 1                                      305   9e-92    Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      305   9e-92    Populus tomentosa [Chinese white poplar]
emb|CAA57881.1|  sucrose synthase                                       305   1e-91    Oxybasis rubra [pigweed]
gb|ADW80566.1|  sucrose synthase 1                                      305   1e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      305   1e-91    Populus tomentosa [Chinese white poplar]
gb|AAR03498.1|  sucrose synthase                                        305   1e-91    Populus tremuloides
gb|ADW80551.1|  sucrose synthase 1                                      305   2e-91    Populus tomentosa [Chinese white poplar]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        305   2e-91    Populus euphratica
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             305   2e-91    
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      305   2e-91    Tarenaya hassleriana [spider flower]
gb|ADW80597.1|  sucrose synthase 2                                      304   3e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80579.1|  sucrose synthase 2                                      304   3e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      304   4e-91    Populus tomentosa [Chinese white poplar]
gb|AHA41509.1|  sucrose synthase                                        304   4e-91    Populus deltoides
gb|ADW80587.1|  sucrose synthase 2                                      304   4e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      303   4e-91    Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80599.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80603.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80610.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      303   5e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80601.1|  sucrose synthase 2                                      303   6e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      303   6e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      303   6e-91    Populus tomentosa [Chinese white poplar]
gb|AGM14948.1|  sucrose synthase 3                                      303   6e-91    Hevea brasiliensis [jebe]
gb|ADW80608.1|  sucrose synthase 2                                      303   6e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80576.1|  sucrose synthase 2                                      303   6e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      303   7e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80583.1|  sucrose synthase 2                                      303   7e-91    Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      303   8e-91    Populus tomentosa [Chinese white poplar]
gb|ADR81997.1|  sucrose synthase 2                                      303   8e-91    Populus trichocarpa [western balsam poplar]
ref|XP_006381564.1|  sucrose synthase family protein                    303   9e-91    Populus trichocarpa [western balsam poplar]
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        303   1e-90    
gb|ADW80602.1|  sucrose synthase 2                                      303   1e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      302   1e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      302   1e-90    Populus tomentosa [Chinese white poplar]
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        302   1e-90    
gb|ADW80556.1|  sucrose synthase 1                                      302   1e-90    Populus tomentosa [Chinese white poplar]
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      302   2e-90    Elaeis guineensis
dbj|BAM05645.1|  sucrose synthase 1                                     301   2e-90    Eucalyptus pilularis
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             302   2e-90    Capsella rubella
gb|ADW80577.1|  sucrose synthase 2                                      301   3e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      301   3e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      301   3e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80600.1|  sucrose synthase 2                                      301   3e-90    Populus tomentosa [Chinese white poplar]
gb|KHN47619.1|  Sucrose synthase                                        301   4e-90    Glycine soja [wild soybean]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        301   4e-90    Glycine max [soybeans]
gb|ADW80611.1|  sucrose synthase 2                                      301   4e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      301   5e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      300   6e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80590.1|  sucrose synthase 2                                      300   7e-90    Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      300   8e-90    Populus tomentosa [Chinese white poplar]
ref|NP_566865.2|  sucrose synthase 4                                    300   1e-89    Arabidopsis thaliana [mouse-ear cress]
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    300   1e-89    Tulipa gesneriana
dbj|BAM05648.1|  sucrose synthase 1                                     299   2e-89    Eucalyptus globulus subsp. globulus
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             299   3e-89    Phaseolus vulgaris [French bean]
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        298   4e-89    
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 298   7e-89    Elaeis guineensis
gb|KHN49081.1|  Sucrose synthase                                        297   1e-88    Glycine soja [wild soybean]
gb|ACP17902.1|  sucrose synthase                                        297   1e-88    Phaseolus vulgaris [French bean]
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      296   4e-88    Phoenix dactylifera
gb|ABW76422.1|  sucrose synthase                                        295   5e-88    Populus tremuloides
gb|KEH37657.1|  sucrose synthase                                        295   1e-87    Medicago truncatula
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      295   1e-87    Phoenix dactylifera
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 292   9e-87    
gb|AFW88072.1|  sucrose synthase1                                       285   1e-86    
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 292   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW88071.1|  sucrose synthase1                                       285   2e-86    
gb|AGW23638.1|  sucrose synthase                                        291   3e-86    Lilium davidii
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      291   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             290   5e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      290   7e-86    Phoenix dactylifera
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 290   8e-86    Oryza brachyantha
ref|XP_006838088.1|  PREDICTED: sucrose synthase 2                      290   1e-85    Amborella trichopoda
gb|AEA76429.1|  sucrose synthase 1                                      289   2e-85    Oncidium hybrid cultivar
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    288   2e-85    Daucus carota [carrots]
gb|EAZ04713.1|  hypothetical protein OsI_26874                          289   2e-85    Oryza sativa Indica Group [Indian rice]
ref|NP_001060278.1|  Os07g0616800                                       289   2e-85    
gb|ABG91018.1|  sucrose synthase                                        278   3e-85    Solanum tuberosum [potatoes]
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 288   3e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF96469.1|  Sucrose synthase 2, putative, expressed                 282   3e-85    Oryza sativa Japonica Group [Japonica rice]
gb|AAV64256.2|  sucrose synthase                                        288   3e-85    Bambusa oldhamii
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 288   5e-85    Setaria italica
gb|ADY02961.1|  sucrose synthase                                        288   5e-85    Dendrobium officinale
gb|AGI56230.1|  sucrose synthase 1                                      288   5e-85    Saccharum officinarum [noble cane]
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          288   6e-85    Sorghum bicolor [broomcorn]
gb|AAL50570.1|AF412037_1  sucrose synthase                              288   6e-85    Bambusa oldhamii
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 287   7e-85    Elaeis guineensis
gb|AAC41682.1|  sucrose synthase 3                                      287   1e-84    Oryza sativa Japonica Group [Japonica rice]
prf||2008300A  sucrose synthase:ISOTYPE=2                               286   1e-84 
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      287   1e-84    Oryza brachyantha
gb|AEO09338.2|  sucrose synthase                                        287   1e-84    Musa acuminata AAA Group [Cavendish banana]
gb|AAA68209.1|  sus1                                                    286   3e-84    Zea mays [maize]
ref|NP_001105323.1|  sucrose synthase 2                                 286   3e-84    Zea mays [maize]
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           286   3e-84    Zea mays [maize]
gb|ADW80596.1|  sucrose synthase 2                                      285   3e-84    Populus tomentosa [Chinese white poplar]
gb|AIS75087.1|  sus1                                                    286   3e-84    Zea mays [maize]
gb|AAM95943.1|  sucrose synthase                                        285   4e-84    
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      286   4e-84    
ref|XP_006650176.1|  PREDICTED: sucrose synthase 1-like isoform X1      286   5e-84    
gb|AIL88516.1|  sucrose synthase type 2-1                               285   6e-84    
gb|EMS65561.1|  Sucrose synthase 2                                      285   7e-84    
gb|AIL88517.1|  sucrose synthase type 2-2                               284   9e-84    
emb|CAC32462.1|  sucrose synthase isoform 3                             283   2e-83    
ref|NP_001050319.1|  Os03g0401300                                       283   3e-83    
gb|AAM95944.1|  sucrose synthase                                        281   1e-82    
gb|EAY90371.1|  hypothetical protein OsI_11950                          281   1e-82    
dbj|BAE06059.1|  sucrose synthase                                       281   1e-82    
dbj|BAK02964.1|  predicted protein                                      280   4e-82    
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      280   4e-82    
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   279   5e-82    
ref|NP_001105411.1|  sucrose synthase 1                                 279   6e-82    
ref|XP_008659019.1|  PREDICTED: sucrose synthase 1 isoform X1           279   7e-82    
ref|NP_001266691.1|  sucrose synthase 1                                 279   7e-82    
emb|CAA03935.1|  sucrose synthase type 2                                279   1e-81    
gb|AAF85966.1|AF263384_1  sucrose synthase-2                            278   1e-81    
gb|ACM69042.1|  sucrose synthase                                        278   2e-81    
gb|AEX98033.1|  sucrose synthase                                        278   2e-81    
gb|AFW85475.1|  shrunken1 isoform 1                                     280   2e-81    
gb|EMS66266.1|  Sucrose synthase 1                                      278   2e-81    
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             278   2e-81    
gb|AAM68126.1|  sucrose synthase                                        278   2e-81    
dbj|BAJ10424.1|  sucrose synthase                                       277   4e-81    
ref|XP_006655877.1|  PREDICTED: sucrose synthase 2-like                 277   4e-81    
gb|AIO11845.1|  sucrose synthase                                        277   5e-81    
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      277   5e-81    
ref|XP_004964611.1|  PREDICTED: sucrose synthase 1-like                 276   6e-81    
gb|AAL50571.1|AF412038_1  sucrose synthase                              277   6e-81    
ref|XP_009601288.1|  PREDICTED: sucrose synthase 2-like                 268   1e-80    
gb|AAL50572.2|AF412039_1  sucrose synthase                              276   1e-80    
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      276   1e-80    
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    276   1e-80    
emb|CDY16569.1|  BnaC09g37040D                                          275   2e-80    
ref|NP_001057047.1|  Os06g0194900                                       275   3e-80    
gb|AEX32875.1|  sucrose synthase 2                                      275   3e-80    
emb|CDX92432.1|  BnaA10g14710D                                          273   8e-80    
dbj|BAJ99820.1|  predicted protein                                      273   1e-79    
emb|CAA75793.1|  sucrose synthase 2                                     273   1e-79    
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      272   3e-79    
gb|ABL74568.1|  sucrose synthase 2                                      272   3e-79    
emb|CAA78747.1|  sucrose synthase                                       272   4e-79    
emb|CDX70945.1|  BnaC03g10290D                                          271   7e-79    
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      271   7e-79    
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    271   8e-79    
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      271   9e-79    
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             271   9e-79    
gb|EMS59092.1|  Sucrose synthase 1                                      271   1e-78    
gb|EMT33394.1|  Sucrose synthase 1                                      271   1e-78    
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    270   2e-78    
emb|CAA50317.1|  sucrose synthase                                       270   2e-78    
gb|EAZ00002.1|  hypothetical protein OsI_22003                          270   2e-78    
emb|CAZ64535.1|  sucrose synthase                                       270   2e-78    
gb|AHM02468.1|  sucrose synthase                                        270   2e-78    
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      270   2e-78    
gb|EMT20174.1|  Sucrose synthase 2                                      267   3e-78    
ref|NP_197583.1|  sucrose synthase 1                                    269   3e-78    
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      269   4e-78    
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    269   5e-78    
gb|ACR78192.1|  sucrose synthase                                        249   1e-77    
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      267   3e-77    
gb|ACR78193.1|  sucrose synthase                                        248   3e-77    
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    266   8e-77    
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 265   1e-76    
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 265   2e-76    
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      264   2e-76    
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      264   3e-76    
emb|CAA04543.1|  sucrose synthase type I                                263   5e-76    
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...    263   8e-76    
ref|XP_007050987.1|  Sucrose synthase 3 isoform 4                       260   9e-76    
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      263   1e-75    
gb|AGM14950.1|  sucrose synthase 5                                      262   1e-75    
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      262   1e-75    
gb|AGV22111.1|  sucrose synthase 1                                      262   1e-75    
ref|XP_004494390.1|  PREDICTED: sucrose synthase 2-like isoform X1      262   2e-75    
gb|EPS70967.1|  sucrose synthase                                        250   2e-75    
gb|AEH27530.1|  putative sucrose synthase                               257   3e-75    
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      261   5e-75    
ref|XP_007050986.1|  Sucrose synthase 3 isoform 3                       259   7e-75    
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      261   8e-75    
gb|AFP23359.1|  sucrose synthase                                        260   1e-74    
ref|XP_007050985.1|  Sucrose synthase 3 isoform 2                       259   1e-74    
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       260   2e-74    
gb|EYU46748.1|  hypothetical protein MIMGU_mgv1a001481mg                259   2e-74    
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      259   3e-74    
ref|NP_192137.1|  sucrose synthase 3                                    259   3e-74    
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 258   4e-74    
gb|AAC28175.1|  T2H3.8                                                  258   4e-74    
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      258   6e-74    
dbj|BAJ88274.1|  predicted protein                                      245   6e-74    
gb|KDO87157.1|  hypothetical protein CISIN_1g003492mg                   256   6e-74    
ref|XP_006396435.1|  hypothetical protein EUTSA_v10028435mg             257   7e-74    
gb|AEN79501.1|  sucrose synthase 2                                      258   8e-74    
gb|AEN71083.1|  sucrose synthase SusA1                                  257   9e-74    
gb|AEN71092.1|  sucrose synthase SusA1                                  257   9e-74    
gb|AEV40893.1|  sucrose synthase                                        257   9e-74    
gb|AEN71093.1|  sucrose synthase SusA1                                  257   9e-74    
gb|AEN71104.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71096.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71090.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71085.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71086.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71099.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71087.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71084.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71103.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71101.1|  sucrose synthase SusA1                                  257   1e-73    
gb|ADP88918.1|  sucrose synthase                                        257   1e-73    
gb|AEN71105.1|  sucrose synthase SusA1                                  257   1e-73    
gb|AEN71088.1|  sucrose synthase SusA1                                  257   1e-73    
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 257   1e-73    
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      257   1e-73    
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             257   1e-73    
gb|AEV40894.1|  sucrose synthase                                        257   1e-73    
gb|AEN71094.1|  sucrose synthase SusA1                                  256   2e-73    
emb|CAB38022.1|  sucrose synthase                                       256   2e-73    
dbj|BAB20799.1|  sucrose synthase 1                                     256   2e-73    
gb|AEN71089.1|  sucrose synthase SusA1                                  256   2e-73    
gb|AFM52237.1|  putative sucrose synthase 6                             256   2e-73    
gb|AEZ00745.1|  SusA1                                                   256   2e-73    
gb|AEN71091.1|  sucrose synthase SusA1                                  256   2e-73    
ref|XP_008784779.1|  PREDICTED: sucrose synthase 4-like                 251   2e-73    
gb|AEN71106.1|  sucrose synthase SusA1                                  256   2e-73    
gb|AEZ00746.1|  SusA1                                                   256   3e-73    
gb|EMT16287.1|  Sucrose synthase 2                                      246   3e-73    
ref|XP_002874924.1|  hypothetical protein ARALYDRAFT_490342             256   3e-73    
gb|KDO87155.1|  hypothetical protein CISIN_1g003492mg                   255   4e-73    
ref|XP_011006464.1|  PREDICTED: sucrose synthase 2                      256   4e-73    
gb|AEV40895.1|  sucrose synthase                                        256   4e-73    
gb|KJB24379.1|  hypothetical protein B456_004G142700                    255   4e-73    
gb|ABK78781.1|  putative sucrose synthase                               255   5e-73    
gb|AJW82917.1|  sucrose synthase                                        255   5e-73    
gb|KDO87154.1|  hypothetical protein CISIN_1g003492mg                   255   5e-73    
dbj|BAM68527.1|  sucrose synthase                                       255   5e-73    
dbj|BAM68521.1|  sucrose synthase                                       255   5e-73    
gb|KJB24381.1|  hypothetical protein B456_004G142700                    255   5e-73    
dbj|BAM37539.1|  sucrose synthase                                       255   5e-73    
dbj|BAM68520.1|  sucrose synthase                                       255   5e-73    
dbj|BAM68526.1|  sucrose synthase                                       255   5e-73    
gb|AGQ57013.1|  sucrose synthase 2                                      255   5e-73    
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    255   5e-73    
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   255   6e-73    
dbj|BAA88904.1|  sucrose synthase                                       255   6e-73    
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   255   6e-73    
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             255   6e-73    
gb|AGM14947.1|  sucrose synthase 2                                      255   6e-73    
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 255   6e-73    
gb|KEH24408.1|  sucrose synthase                                        255   6e-73    
dbj|BAA88981.1|  sucrose synthase                                       255   7e-73    
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 255   7e-73    
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             254   8e-73    
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 254   9e-73    
ref|XP_009414138.1|  PREDICTED: sucrose synthase 4-like                 254   1e-72    
gb|AHL29282.1|  sucrose synthase 2                                      254   2e-72    
gb|AFO84091.1|  sucrose synthase                                        254   2e-72    
gb|AEV40896.1|  sucrose synthase                                        254   2e-72    
dbj|BAP47501.1|  sucrose synthase                                       254   2e-72    
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       254   2e-72    
gb|KCW81856.1|  hypothetical protein EUGRSUZ_C03207                     253   3e-72    
gb|ABR87939.1|  sucrose synthase 1                                      253   3e-72    
ref|XP_010684343.1|  PREDICTED: sucrose synthase                        253   3e-72    
ref|NP_001280838.1|  sucrose synthase 3                                 253   4e-72    
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      253   4e-72    
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 253   4e-72    
ref|XP_010049329.1|  PREDICTED: sucrose synthase-like                   253   4e-72    
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      253   4e-72    
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      253   5e-72    
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 253   5e-72    
ref|NP_001268888.1|  sucrose synthase 2-like                            253   5e-72    
gb|AAK65960.1|AF273253_1  sucrose synthase                              253   5e-72    
tpg|DAA45276.1|  TPA: hypothetical protein ZEAMMB73_631953              241   5e-72    
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    252   6e-72    
ref|XP_010092252.1|  Sucrose synthase 2                                 252   9e-72    
ref|XP_002523115.1|  sucrose synthase, putative                         251   1e-71    
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    251   1e-71    
ref|XP_002302727.1|  sucrose synthase family protein                    251   1e-71    
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 251   2e-71    
emb|CDY52781.1|  BnaCnng23260D                                          251   2e-71    
dbj|BAE79815.1|  sucrose synthase                                       252   2e-71    
ref|XP_012082813.1|  PREDICTED: sucrose synthase 2                      251   2e-71    
gb|AES61743.2|  sucrose synthase                                        250   3e-71    
ref|XP_003591492.1|  Sucrose synthase                                   250   3e-71    
ref|XP_007035652.1|  Sucrose synthase 2 isoform 2                       249   5e-71    
gb|AFZ78660.1|  sucrose synthase                                        249   8e-71    
gb|ABF95855.1|  Sucrose synthase 2, putative, expressed                 247   1e-70    
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       249   1e-70    
ref|XP_009111303.1|  PREDICTED: sucrose synthase 3                      248   2e-70    
ref|NP_001275237.1|  sucrose synthase                                   248   3e-70    
gb|AAQ18911.1|  sucrose synthase                                        231   3e-70    
ref|XP_008789904.1|  PREDICTED: sucrose synthase 4                      248   3e-70    
emb|CDY22042.1|  BnaA09g00710D                                          247   4e-70    
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      247   6e-70    
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      246   7e-70    
gb|AFS17278.1|  sucrose synthase 2                                      246   1e-69    
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   246   1e-69    
ref|NP_001050064.1|  Os03g0340500                                       246   1e-69    
gb|KFK36302.1|  hypothetical protein AALP_AA4G104600                    246   2e-69    
gb|EMT06653.1|  Sucrose synthase 1                                      245   2e-69    
ref|XP_009378749.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    245   2e-69    
gb|AJW82918.1|  sucrose synthase                                        245   2e-69    
emb|CAZ65725.1|  sucrose synthase                                       245   3e-69    
ref|XP_008245454.1|  PREDICTED: sucrose synthase 2-like                 242   4e-69    
emb|CAJ32597.1|  sucrose synthase                                       244   8e-69    
emb|CDP17108.1|  unnamed protein product                                244   9e-69    
emb|CDX85398.1|  BnaC07g27090D                                          243   2e-68    
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 243   2e-68    
gb|ABR15470.1|  sucrose synthase                                        243   2e-68    
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      243   2e-68    
ref|XP_011079962.1|  PREDICTED: sucrose synthase 2                      242   2e-68    
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 242   3e-68    
ref|XP_009391495.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    242   3e-68    
ref|XP_010484973.1|  PREDICTED: sucrose synthase 2-like                 242   4e-68    
ref|XP_008351185.1|  PREDICTED: sucrose synthase 2-like                 242   4e-68    
gb|KJB07349.1|  hypothetical protein B456_001G017700                    242   4e-68    
ref|XP_007163137.1|  hypothetical protein PHAVU_001G209600g             241   5e-68    
ref|XP_008245453.1|  PREDICTED: sucrose synthase 2-like                 226   5e-68    
gb|AIL88515.1|  sucrose synthase type 3                                 241   6e-68    
ref|XP_010442378.1|  PREDICTED: sucrose synthase 2-like                 238   7e-68    
ref|XP_012083986.1|  PREDICTED: sucrose synthase 2-like isoform X2      241   8e-68    



