BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4650

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782512.1|  PREDICTED: uncharacterized protein At1g51745       204   8e-58   Nicotiana sylvestris
ref|XP_009614718.1|  PREDICTED: uncharacterized protein At1g51745...    204   1e-57   Nicotiana tomentosiformis
ref|XP_007135591.1|  hypothetical protein PHAVU_010G142200g             197   5e-55   Phaseolus vulgaris [French bean]
ref|XP_008228331.1|  PREDICTED: uncharacterized protein At1g51745...    196   1e-54   Prunus mume [ume]
ref|XP_009614713.1|  PREDICTED: uncharacterized protein At1g51745...    194   7e-54   Nicotiana tomentosiformis
ref|XP_009367513.1|  PREDICTED: uncharacterized protein At1g51745...    193   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_008380818.1|  PREDICTED: uncharacterized protein At1g51745...    192   2e-53   
ref|XP_007024422.1|  Tudor/PWWP/MBT superfamily protein, putative...    191   7e-53   
ref|XP_006343014.1|  PREDICTED: uncharacterized protein At1g51745...    190   8e-53   Solanum tuberosum [potatoes]
ref|XP_004236393.1|  PREDICTED: uncharacterized protein At1g51745...    189   2e-52   Solanum lycopersicum
gb|KJB70320.1|  hypothetical protein B456_011G067800                    189   2e-52   Gossypium raimondii
ref|XP_011080298.1|  PREDICTED: uncharacterized protein At1g51745       189   2e-52   Sesamum indicum [beniseed]
gb|KHG19697.1|  hypothetical protein F383_24275                         189   3e-52   Gossypium arboreum [tree cotton]
gb|KHG23152.1|  hypothetical protein F383_01193                         187   1e-51   Gossypium arboreum [tree cotton]
ref|XP_008228332.1|  PREDICTED: uncharacterized protein At1g51745...    186   3e-51   Prunus mume [ume]
gb|KJB56861.1|  hypothetical protein B456_009G139300                    186   4e-51   Gossypium raimondii
ref|XP_010062582.1|  PREDICTED: uncharacterized protein At1g51745       186   5e-51   Eucalyptus grandis [rose gum]
emb|CDO97945.1|  unnamed protein product                                185   1e-50   Coffea canephora [robusta coffee]
ref|XP_004510340.1|  PREDICTED: uncharacterized protein At1g51745...    184   3e-50   
ref|XP_007217004.1|  hypothetical protein PRUPE_ppa002212mg             182   6e-50   
gb|KHN39281.1|  Hypothetical protein glysoja_018053                     181   4e-49   Glycine soja [wild soybean]
emb|CBI35983.3|  unnamed protein product                                168   6e-49   Vitis vinifera
gb|KHN11311.1|  Hypothetical protein glysoja_023375                     180   7e-49   Glycine soja [wild soybean]
ref|XP_003529739.1|  PREDICTED: uncharacterized protein At1g51745...    179   9e-49   Glycine max [soybeans]
ref|XP_011072468.1|  PREDICTED: uncharacterized protein At1g51745       179   9e-49   Sesamum indicum [beniseed]
ref|XP_008380820.1|  PREDICTED: uncharacterized protein At1g51745...    178   2e-48   
ref|XP_009367515.1|  PREDICTED: uncharacterized protein At1g51745...    177   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_010088115.1|  hypothetical protein L484_001821                   177   4e-48   Morus notabilis
ref|XP_006297135.1|  hypothetical protein CARUB_v10013137mg             173   1e-46   Capsella rubella
gb|KEH18280.1|  tudor/PWWP/MBT superfamily protein                      173   2e-46   Medicago truncatula
ref|XP_008462373.1|  PREDICTED: uncharacterized protein At1g51745...    173   2e-46   Cucumis melo [Oriental melon]
ref|XP_011659648.1|  PREDICTED: uncharacterized protein At1g51745       173   3e-46   Cucumis sativus [cucumbers]
ref|XP_010654562.1|  PREDICTED: uncharacterized protein At1g51745...    172   3e-46   Vitis vinifera
ref|XP_006406288.1|  hypothetical protein EUTSA_v10020246mg             172   3e-46   Eutrema salsugineum [saltwater cress]
ref|XP_012069023.1|  PREDICTED: uncharacterized protein At1g51745...    172   4e-46   
emb|CAN84040.1|  hypothetical protein VITISV_024170                     172   4e-46   Vitis vinifera
ref|XP_011013034.1|  PREDICTED: uncharacterized protein At1g51745...    172   4e-46   Populus euphratica
ref|XP_010545639.1|  PREDICTED: uncharacterized protein At1g51745...    171   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_010468342.1|  PREDICTED: uncharacterized protein At1g51745...    170   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010510070.1|  PREDICTED: uncharacterized protein At1g51745       170   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010488139.1|  PREDICTED: uncharacterized protein At1g51745...    169   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002515884.1|  conserved hypothetical protein                     169   7e-45   
emb|CDY56919.1|  BnaCnng31400D                                          167   2e-44   Brassica napus [oilseed rape]
ref|XP_011015418.1|  PREDICTED: uncharacterized protein At1g51745...    167   2e-44   Populus euphratica
ref|XP_011011986.1|  PREDICTED: uncharacterized protein At1g51745...    167   2e-44   Populus euphratica
ref|XP_009145492.1|  PREDICTED: uncharacterized protein At1g51745       166   4e-44   Brassica rapa
emb|CDY51454.1|  BnaA05g36710D                                          166   4e-44   Brassica napus [oilseed rape]
gb|EYU45844.1|  hypothetical protein MIMGU_mgv1a004135mg                164   1e