>gb|ACL00957.1| sucrose synthase [Ipomoea batatas]
Length=727

 Score =   415 bits (1066),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/204 (99%), Positives = 202/204 (99%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPH+LLAEFEAICKEDQE
Sbjct  1     MAERALTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHELLAEFEAICKEDQE  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE
Sbjct  61    KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD
Sbjct  121   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVHQYKGKTMMLNDRIQN NTL
Sbjct  181   FLRVHQYKGKTMMLNDRIQNLNTL  204



>dbj|BAP82380.1| sucrose synthase, partial [Orobanche aegyptiaca]
Length=243

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEF+ IC+ D+ 
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFKVICQADKA  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL DHAFQ+VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTV +YL FKE
Sbjct  61    KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVSQYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G ANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHD+ES+TPLLD
Sbjct  121   ELVNGTANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDRESMTPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLNDRI+N N+L
Sbjct  181   FLRMHSYKGKTMMLNDRIRNLNSL  204



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   380 bits (977),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IE+HGKGILKPHQL+AEFEAIC  D+E
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIEAHGKGILKPHQLMAEFEAICAADKE  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL DHAF++VLKSTQEAIV PPWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61    KLQDHAFKEVLKSTQEAIVFPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
              LV+G ANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLLD
Sbjct  121   VLVNGTANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLNDRI+N N+L
Sbjct  181   FLRMHHYKGKTMMLNDRIRNLNSL  204



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   379 bits (973),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYL FKE
Sbjct  61    KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGTSNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHNYKGKTMMLNDRIQNLTTL  204



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   379 bits (973),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+ALAVEEL VPEYL FKE
Sbjct  61    KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALAVEELAVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGTSNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHNYKGKTMMLNDRIQNLTTL  204



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPE+LQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEFLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +N NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSNDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHHYKGKTMMLNDRIQNLYTL  204



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPE+LQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEFLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +N NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSNDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHHYKGKTMMLNDRIQNLYTL  204



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPE+LQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEFLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +N NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSNDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHHYKGKTMMLNDRIQNLYTL  204



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   378 bits (970),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1     MAERALTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYL FKE
Sbjct  61    KLNDHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGTSNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHNYKGKTMMLNDRIQNLTTL  204



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   377 bits (968),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEFEAIC+ D+ 
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFEAICQADKA  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL DHAFQ+VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEELTVP+YL FKE
Sbjct  61    KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELTVPQYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G ANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHD+ES+TPLLD
Sbjct  121   ELVNGAANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDRESMTPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             F R+H YKGKTMMLNDRI+N N+L
Sbjct  181   FPRMHSYKGKTMMLNDRIRNLNSL  204



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   377 bits (968),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1     MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H YKGKTMMLNDRIQN+NTL
Sbjct  181   FLRAHHYKGKTMMLNDRIQNSNTL  204



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   377 bits (968),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVL PWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +N NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSNDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDR+Q+ NTL
Sbjct  181   FLRVHHYKGKTMMLNDRVQDLNTL  204



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   377 bits (968),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1     MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H YKGKTMMLNDRIQN+NTL
Sbjct  181   FLRAHHYKGKTMMLNDRIQNSNTL  204



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   377 bits (968),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1     MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H YKGKTMMLNDRIQN+NTL
Sbjct  181   FLRAHHYKGKTMMLNDRIQNSNTL  204



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   377 bits (967),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1     MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H YKGKTMMLNDRIQN+NTL
Sbjct  181   FLRAHHYKGKTMMLNDRIQNSNTL  204



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   377 bits (967),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVL PWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWEYVRVNVNALIVEELTVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +N NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSNDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQN  TL
Sbjct  181   FLRVHNYKGKTMMLNDRIQNLTTL  204



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   375 bits (962),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF++I KED+ 
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDSIHKEDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVL PWVALAIRLRPGVWEYVRVNV+AL VEELTVPEYLQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRPGVWEYVRVNVNALVVEELTVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G ++ NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSHDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQ+ NTL
Sbjct  181   FLRVHHYKGKTMMLNDRIQDLNTL  204



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             K++DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHAL VEELTVPEYL FKE
Sbjct  61    KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALVVEELTVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFPKPTLTK IG+GVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  121   ELVDGSKNGNFVLELDFEPFTASFPKPTLTKYIGDGVEFLNRHLSAKMFHDKESMAPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVHQYKGKTMMLNDRI++ NTL
Sbjct  181   FLRVHQYKGKTMMLNDRIKDLNTL  204



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             K++DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHAL VEELTVPEYL FKE
Sbjct  61    KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALVVEELTVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFPKPTLTK IG+GVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  121   ELVDGSKNGNFVLELDFEPFTASFPKPTLTKYIGDGVEFLNRHLSAKMFHDKESMAPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVHQYKGKTMMLNDRI++ NTL
Sbjct  181   FLRVHQYKGKTMMLNDRIKDLNTL  204



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1     MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             K++DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHAL VEELTVPEYL FKE
Sbjct  61    KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALVVEELTVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFPKPTLTK IG+GVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  121   ELVDGSKNGNFVLELDFEPFTASFPKPTLTKYIGDGVEFLNRHLSAKMFHDKESMAPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVHQYKGKTMMLNDRI++ NTL
Sbjct  181   FLRVHQYKGKTMMLNDRIKDLNTL  204



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   373 bits (957),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1     MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL+VEELTVPE+LQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALSVEELTVPEFLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G ++ NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSSDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y GK+MMLNDRIQN  TL
Sbjct  181   FLRVHHYNGKSMMLNDRIQNLYTL  204



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   373 bits (957),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1     MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLNDHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL+VEELTVPE+LQFKE
Sbjct  61    KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALSVEELTVPEFLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G ++ NFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+TPLL+
Sbjct  121   ELVNGTSSDNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMTPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y GK+MMLNDRIQN  TL
Sbjct  181   FLRVHHYNGKSMMLNDRIQNLYTL  204



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   372 bits (955),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1     MAERVLTRVHRLRERVDATLCAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+ PLL+
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMAPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H YKGKTMMLNDRI N+NTL
Sbjct  181   FLRAHHYKGKTMMLNDRIHNSNTL  204



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   372 bits (954),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1     MAERVLTRVHRLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKES+ PLL+
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESMAPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H YKGKTMMLNDRI N+NTL
Sbjct  181   FLRAHHYKGKTMMLNDRIHNSNTL  204



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   365 bits (938),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+ VLTRVHSLRERLDATL AHRNEILLF+S+IE HGKGILKPHQLL+EFEAIC+ D+E
Sbjct  1     MADPVLTRVHSLRERLDATLAAHRNEILLFLSRIEGHGKGILKPHQLLSEFEAICEADKE  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL DHAF++VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEE++V +YLQFKE
Sbjct  61    KLQDHAFKEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEEVSVSQYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +N NFVLELDFEPFT+SFPKPTLTKSIGNGVEFLNRHLSAKMFHD++S+TPLLD
Sbjct  121   ELVNGTSNDNFVLELDFEPFTSSFPKPTLTKSIGNGVEFLNRHLSAKMFHDRDSMTPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLNDRI+N N+L
Sbjct  181   FLRMHHYKGKTMMLNDRIRNLNSL  204



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   354 bits (909),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA +VLTRVHSLRERLD TL+AHRNEILLF+SKIESHGKGILKPHQ+ AE EA+ KE Q+
Sbjct  1     MAGQVLTRVHSLRERLDGTLSAHRNEILLFLSKIESHGKGILKPHQIEAEIEALSKEVQQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LKS QEAIVLPPW+A A+RLRPGVWEY+RVN++AL VEEL+VPEYLQFKE
Sbjct  61    KLYDGAFGELLKSAQEAIVLPPWIAFAVRLRPGVWEYMRVNLNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDGP NGNF+LELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  121   ELVDGPCNGNFILELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKESMHPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH Y GKTMMLNDRIQN N L
Sbjct  181   FLKVHNYNGKTMMLNDRIQNLNAL  204



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   353 bits (905),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 186/204 (91%), Gaps = 1/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAE+V TRVHSLRERLD+TL  HRNEIL+ +S+IESHGKGILKPHQL+AEF+AI KED  
Sbjct  1     MAEKVFTRVHSLRERLDSTLATHRNEILMVLSRIESHGKGILKPHQLMAEFDAISKEDN-  59

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL+D AF +VLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNV+AL VEEL+VPEYL FKE
Sbjct  60    KLHDGAFHEVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVNALVVEELSVPEYLHFKE  119

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV G +NGNFVLELDFEPFTASFP+PTLTKSIGNGVEFLNRHLSAKMFHDK+S+ PLLD
Sbjct  120   ELVSGDSNGNFVLELDFEPFTASFPRPTLTKSIGNGVEFLNRHLSAKMFHDKDSMHPLLD  179

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR H  KGKTMMLNDRIQN N+L
Sbjct  180   FLRTHACKGKTMMLNDRIQNLNSL  203



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   345 bits (884),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  632   TAMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKED  811
             + M ERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQL+ EFEAI + D
Sbjct  59    STMPERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLVPEFEAIFESD  118

Query  812   QE-KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQ  988
             ++ KL DHAF+Q+LK+TQEAIVLPPWVALAIRLRPGVWEYVRVNV+ L  E+LTV +YLQ
Sbjct  119   KKPKLQDHAFKQLLKTTQEAIVLPPWVALAIRLRPGVWEYVRVNVNTLVFEDLTVQQYLQ  178

Query  989   FKEELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTP  1168
             FKEELV+G  N  FVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAK+FHD ES+  
Sbjct  179   FKEELVNGSGNEKFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKLFHDNESMAA  238

Query  1169  LLDFLRVHQYKGKTMMLNDRIQNANTL  1249
             LLDFLR+H Y GKTMMLNDRI+N N+L
Sbjct  239   LLDFLRMHHYNGKTMMLNDRIENLNSL  265



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   339 bits (869),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  VLTRVHSLR+RLD TL+ HRNE+LL +S IE HGKGILKPHQ+ AEFEA+ K  Q+
Sbjct  1     MASHVLTRVHSLRDRLDGTLSTHRNELLLLLSNIEKHGKGILKPHQIEAEFEALPKHAQQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL+D  F +VLKS QEAIVLPPWVALAIRLRPGVWEY+RVN++AL VEEL+VPEYL FKE
Sbjct  61    KLHDGPFGEVLKSAQEAIVLPPWVALAIRLRPGVWEYIRVNINALVVEELSVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+GP NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAKMFHDKES+ PLL+
Sbjct  121   ELVEGPRNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+ H Y G+TMMLNDRIQN N L
Sbjct  181   FLKAHNYNGRTMMLNDRIQNLNAL  204



>gb|KDO73787.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=562

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1     MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score =   336 bits (861),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL AEFEAI + +++
Sbjct  1     MAERVLTRVHSLRERLDETLSAHRNEILAFLSRIEAKGKGFLQPHQLTAEFEAIPEANRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL +EEL V EYL FKE
Sbjct  61    KLLDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVIEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSLNGNFVLELDFEPFAASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH Y+GK+MMLNDRIQN N+L
Sbjct  181   FLQVHCYEGKSMMLNDRIQNLNSL  204



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   335 bits (860),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1     MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL+D  F  +LKS QEAIVLPPW+A A+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61    KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRPGVWEYIRVNVSALVVEELLVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTAS P+PTL+KSIGNGVEFLNRHLSAKMFHDK+S+ PLLD
Sbjct  121   ELVDGSCNGNFVLELDFEPFTASVPRPTLSKSIGNGVEFLNRHLSAKMFHDKDSMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR HQYKGKTMMLNDRIQN +TL
Sbjct  181   FLRTHQYKGKTMMLNDRIQNLDTL  204



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   335 bits (860),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 183/206 (89%), Gaps = 2/206 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M E VLTRVHSLRER+D+TL  HRNEIL+F+S+IESHGKGILKPHQLLAE+EAI KED+ 
Sbjct  1     MGEPVLTRVHSLRERMDSTLANHRNEILMFLSRIESHGKGILKPHQLLAEYEAISKEDKL  60

Query  818   KLNDH--AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQF  991
             KL+D   AF +V+KSTQEAIV PPWVALAIRLRPGVWEYVRVNVH L VEEL+VP+YLQF
Sbjct  61    KLDDGHGAFAEVIKSTQEAIVSPPWVALAIRLRPGVWEYVRVNVHHLVVEELSVPQYLQF  120

Query  992   KEELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPL  1171
             KEELV G ++ NFVLELDF PFTASFP+PTLTKSIGNGVEFLNRHLSAKMFH K+S+ PL
Sbjct  121   KEELVIGSSDANFVLELDFAPFTASFPRPTLTKSIGNGVEFLNRHLSAKMFHGKDSMHPL  180

Query  1172  LDFLRVHQYKGKTMMLNDRIQNANTL  1249
             L+FLR+H Y GKT+MLN+R+QN N L
Sbjct  181   LEFLRLHNYNGKTLMLNNRVQNVNGL  206



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   335 bits (860),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1     MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL+D  F  +LKS QEAIVLPPW+A A+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61    KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRPGVWEYIRVNVSALVVEELLVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTAS P+PTL+KSIGNGVEFLNRHLSAKMFHDK+S+ PLLD
Sbjct  121   ELVDGSCNGNFVLELDFEPFTASVPRPTLSKSIGNGVEFLNRHLSAKMFHDKDSMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR HQYKGKTMMLNDRIQN +TL
Sbjct  181   FLRTHQYKGKTMMLNDRIQNLDTL  204



>gb|AJW82916.1| sucrose synthase [Dimocarpus longan]
Length=805

 Score =   335 bits (858),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQL+AEFEA+ + +++
Sbjct  1     MAERALTRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQLVAEFEALPEHNRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL VPEYL FKE
Sbjct  61    KLADGAFAEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELQVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>gb|AAD09568.1| sucrose synthase [Gossypium hirsutum]
Length=454

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E++ 
Sbjct  1     MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENER  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LK++QE IVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61    KLADGAFFEILKASQEXIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNANFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             F  VH +KGK MMLNDRIQN N+L
Sbjct  181   FPEVHSHKGKNMMLNDRIQNLNSL  204



>gb|KDO73786.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=700

 Score =   330 bits (846),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1     MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   330 bits (846),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1     MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   330 bits (846),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1     MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   330 bits (846),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1     MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L + AF +VL++TQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    HLTEGAFGEVLRATQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>gb|KJB54540.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=562

 Score =   323 bits (829),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   330 bits (846),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIV PPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEILRASQEAIVFPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   330 bits (847),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  47    MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  106

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIV PPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  107   KLADGAFFEILRASQEAIVFPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  166

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  167   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  226

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  227   FLRVHCHKGKNMMLNDRIQNLNSL  250



>gb|AFY03624.1| sucrose synthase, partial [Eucalyptus globulus]
Length=274

 Score =   313 bits (802),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+R+LTR HSLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1     MADRMLTRSHSLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61    KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             EL DG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELADGSLNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNXRIQNVFSL  204



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   329 bits (843),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1     MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61    KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNANFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   329 bits (843),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1     MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61    KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNANFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   329 bits (843),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1     MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61    KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNANFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  9     MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  68

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  69    KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  128

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  129   ELVDGSSNANFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  188

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  189   FLKVHCHKGKNMMLNDRIQNLNSL  212



>gb|KJB82967.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=815

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1     MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++LK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL+FKE
Sbjct  61    KLADGAFFEILKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNANFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   327 bits (838),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1     MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L + AF +VL++TQEAIVL PWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    HLTEGAFGEVLRATQEAIVLAPWVALAVRPRPGVWEYIRVNVHALVVEELLVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N+L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_008450968.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450969.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450970.1| PREDICTED: sucrose synthase [Cucumis melo]
Length=806

 Score =   327 bits (837),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E+++
Sbjct  1     MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL V EYL+FKE
Sbjct  61    KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQVSEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FH KES+ PLLD
Sbjct  121   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHGKESMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQ  N  
Sbjct  181   FLRVHCYKGKTMMLNDRIQTLNAF  204



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   326 bits (836),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+AHRNEIL  +S+IES GKG L+PHQLLAEFE I + +++
Sbjct  1     MAERVLTRVQSLRERLDETLSAHRNEILALLSRIESKGKGFLQPHQLLAEFEEIPEANRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK+TQE IVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLK  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ +MLN++I++ N L
Sbjct  181   FLRVHCYEGRNLMLNNKIKDVNEL  204



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MAERALTRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   325 bits (834),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1     MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   325 bits (834),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1     MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>gb|KJB54542.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=750

 Score =   323 bits (829),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   325 bits (832),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLNSL  204



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   325 bits (832),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLNSL  204



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   324 bits (831),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1     MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+ TL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRSTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   324 bits (831),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   324 bits (831),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   324 bits (831),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   324 bits (831),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   324 bits (831),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   324 bits (830),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1     MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+ TL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRSTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   324 bits (830),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   324 bits (830),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   324 bits (830),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGI + HQL+AE EAI +  ++
Sbjct  1     MAERVLTRVHSLRERLDETLVANRNEIVALLSRIIGKGKGICRNHQLIAEVEAIPEATRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL VPEYL FKE
Sbjct  61    KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDF+PF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSTNGNFVLELDFDPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGK MMLNDRIQN N L
Sbjct  181   FLRVHCYKGKNMMLNDRIQNVNAL  204



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   324 bits (830),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|KJB54541.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=819

 Score =   324 bits (830),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|KJB54539.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=833

 Score =   324 bits (830),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   323 bits (829),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KS+GNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSVGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|KGN66333.1| hypothetical protein Csa_1G597800 [Cucumis sativus]
Length=783

 Score =   322 bits (826),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1     MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL+FKE
Sbjct  61    KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQASEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FH KES+ PLLD
Sbjct  121   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHGKESMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQ  +  
Sbjct  181   FLRVHCYKGKTMMLNDRIQTLDAF  204



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   323 bits (828),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+R LTRVHSLRERLD TL+AHRNEI   +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1     MADRALTRVHSLRERLDVTLSAHRNEIAALLSRIINKGKGFMQPHELVAEFEAIPESNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61    KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGK MMLNDRI N N L
Sbjct  181   FLRVHCYKGKNMMLNDRIHNVNEL  204



>ref|NP_001292638.1| sucrose synthase [Cucumis sativus]
 gb|AEN83999.1| sucrose synthase [Cucumis sativus]
Length=806

 Score =   323 bits (827),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1     MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL+FKE
Sbjct  61    KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQASEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FH KES+ PLLD
Sbjct  121   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHGKESMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQ  +  
Sbjct  181   FLRVHCYKGKTMMLNDRIQTLDAF  204



>ref|XP_004144053.1| PREDICTED: sucrose synthase [Cucumis sativus]
 ref|XP_011660038.1| PREDICTED: sucrose synthase [Cucumis sativus]
Length=806

 Score =   323 bits (827),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1     MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL+FKE
Sbjct  61    KLADGAFGEVLRSTQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQASEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FH KES+ PLLD
Sbjct  121   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHGKESMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQ  +  
Sbjct  181   FLRVHCYKGKTMMLNDRIQTLDAF  204



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   322 bits (826),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1     MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61    KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGK MMLNDRI N N L
Sbjct  181   FLRVHCYKGKNMMLNDRIHNVNEL  204



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   322 bits (826),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MATERLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>dbj|BAM05652.1| sucrose synthase 3, partial [Eucalyptus globulus subsp. globulus]
Length=795

 Score =   322 bits (825),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNVFSL  204



>dbj|BAM05649.1| sucrose synthase 3 [Eucalyptus globulus subsp. globulus]
Length=806

 Score =   322 bits (825),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNVFSL  204



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   322 bits (825),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1     MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61    KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGK MMLNDRI N N L
Sbjct  181   FLRVHCYKGKNMMLNDRIHNVNEL  204



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   322 bits (825),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQ+ N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQSLNAL  204



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   322 bits (825),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1     MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL  TQE IVLPPWVALA+R RPGVWEY+RVNV AL VEEL VPEYL FKE
Sbjct  61    KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRPGVWEYIRVNVDALVVEELQVPEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGK MMLNDRI N N L
Sbjct  181   FLRVHCYKGKNMMLNDRIHNVNEL  204



>gb|KJB65375.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=750

 Score =   320 bits (821),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1     MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+ TL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRSTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   322 bits (825),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>dbj|BAM05650.1| sucrose synthase 3, partial [Eucalyptus pilularis]
Length=795

 Score =   322 bits (824),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL +EEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVIEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNVFSL  204



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   322 bits (825),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>ref|XP_004508033.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004508034.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
Length=811

 Score =   322 bits (824),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   322 bits (824),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1     MAERVLTRVQSLRERLDQTLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEA+VLPPWVALA+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRPGVWEYIRVNVHALTLEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH Y+G+ MMLN+RI+N N L
Sbjct  181   FLQVHCYEGRNMMLNNRIKNVNEL  204



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1     MAERVLTRVQSLRERLDETLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEA+VLPPWVALA+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRPGVWEYIRVNVHALTLEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH Y+G+ MMLN+RI+N N L
Sbjct  181   FLQVHCYEGRNMMLNNRIKNVNEL  204



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLDSL  204



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA  V+TRVHSLRERLD TL AH NEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MANPVITRVHSLRERLDETLLAHGNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK++QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFFEVLKASQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLDSL  204



>dbj|BAA89232.1| wsus [Citrullus lanatus]
Length=806

 Score =   321 bits (822),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ HQL+AEFEAI +E+++
Sbjct  1     MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHQLIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL++TQE+IVLPPWVALA+R RPGVWEY++VNVHAL VEEL V EYL  KE
Sbjct  61    KLADGDFGEVLRATQESIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELQVAEYLHLKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHL AK+FH KES+ PLLD
Sbjct  121   ELVDGSSNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLLAKLFHGKESMQPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGKTMMLNDRIQ  N  
Sbjct  181   FLRVHCYKGKTMMLNDRIQTLNAF  204



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1     MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+ TL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRSTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   321 bits (822),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1     MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+ TL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRSTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   321 bits (822),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   320 bits (821),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MAADRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   EYL+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQAAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +N NFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNANFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRI N ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIHNPDSL  204



>ref|XP_009359754.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=837

 Score =   321 bits (822),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+AHRNEIL  +S+IE  GKG L+PHQLLAEFE I + ++ 
Sbjct  1     MAERVLTRVQSLRERLDETLSAHRNEILALLSRIEKKGKGFLQPHQLLAEFEEIPETNRR  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK+TQE IVLPPWVALA+R RPGVWEY+RVNVHAL  EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRPGVWEYIRVNVHALVFEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGSANGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLK  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ +MLN++I + N L
Sbjct  181   FLRVHCYEGRNLMLNNKINDVNEL  204



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   320 bits (819),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAI+LPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIILPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVNGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNVFSL  204



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   320 bits (819),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER L RVHSLRERL  TL+AHRNE+L  +S+IE HGKGIL+PH LL E  AI + D++
Sbjct  1     MAERALARVHSLRERLGETLSAHRNELLHLLSRIEYHGKGILQPHHLLEELGAISEGDRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F  V++STQE IVLPPWVALA+R RPGVW+Y+RVNV+ALAVEELTV EYLQFKE
Sbjct  61    KLLDGVFGDVIRSTQEIIVLPPWVALAVRPRPGVWDYIRVNVNALAVEELTVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             +LV+G    NFVLELD EPF ASFPKPTL+KSIGNGVEFLNRHLSAK+FHDK+SL PLLD
Sbjct  121   DLVNGSPKDNFVLELDLEPFNASFPKPTLSKSIGNGVEFLNRHLSAKLFHDKDSLHPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+GKTMMLNDRIQN NTL
Sbjct  181   FLRVHHYRGKTMMLNDRIQNLNTL  204



>gb|AFY03626.1| sucrose synthase, partial [Eucalyptus globulus]
Length=796

 Score =   319 bits (818),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA R+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MAXRLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVBGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNXFSL  204



>dbj|BAM05651.1| sucrose synthase 3, partial [Eucalyptus pyrocarpa]
Length=795

 Score =   319 bits (817),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAE +LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MAESLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL +EEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVIEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNVFSL  204



>ref|XP_012077131.1| PREDICTED: sucrose synthase [Jatropha curcas]
 ref|XP_012077132.1| PREDICTED: sucrose synthase [Jatropha curcas]
 gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   319 bits (817),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL AHRNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSIRERLDETLKAHRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L D  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSNNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   319 bits (817),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1     MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQ KE
Sbjct  61    KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQLKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVD  +NGNFVLELDF+PF ASFP+PTL+KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDRSSNGNFVLELDFQPFNASFPRPTLSKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   319 bits (817),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1     MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEAIVLPPWVALA+R RPGVWEY+RVNVHALA+EEL V EYLQ KE
Sbjct  61    KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALALEELCVAEYLQLKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVD  +NGNFVLELDF+PF ASFP+PTL+KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDRSSNGNFVLELDFQPFNASFPRPTLSKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>gb|ABF50715.1| sucrose synthase [Viscum album subsp. album]
Length=810

 Score =   319 bits (817),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
              MA+R LTRV+SLRERLD TL  HRNEIL  +S+IE++GKGIL+ H +++E EA+ K D 
Sbjct  22    GMADRALTRVYSLRERLDETLADHRNEILALLSRIENNGKGILQHHHIVSELEALPKADM  81

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
              KL D AF  V++S QEAIV  PWVALA+R RPGVW+Y+RVNV+ALAVEEL V EYL FK
Sbjct  82    LKLTDGAFGDVIRSAQEAIVFSPWVALAVRPRPGVWDYIRVNVNALAVEELKVAEYLHFK  141

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG ANGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAKMFHDK+S+ PLL
Sbjct  142   EELVDGSANGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKDSMHPLL  201

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             DFLR H+YKGK+MMLNDRIQN N L
Sbjct  202   DFLRAHEYKGKSMMLNDRIQNLNYL  226



>gb|AGV22112.1| sucrose synthase 2 [Betula luminifera]
Length=807

 Score =   318 bits (816),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGIL+ H L+AE EAI +   +
Sbjct  1     MAERVLTRVHSLRERLDDTLAANRNEIVALLSRIVGKGKGILQHHHLIAEVEAIPEATSK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLEGAFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSTNGNFVLELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH YKGK MMLNDRIQN N L
Sbjct  181   FLRVHCYKGKNMMLNDRIQNVNAL  204



>gb|AES92143.2| sucrose synthase [Medicago truncatula]
Length=750

 Score =   317 bits (812),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1     MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   317 bits (813),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSQNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   318 bits (815),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1     MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEA+VLPPWVA A+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWEYIRVNVHALVLEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIG GVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFHASFPRPTLSKSIGKGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   318 bits (815),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1     MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEA+VLPPWVA A+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWEYIRVNVHALVLEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIG GVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFHASFPRPTLSKSIGKGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L D  F +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSQNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M ER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1     MPERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL++ AF ++L+S+QEAIVLPPW+ALA+R RPGVWEY+RVN+HAL VEEL V E+L FKE
Sbjct  61    KLSEGAFGEILRSSQEAIVLPPWIALAVRPRPGVWEYIRVNIHALVVEELQVTEFLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G  NGNFVLELDFEPFTA FP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVNGNLNGNFVLELDFEPFTAQFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNTRIQNVFSL  204



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+RV+TRVHSLRERLD TL A RNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1     MADRVITRVHSLRERLDETLLADRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VLK++QEAIVLPP VALA+R RPGVWEY+RVNVHAL VEELTV EYL FKE
Sbjct  61    KLANGAFFEVLKASQEAIVLPPCVALAVRPRPGVWEYIRVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF +SFP+PTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNSSFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH +KGK MMLNDRIQN N L
Sbjct  181   FLRVHCHKGKNMMLNDRIQNLNAL  204



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1     MAERALTRVQSLRERLDETLFTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLK TQEA+VLPPWVA A+R RPGVWEY+RVNVHAL +EEL V EYLQFKE
Sbjct  61    KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRPGVWEYIRVNVHALVLEELRVAEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDF+PF ASFP+PTL+KSIG GVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFQPFHASFPRPTLSKSIGKGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH Y+G+ MMLN+RI+N N L
Sbjct  181   FLRVHCYEGRNMMLNNRIKNVNEL  204



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   317 bits (813),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1     MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   317 bits (813),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVL RVHSLRERL  TL A RNE+L+ +S+IE HGKGI++PH LL E E I + D++
Sbjct  1     MAERVLARVHSLRERLGETLAAQRNELLILLSRIEGHGKGIMQPHHLLEELEKIPEGDRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F  V++STQEAIVLPPWVALA+R RPGVW+Y+RVN++AL VEELT  +YLQFKE
Sbjct  61    KLVDGVFGDVIRSTQEAIVLPPWVALAVRPRPGVWDYIRVNINALVVEELTESQYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +  NFVLELD EPFTASFPKPTL+K IGNGVEFLNRHLSAKMFHDK+SL PLLD
Sbjct  121   ELVNGSSKENFVLELDLEPFTASFPKPTLSKFIGNGVEFLNRHLSAKMFHDKDSLHPLLD  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR HQYKGKTMMLNDRIQN +TL
Sbjct  181   FLRAHQYKGKTMMLNDRIQNLDTL  204



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   317 bits (813),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEESRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVHFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKGKTLMLNDRIQNPDSL  204



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   317 bits (812),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS+RERLD TL A+RNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSIRERLDETLKAYRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L D  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSNNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLNSL  204



>ref|XP_010049327.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
 ref|XP_010049328.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
Length=805

 Score =   317 bits (811),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1     MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61    KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             EL DG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELADGSLNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNARIQNVFSL  204



>gb|KCW81848.1| hypothetical protein EUGRSUZ_C03199 [Eucalyptus grandis]
Length=820

 Score =   317 bits (812),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1     MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61    KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             EL DG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELADGSLNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNARIQNVFSL  204



>ref|NP_001289661.1| sucrose synthase-like [Eucalyptus grandis]
 gb|ABB53601.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   317 bits (811),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1     MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VLKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKE
Sbjct  61    KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             EL DG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELADGSLNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH YKGK MM+N RIQN  +L
Sbjct  181   FLQVHCYKGKNMMVNARIQNVFSL  204



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   316 bits (809),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL   EYL FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEELQPAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF A+FP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNAAFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H  KGKT+MLNDRIQN + L
Sbjct  181   FLRLHSVKGKTLMLNDRIQNPDAL  204



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score =   317 bits (813),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
             +MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ +
Sbjct  88    SMATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSR  147

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             +KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FK
Sbjct  148   QKLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFK  207

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL
Sbjct  208   EELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLL  267

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             +FLR+H YKGKT+MLNDRIQN ++L
Sbjct  268   EFLRLHSYKGKTLMLNDRIQNPDSL  292



>gb|ACR08725.1| sucrose synthase, partial [Vigna luteola]
Length=221

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +2

Query  671   LRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQVL  850
             LRERLD TL+A RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++KL D AF +VL
Sbjct  1     LRERLDETLSASRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQKLTDGAFGEVL  60

Query  851   KSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDGPANGNF  1030
             +STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL FKEELVDG +NGNF
Sbjct  61    RSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLHFKEELVDGSSNGNF  120

Query  1031  VLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVHQYKGKT  1210
             VLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+FLR+H   GKT
Sbjct  121   VLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLEFLRLHSVNGKT  180

Query  1211  MMLNDRIQNANTL  1249
             +MLNDRIQN + L
Sbjct  181   LMLNDRIQNPDAL  193



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   315 bits (808),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +2

Query  647   RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  826
             R L R HSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL+ EFEAI +  ++ L 
Sbjct  5     RALNRAHSLRERLDDTLSAHRNEILAFLSRIEAKGKGFLQPHQLIDEFEAIPEASRKNLL  64

Query  827   DHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELV  1006
             +  F +VLK+TQEAIVLPPWVALA+R RPGVWEY+RVNVH+L  EEL VPEYL FKEELV
Sbjct  65    ESEFGEVLKNTQEAIVLPPWVALAVRPRPGVWEYIRVNVHSLVAEELLVPEYLHFKEELV  124

Query  1007  DGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLR  1186
             DG  NGNFVLELDFEPF A+FPKPTL+KSIGNGVEFLNRHLSAK+FHDKES+ PLL+FLR
Sbjct  125   DGSLNGNFVLELDFEPFNATFPKPTLSKSIGNGVEFLNRHLSAKLFHDKESMHPLLEFLR  184

Query  1187  VHQYKGKTMMLNDRIQNANTL  1249
             VH YKGK MMLN +IQN N L
Sbjct  185   VHCYKGKNMMLNGKIQNVNAL  205



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H  KGKT+MLNDRIQN + L
Sbjct  181   FLRLHSVKGKTLMLNDRIQNPDAL  204



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   315 bits (807),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H  KGKT+MLNDRIQN + L
Sbjct  181   FLRLHSVKGKTLMLNDRIQNPDAL  204



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   315 bits (807),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL +  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLDSL  204



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   315 bits (806),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL +  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLDSL  204



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   315 bits (806),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL +  F +VL+S QEAIVLPPWVALA+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLESVFGEVLRSAQEAIVLPPWVALAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSVNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIHNLDSL  204



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   315 bits (806),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLKVNVHALVVEELQPAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF A+FP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNAAFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H  KGKT+MLNDRIQN + L
Sbjct  181   FLRLHSVKGKTLMLNDRIQNPDAL  204



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   315 bits (806),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY++VNVHAL VEEL   EYL FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLKVNVHALVVEELQPAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF A+FP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFNAAFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H  KGKT+MLNDRIQN + L
Sbjct  181   FLRLHSVKGKTLMLNDRIQNPDAL  204



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   315 bits (806),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = +2

Query  647   RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  826
             R LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ H+++AEFE I +E ++KL 
Sbjct  3     RRLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHRVIAEFEEIPEESRQKLT  62

Query  827   DHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELV  1006
             D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKEELV
Sbjct  63    DGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKEELV  122

Query  1007  DGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLR  1186
             DG ANGNFVLELDFEPFTASFP+PTL KSIGNGV FLNRHLSAK+FHDKESL PLL+FLR
Sbjct  123   DGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVHFLNRHLSAKLFHDKESLHPLLEFLR  182

Query  1187  VHQYKGKTMMLNDRIQNANTL  1249
             +H YKGKT+MLNDRIQN ++L
Sbjct  183   LHSYKGKTLMLNDRIQNPDSL  203



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   314 bits (805),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS RERLD TL A RNE+L  +S++E+ GKGIL+ HQ++AEFE++ +E Q+
Sbjct  1     MAERVITRVHSQRERLDETLAAQRNEVLALLSRVEAKGKGILQHHQIIAEFESLPEETQK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL   AF +VL+STQEAIVLPPWVALAIR RPGVWEY+RVN+HAL VEEL V EYL FKE
Sbjct  61    KLEGGAFFEVLRSTQEAIVLPPWVALAIRPRPGVWEYIRVNLHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNF LELDFEPF ASFP+PTL+K IG+GVEFLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFALELDFEPFNASFPRPTLSKYIGDGVEFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH  KGK +MLNDRIQ  +TL
Sbjct  181   FLRVHGRKGKNLMLNDRIQTPSTL  204



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   313 bits (803),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 3/204 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA R LTRV SL+ERLD TL+A RNEI+ F+S+I SHGKGIL+PHQLL+E EA+   D++
Sbjct  1     MAAR-LTRVPSLKERLDETLSAQRNEIISFLSRIVSHGKGILQPHQLLSELEAVS--DKQ  57

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +V + TQE IVLPPW+ LA+R RPGVWEY+RVNV ALAVEELT  E+L  KE
Sbjct  58    KLYDGPFGEVFRHTQEVIVLPPWITLAVRPRPGVWEYIRVNVDALAVEELTPSEFLHVKE  117

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  118   ELVDGSVNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKESMKPLLD  177

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLNDRIQN +TL
Sbjct  178   FLRMHHYKGKTMMLNDRIQNLDTL  201



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   313 bits (803),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1     MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPG+WEY+RVNVHAL VE L   E+L+FKE
Sbjct  61    KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRPGIWEYLRVNVHALVVENLQPAEFLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG ANGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSANGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YK KT+MLNDRIQN ++L
Sbjct  181   FLRLHSYKVKTLMLNDRIQNPDSL  204



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   312 bits (800),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 175/204 (86%), Gaps = 3/204 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA R LTRV SL+ERLD TLTA RNEI+ F+SKI SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1     MASR-LTRVPSLKERLDETLTAQRNEIISFLSKIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+ TQE IVLPPW+ LA+R RPG+WEY+RVNV ALAVEELT  ++L  KE
Sbjct  58    KLADGPFGEVLRHTQETIVLPPWITLAVRPRPGIWEYIRVNVDALAVEELTPSQFLHVKE  117

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  118   ELVDGSTNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKESMRPLLD  177

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  178   FLRMHHYKGKTIMLNDRIQNLDSL  201



>dbj|BAE99649.1| sucrose synthase like protein [Arabidopsis thaliana]
Length=395

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
             A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2     ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             +KL   AF + L+S QEAIVLPP+VALA+R RPGVWEYVRVN+H L VEEL   EYLQFK
Sbjct  62    KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRPGVWEYVRVNLHDLVVEELQASEYLQFK  121

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG  NGNF LELDFEPF A+FP+PTL K IG+GVEFLNRHLSAK+FHDKESL PLL
Sbjct  122   EELVDGIKNGNFTLELDFEPFNAAFPRPTLNKYIGDGVEFLNRHLSAKLFHDKESLHPLL  181

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
              FLR+H ++GKT+MLN+RIQN NTL
Sbjct  182   KFLRLHSHEGKTLMLNNRIQNLNTL  206



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   310 bits (795),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1     MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61    KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H   GKT+MLNDRIQN + L
Sbjct  181   FLRLHSVNGKTLMLNDRIQNPDAL  204



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   310 bits (794),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 174/204 (85%), Gaps = 3/204 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA R LTRV SL+ERLD TLTA RNEI+ F+ +I SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1     MASR-LTRVPSLKERLDETLTAQRNEIISFLKRIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+ TQE IVLPPW+ LA+R RPGVWEY+RVNV ALAVEELT  ++L  KE
Sbjct  58    KLADGPFGEVLRHTQETIVLPPWITLAVRPRPGVWEYIRVNVDALAVEELTPSQFLHVKE  117

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAKMFHDKES+ PLLD
Sbjct  118   ELVDGSTNGNFVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKESMRPLLD  177

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKT+MLNDRIQN ++L
Sbjct  178   FLRMHHYKGKTIMLNDRIQNLDSL  201



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   310 bits (793),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1     MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNVHAL VE L   EYL+FKE
Sbjct  61    KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRPGVWEYLRVNVHALVVEVLQPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPFTASFP+PTL KSIGNGV+FLNRHLSAK+FHDKESL PLL+
Sbjct  121   ELVDGSSNGNFVLELDFEPFTASFPRPTLNKSIGNGVQFLNRHLSAKLFHDKESLHPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H   GKT+MLNDRIQN + L
Sbjct  181   FLRLHSVNGKTLMLNDRIQNPDAL  204



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   309 bits (792),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   309 bits (792),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   309 bits (792),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|AAA63685.1| sucrose synthase, partial [Solanum tuberosum]
Length=158

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1     MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KLN+HAF+++LKSTQEAIVLPPWVALAIRLRPGVWEY+RVNV+AL VEEL+VPEYLQFKE
Sbjct  61    KLNEHAFEELLKSTQEAIVLPPWVALAIRLRPGVWEYIRVNVNALVVEELSVPEYLQFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVE  1111
             ELVDG +NGNFVLELDFEPFTASFPKPTLTKSIGNGVE
Sbjct  121   ELVDGASNGNFVLELDFEPFTASFPKPTLTKSIGNGVE  158



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   309 bits (792),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 180/231 (78%), Gaps = 27/231 (12%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1     MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF ++L+++QEAIVLPPWVALA+R RPGVWEY++VNVHAL VEELTV EYL FKE
Sbjct  61    KLADGAFSEILRASQEAIVLPPWVALAVRPRPGVWEYIKVNVHALVVEELTVAEYLHFKE  120

Query  998   ELVDG---------------------------PANGNFVLELDFEPFTASFPKPTLTKSI  1096
             ELVDG                            ANGNFVLELDFEPF ASFP+ TL+KSI
Sbjct  121   ELVDGRYLENCSFSVYFTRKCSFYHCFFDFSCSANGNFVLELDFEPFNASFPRSTLSKSI  180

Query  1097  GNGVEFLNRHLSAKMFHDKESLTPLLDFLRVHQYKGKTMMLNDRIQNANTL  1249
             GNGVEFLNRHLSAK+FHDKES+ PLL+FL+VH +KGK MMLNDRIQN N+L
Sbjct  181   GNGVEFLNRHLSAKLFHDKESMHPLLEFLKVHCHKGKNMMLNDRIQNLNSL  231



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (789),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQMVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (789),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (789),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (789),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   308 bits (788),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTR+HS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRIHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   308 bits (788),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
             AMAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ +
Sbjct  7     AMAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTR  66

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             + L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL  EEL V EYL FK
Sbjct  67    KTLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVAEELRVAEYLHFK  126

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL
Sbjct  127   EELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLL  186

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
              FL+VH +KGK MMLNDRI+N ++L
Sbjct  187   AFLKVHCHKGKNMMLNDRIRNLDSL  211



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   307 bits (786),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   307 bits (786),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   307 bits (786),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   306 bits (783),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL  EEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVAEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   306 bits (783),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   305 bits (782),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   305 bits (782),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score =   305 bits (782),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 173/205 (84%), Gaps = 4/205 (2%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA R LTRV SL+ERLD TLTA RNEIL F+S+I SHGKGIL+PH+LL+EFEA+   D+ 
Sbjct  1     MAGR-LTRVPSLKERLDETLTAQRNEILSFLSRIVSHGKGILQPHELLSEFEAVS--DKH  57

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +V + TQEAIVLPPW+ LA+R RPGVWEY+RVNV  LAVEELT  ++L  KE
Sbjct  58    KLADGPFGEVFRHTQEAIVLPPWITLAVRPRPGVWEYIRVNVDELAVEELTPSQFLHVKE  117

Query  998   ELVDGPANGNFVL-ELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             ELVDG  NGNFVL ELDFEPF ASFP+PTL+KSIGNGVEFLNRHLSAKMFHDKES+ PLL
Sbjct  118   ELVDGSVNGNFVLDELDFEPFNASFPRPTLSKSIGNGVEFLNRHLSAKMFHDKESMRPLL  177

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             DFLR+H YKGKTMMLNDRIQN ++L
Sbjct  178   DFLRMHHYKGKTMMLNDRIQNLDSL  202



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+S QEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL VH +KGK MMLNDRI+N ++L
Sbjct  181   FLEVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+S QEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL VH +KGK MMLNDRI+N ++L
Sbjct  181   FLEVHCHKGKNMMLNDRIRNLDSL  204



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M ER LTRVHS+RE +D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI +++++
Sbjct  1     MTERALTRVHSIREHVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDNRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDF+PF ASFP+PTL+K IGNGVEFLNRHLSAK FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFDPFNASFPRPTLSKDIGNGVEFLNRHLSAKWFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRIQN ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIQNLDSL  204



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   305 bits (781),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+S QEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSAQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NG FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   305 bits (780),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +2

Query  650   VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  829
             VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3     VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  830   HAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVD  1009
              AF +VL+STQEAIVLPPWVALA+R RPGVWEY+RVNV AL VEEL V EYL FKEELVD
Sbjct  63    GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYIRVNVQALVVEELRVAEYLHFKEELVD  122

Query  1010  GPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRV  1189
             G +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+V
Sbjct  123   GGSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKV  182

Query  1190  HQYKGKTMMLNDRIQNANTL  1249
             H +KGK MMLNDRIQN ++L
Sbjct  183   HCHKGKNMMLNDRIQNLDSL  202



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   305 bits (780),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
             A AERV+TRVHS RERLDATL A +NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2     ANAERVITRVHSQRERLDATLIAQKNEVLALLSRVEAKGKGILQYHQIIAEFEAMPLETQ  61

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             +KL   AF ++L+S QEAIVLPP+VALA+R RPGVWEYVRVN+H L V+EL   EYLQFK
Sbjct  62    KKLQGGAFFEILRSAQEAIVLPPFVALAVRPRPGVWEYVRVNLHDLVVDELQASEYLQFK  121

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG  NGNF LELDFEPF A+FP+PTL K IGNGVEFLNRHLSAK+FHDKESL PLL
Sbjct  122   EELVDGIRNGNFTLELDFEPFNAAFPRPTLNKYIGNGVEFLNRHLSAKLFHDKESLHPLL  181

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
              FLR+H ++GKT+MLNDRIQN NTL
Sbjct  182   KFLRLHSHEGKTLMLNDRIQNLNTL  206



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   305 bits (780),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS RERLD TL+A RNE+L  +S++E+ GKGIL+ HQ++AEFEA+ +E ++
Sbjct  1     MAERVITRVHSQRERLDGTLSAQRNEVLSLLSRVEAKGKGILQHHQIIAEFEALPEETRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL   AF ++L+S+QEAIVLPPWVALAIR RPGVWEY+RVN+HAL VEEL V EYL  KE
Sbjct  61    KLEGSAFFEILRSSQEAIVLPPWVALAIRPRPGVWEYIRVNLHALVVEELLVSEYLHLKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G  NG+F LELDFEPF ASFP+PTL+K IG+GVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVNGSVNGSFPLELDFEPFNASFPRPTLSKYIGDGVEFLNRHLSAKLFHDKESLHPLLQ  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLRVH  KGK +MLNDRIQN  TL
Sbjct  181   FLRVHCRKGKNLMLNDRIQNLKTL  204



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   304 bits (779),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ+LAEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQILAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   304 bits (779),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKTLAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   304 bits (778),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   304 bits (778),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PPW+ALA+R RPGVWEY+R+NV AL VEEL V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPWIALALRPRPGVWEYIRLNVQALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG +NGNFVLELDFEPF AS P+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGSNGNFVLELDFEPFNASLPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   304 bits (778),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (777),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   303 bits (777),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 175/208 (84%), Gaps = 4/208 (2%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAERV+TRVHS RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1     MAERVITRVHSFRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+S QEAIVLPP VA A+R RPGVWEY+RVNVHAL VEEL V EYL FKE
Sbjct  61    KLLDSVFGEVLRSAQEAIVLPPCVAFAVRPRPGVWEYIRVNVHALVVEELRVAEYLHFKE  120

Query  998   ELVDGPANGN----FVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLT  1165
             ELV+G  NGN    FVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL 
Sbjct  121   ELVNGSVNGNVNGKFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLH  180

Query  1166  PLLDFLRVHQYKGKTMMLNDRIQNANTL  1249
             PLL+FL+VH +KGK+MMLNDRI + ++L
Sbjct  181   PLLEFLKVHCHKGKSMMLNDRIHSLDSL  208



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (776),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (776),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (776),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVRALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (776),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  ++++E  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRVEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (776),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  G+GIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGRGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   303 bits (776),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +2

Query  650   VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  829
             VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3     VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  830   HAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVD  1009
              AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVD
Sbjct  63    GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVD  122

Query  1010  GPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRV  1189
             G +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+V
Sbjct  123   GGSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKV  182

Query  1190  HQYKGKTMMLNDRIQNANTL  1249
             H +KGK MMLNDRI N ++L
Sbjct  183   HCHKGKNMMLNDRIHNLDSL  202



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   303 bits (775),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +2

Query  650   VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  829
             VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3     VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  830   HAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVD  1009
              AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVD
Sbjct  63    GAFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVD  122

Query  1010  GPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRV  1189
             G +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+V
Sbjct  123   GGSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKV  182

Query  1190  HQYKGKTMMLNDRIQNANTL  1249
             H +KGK MMLNDRI N ++L
Sbjct  183   HCHKGKNMMLNDRIHNLDSL  202



>ref|XP_004488141.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004488142.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
 ref|XP_004488143.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
 ref|XP_004488144.1| PREDICTED: sucrose synthase-like isoform X4 [Cicer arietinum]
 ref|XP_004488145.1| PREDICTED: sucrose synthase-like isoform X5 [Cicer arietinum]
Length=824

 Score =   303 bits (776),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M    LTR HS+R+R D  LT HRNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MGSDRLTRSHSIRQRFDEILTGHRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VL+STQEAIVLPP+VALA+R RPGVWEY+RV+VH L V+EL+  EYL+FKE
Sbjct  61    KLVNGAFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVDVHGLVVDELSAAEYLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FH KESL PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHGKESLQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H Y GKTMM+NDRIQN N+L
Sbjct  181   FLRLHNYNGKTMMVNDRIQNLNSL  204



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   303 bits (775),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E  + L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIGKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
               KGK MMLNDRIQN ++L
Sbjct  184   CRKGKNMMLNDRIQNLDSL  202



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PP +ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPRIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>ref|XP_004488146.1| PREDICTED: sucrose synthase-like isoform X6 [Cicer arietinum]
Length=806

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             M    LTR HS+R+R D  LT HRNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1     MGSDRLTRSHSIRQRFDEILTGHRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL + AF +VL+STQEAIVLPP+VALA+R RPGVWEY+RV+VH L V+EL+  EYL+FKE
Sbjct  61    KLVNGAFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVDVHGLVVDELSAAEYLKFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FH KESL PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHGKESLQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H Y GKTMM+NDRIQN N+L
Sbjct  181   FLRLHNYNGKTMMVNDRIQNLNSL  204



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1     MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
              L   AF +VL+STQEAIV+PP +ALA+R RPGVWEY+R+NV AL VE+L V EYL FKE
Sbjct  61    TLAGGAFAEVLRSTQEAIVVPPRIALALRPRPGVWEYIRLNVQALVVEDLRVAEYLHFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELVDG  NGNFVLELDFEPF ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL 
Sbjct  121   ELVDGGCNGNFVLELDFEPFNASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLA  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FL+VH +KGK MMLNDRI+N ++L
Sbjct  181   FLKVHCHKGKNMMLNDRIRNLDSL  204



>ref|XP_010939862.1| PREDICTED: sucrose synthase 1 [Elaeis guineensis]
Length=815

 Score =   302 bits (774),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 1/205 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  814
             MA   L+RVHS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1     MASPALSRVHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVW+YVRVNV  LAVEELTVPEYLQFK
Sbjct  61    EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWQYVRVNVSELAVEELTVPEYLQFK  120

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG +  NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ PLL
Sbjct  121   EELVDGSSQSNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLL  180

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             +FLR H YKG +MMLNDRIQ+ + L
Sbjct  181   NFLRAHNYKGASMMLNDRIQSLSAL  205



>dbj|BAM05645.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05646.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05647.1| sucrose synthase 1, partial [Eucalyptus pyrocarpa]
Length=786

 Score =   301 bits (772),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +2

Query  668   SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  847
             SLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1     SLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  848   LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDGPANGN  1027
             LKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKEEL DG  NGN
Sbjct  61    LKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGN  120

Query  1028  FVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVHQYKGK  1207
             FVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+FL+VH YKGK
Sbjct  121   FVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLEFLQVHCYKGK  180

Query  1208  TMMLNDRIQNANTL  1249
              MM+N RIQN  +L
Sbjct  181   NMMVNTRIQNVFSL  194



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   302 bits (773),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
             A AERVLTRVHS RERLD TL AH+NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2     ANAERVLTRVHSQRERLDETLVAHKNEVLALLSRVEAKGKGILQHHQIIAEFEAMPVEAQ  61

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             +KL   AF ++L+STQEAIVLPP VALA+R RPGVWEY+RVNVH L +EEL   EYL FK
Sbjct  62    KKLQGGAFFEILRSTQEAIVLPPLVALAVRPRPGVWEYIRVNVHDLVIEELQASEYLHFK  121

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             E+LV+G  NG+F LELDFEPF A+FP+PTL K IGNGVEFLNRHLSAK+FHDKESL PLL
Sbjct  122   EDLVNGIKNGSFTLELDFEPFNAAFPRPTLNKYIGNGVEFLNRHLSAKLFHDKESLHPLL  181

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
              FLR+H ++GKT+MLNDRIQN NTL
Sbjct  182   KFLRLHSHEGKTLMLNDRIQNLNTL  206



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   301 bits (772),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK M+LNDRIQN ++L
Sbjct  184   CHKGKNMVLNDRIQNLDSL  202



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   301 bits (772),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+V+
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVY  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   301 bits (771),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELV+G
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVNG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   301 bits (771),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             A  +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    ALSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   301 bits (771),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+STQEAIVLPP+VALA+R RPGVWEY+RVNVH L V+EL   EYL+FKE
Sbjct  61    KLQDGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVNVHMLVVDELRPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHDKESMQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLND++Q+ ++L
Sbjct  181   FLRLHSYKGKTMMLNDKVQSLDSL  204



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   301 bits (771),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D  F +VL+STQEAIVLPP+VALA+R RPGVWEY+RVNVH L V+EL   EYL+FKE
Sbjct  61    KLQDGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVNVHMLVVDELRPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHDKESMQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLND++Q+ ++L
Sbjct  181   FLRLHSYKGKTMMLNDKVQSLDSL  204



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   301 bits (771),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDF PF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFGPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   301 bits (770),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGV FLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVGFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   300 bits (769),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FK ELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKVELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   300 bits (769),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERL  TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLGETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVTEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   300 bits (769),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA+R RPGVWEYVRVNV AL VEEL V EYL FKEE VDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAVRPRPGVWEYVRVNVQALVVEELRVAEYLHFKEEPVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+FHDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLFHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN ++L
Sbjct  184   CHKGKNMMLNDRIQNLDSL  202



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   300 bits (768),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  814
             A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2     ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             +KL   AF + L+S QEAIVLPP+VALA+R RPGVWEYVRVN+H L VEEL   EYLQFK
Sbjct  62    KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRPGVWEYVRVNLHDLVVEELQASEYLQFK  121

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG  NGNF LELDFEPF A+FP+PTL K IG+GVEFLNRHLSAK+FHDKESL PLL
Sbjct  122   EELVDGIKNGNFTLELDFEPFNAAFPRPTLNKYIGDGVEFLNRHLSAKLFHDKESLHPLL  181

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
              FLR+H ++GKT+MLN+RIQN NTL
Sbjct  182   KFLRLHSHEGKTLMLNNRIQNLNTL  206



>sp|Q41607.1|SUS2_TULGE RecName: Full=Sucrose synthase 2; AltName: Full=Sucrose-UDP glucosyltransferase 
2 [Tulipa gesneriana]
 emb|CAA65640.1| sucrose-synthase 21 [Tulipa gesneriana]
Length=820

 Score =   300 bits (769),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 1/205 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAIC-KEDQ  814
             MA+R +TRVHS+RERL  TL+AH+NE+L   S+    G+G+L+PHQLL E+EA+    D+
Sbjct  1     MADRAMTRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIPAADR  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D  F+ VLK+ QEAIV+PPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFK
Sbjct  61    EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFK  120

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG    NF LELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ PLL
Sbjct  121   EELVDGSGQSNFTLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLL  180

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             +FL+ H Y G +MMLNDRIQ    L
Sbjct  181   NFLKEHHYNGTSMMLNDRIQTLGAL  205



>dbj|BAM05648.1| sucrose synthase 1, partial [Eucalyptus globulus subsp. globulus]
Length=786

 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +2

Query  668   SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  847
             SLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1     SLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  848   LKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDGPANGN  1027
             LKSTQEAIV PPWVALA+R RPGVWE++RVNVHAL +E+L V EYL FKEEL DG  NGN
Sbjct  61    LKSTQEAIVSPPWVALAVRPRPGVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGN  120

Query  1028  FVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVHQYKGK  1207
             FVLELDFEPFTASFP+PTL+KSIGNGVEFLNRHLSAK+FHDKESL PLL+FL+VH YKGK
Sbjct  121   FVLELDFEPFTASFPRPTLSKSIGNGVEFLNRHLSAKLFHDKESLHPLLEFLQVHCYKGK  180

Query  1208  TMMLNDRIQNANTL  1249
              MM+N RIQN  +L
Sbjct  181   NMMVNARIQNVFSL  194



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   299 bits (766),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LT  HS RER+D TL+ +RNEIL  +S++E  GKGIL+ HQ++AE E I +E ++
Sbjct  1     MAHHPLTHSHSFRERIDETLSGNRNEILALLSRLEGKGKGILQHHQIIAELEEIPEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPP+VALA+R RPGVWEY+RVN H LAV+EL   EYL+FKE
Sbjct  61    KLQDGAFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVNAHVLAVDELRPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHDKESMQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKG TMMLND++QN N+L
Sbjct  181   FLRLHSYKGTTMMLNDKVQNLNSL  204



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   298 bits (764),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL    F +VL+STQEAIVLPP+VALA+R RPGVWEY+RVNVH L V+EL   EYL+FKE
Sbjct  61    KLQGGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVNVHMLVVDELLPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHDKESMQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLND++Q+ ++L
Sbjct  181   FLRLHSYKGKTMMLNDKVQSLDSL  204



>ref|XP_010937277.1| PREDICTED: sucrose synthase 2-like [Elaeis guineensis]
Length=816

 Score =   298 bits (763),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  814
             MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1     MATPALSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEVDR  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFK
Sbjct  61    EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFK  120

Query  995   EELVDGPA-NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPL  1171
             EELVDG   N NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ PL
Sbjct  121   EELVDGSGHNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPL  180

Query  1172  LDFLRVHQYKGKTMMLNDRIQNANTL  1249
             L+FLR H YKG +MMLNDRI++ + L
Sbjct  181   LNFLRAHNYKGTSMMLNDRIRSLSAL  206



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1     MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL    F +VL+STQEAIVLPP+VALA+R RPGVWEY+RVNVH L V++L   EYL+FKE
Sbjct  61    KLQGGVFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVNVHMLVVDDLRPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHDKESMQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H YKGKTMMLND++Q+ ++L
Sbjct  181   FLRLHSYKGKTMMLNDKVQSLDSL  204



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  817
             MA   LT  HS RER+D TL+ +RNEIL  +S++E  GKGIL+ HQ++AE E I +E ++
Sbjct  1     MAHHPLTHSHSFRERIDETLSGNRNEILALLSRLEGKGKGILQHHQIIAELEEIPEEHRK  60

Query  818   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKE  997
             KL D AF +VL+STQEAIVLPP+VALA+R RPGVWEY+RVN H LAV+EL   EYL+FKE
Sbjct  61    KLQDGAFGEVLRSTQEAIVLPPFVALAVRPRPGVWEYLRVNAHVLAVDELRPAEYLRFKE  120

Query  998   ELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLD  1177
             ELV+G +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FHDKES+ PLL+
Sbjct  121   ELVEGSSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHDKESMQPLLE  180

Query  1178  FLRVHQYKGKTMMLNDRIQNANTL  1249
             FLR+H Y+G TMMLND++QN N+L
Sbjct  181   FLRLHSYQGTTMMLNDKVQNLNSL  204



>ref|XP_008783098.1| PREDICTED: sucrose synthase 1 [Phoenix dactylifera]
Length=816

 Score =   296 bits (758),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  814
             MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1     MATPPLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEGDR  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVWEYVRVNV  LAVEELTVPEYLQFK
Sbjct  61    EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFK  120

Query  995   EELVDGPA-NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPL  1171
             EELVDG + N NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ P+
Sbjct  121   EELVDGSSQNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPV  180

Query  1172  LDFLRVHQYKGKTMMLNDRIQNANTL  1249
             L+FLR H YKG +MMLNDRI + + L
Sbjct  181   LNFLRAHNYKGTSMMLNDRIHSLSAL  206



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   295 bits (756),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4     LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEAIVLPPWVALA R RPGVWEYVRVNV AL VEEL V EYL FKEELVDG
Sbjct  64    AFSEVLRSTQEAIVLPPWVALAERPRPGVWEYVRVNVQALVVEELRVAEYLHFKEELVDG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF+ASFP+PTL+K IGNGVEFLNRHLSAK+ HDKESL PLL FL+VH
Sbjct  124   GSNGNFVLELDFEPFSASFPRPTLSKYIGNGVEFLNRHLSAKLPHDKESLHPLLAFLKVH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              +KGK MMLNDRIQN  +L
Sbjct  184   CHKGKNMMLNDRIQNLYSL  202



>gb|KEH37657.1| sucrose synthase [Medicago truncatula]
Length=804

 Score =   295 bits (754),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +2

Query  653   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  832
             LTR  SLRER D +LTAHR EIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++KL + 
Sbjct  4     LTRSTSLRERFDESLTAHRIEILALLSRIEAKGKGILQHHQVIAEFEEIPEEKRQKLVNG  63

Query  833   AFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFKEELVDG  1012
             AF +VL+STQEA+VLPP+VALA+R RPGVWEY+RV+VH+L V+EL   EYL+FKEELV+G
Sbjct  64    AFGEVLRSTQEAVVLPPFVALAVRPRPGVWEYLRVDVHSLVVDELRAAEYLKFKEELVEG  123

Query  1013  PANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLLDFLRVH  1192
              +NGNFVLELDFEPF ASFP+PTL KSIGNGVEFLNRHLSAK+FH KESL PLL+FLR+H
Sbjct  124   SSNGNFVLELDFEPFNASFPRPTLNKSIGNGVEFLNRHLSAKLFHGKESLKPLLEFLRLH  183

Query  1193  QYKGKTMMLNDRIQNANTL  1249
              Y GKTMM+NDRIQN ++L
Sbjct  184   NYNGKTMMVNDRIQNLDSL  202



>ref|XP_008800466.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
 ref|XP_008800467.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
Length=815

 Score =   295 bits (754),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 168/205 (82%), Gaps = 1/205 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  814
             MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1     MASPTLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D  F+ VLK+ QEAIVLPPWVALAIR RPGVW+YVRVNV  LAVEELTVP+YLQFK
Sbjct  61    EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRPGVWQYVRVNVSELAVEELTVPQYLQFK  120

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG +  NF LELD EPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ PLL
Sbjct  121   EELVDGSSQNNFALELDLEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPLL  180

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             +FLR H YKG +MMLNDRI + + L
Sbjct  181   NFLRAHNYKGTSMMLNDRIHSLSAL  205



>ref|XP_009390882.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=816

 Score =   292 bits (748),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 2/206 (1%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  814
             M++R LTR HS+RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A+  E D+
Sbjct  1     MSQRTLTRAHSVRERIGDSLSSHPNELVALFSRFVHQGKGMLQPHQLLAEYGAVFSEADR  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D AF+ V+++ QEAIV+PPWVALAIR RPGVWEYVRVN+  LAVEELTVPEYLQFK
Sbjct  61    EKLKDGAFEDVIQAAQEAIVIPPWVALAIRPRPGVWEYVRVNISELAVEELTVPEYLQFK  120

Query  995   EELVDGPA-NGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPL  1171
             EEL DG + N NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+F DKESL PL
Sbjct  121   EELADGSSQNSNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFQDKESLYPL  180

Query  1172  LDFLRVHQYKGKTMMLNDRIQNANTL  1249
             L+FLR H YKG +MMLNDRIQ+ + L
Sbjct  181   LNFLRKHNYKGMSMMLNDRIQSLSAL  206



>gb|AFW88072.1| sucrose synthase1 [Zea mays]
Length=544

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFE-AICKED  811
                +RVL+R+HS+RER+  +L+AH NE++   +++++ GKG+L+PHQ++AE+  AI + +
Sbjct  4     GAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLKNLGKGMLQPHQIIAEYNNAIPEAE  63

Query  812   QEKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQF  991
             +EKL D AF+ VL++ QEAIV+PPWVALAIR RPGVWEYVRVNV  LAVEEL VPEYLQF
Sbjct  64    REKLKDGAFEDVLRAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELRVPEYLQF  123

Query  992   KEELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPL  1171
             KE+LV+   N NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ PL
Sbjct  124   KEQLVEEGPNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPL  183

Query  1172  LDFLRVHQYKGKTMMLNDRIQNANTL  1249
             L+FLR H YKG TMMLNDRI++ + L
Sbjct  184   LNFLRAHNYKGMTMMLNDRIRSLSAL  209



>ref|XP_009390318.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=815

 Score =   292 bits (747),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 168/205 (82%), Gaps = 1/205 (0%)
 Frame = +2

Query  638   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  814
             M +R LTR HS+RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A   E D+
Sbjct  1     MPQRSLTRAHSVRERIGDSLSSHPNELVALFSRFIHQGKGMLQPHQLLAEYAAAFSEADK  60

Query  815   EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQFK  994
             EKL D AF+ V+K+ QEAIV+PPWVALAIR RPGVWEYVRVN+  LAVEELTVPEYL FK
Sbjct  61    EKLKDGAFEDVIKAAQEAIVIPPWVALAIRPRPGVWEYVRVNISELAVEELTVPEYLHFK  120

Query  995   EELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPLL  1174
             EELVDG +  NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+F DKESL PLL
Sbjct  121   EELVDGSSQNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFQDKESLYPLL  180

Query  1175  DFLRVHQYKGKTMMLNDRIQNANTL  1249
             +FLR H YKG +MMLNDRIQ+ + L
Sbjct  181   NFLRKHNYKGMSMMLNDRIQSLSAL  205



>gb|AFW88071.1| sucrose synthase1 [Zea mays]
Length=560

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 173/206 (84%), Gaps = 1/206 (0%)
 Frame = +2

Query  635   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFE-AICKED  811
                +RVL+R+HS+RER+  +L+AH NE++   +++++ GKG+L+PHQ++AE+  AI + +
Sbjct  4     GAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLKNLGKGMLQPHQIIAEYNNAIPEAE  63

Query  812   QEKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRPGVWEYVRVNVHALAVEELTVPEYLQF  991
             +EKL D AF+ VL++ QEAIV+PPWVALAIR RPGVWEYVRVNV  LAVEEL VPEYLQF
Sbjct  64    REKLKDGAFEDVLRAAQEAIVIPPWVALAIRPRPGVWEYVRVNVSELAVEELRVPEYLQF  123

Query  992   KEELVDGPANGNFVLELDFEPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDKESLTPL  1171
             KE+LV+   N NFVLELDFEPF ASFP+P+L+KSIGNGV+FLNRHLS+K+FHDKES+ PL
Sbjct  124   KEQLVEEGPNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESMYPL  183

Query  1172  LDFLRVHQYKGKTMMLNDRIQNANTL  1249
             L+FLR H YKG TMMLNDRI++ + L
Sbjct  184   LNFLRAHNYKGMTMMLNDRIRSLSAL  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3556168901736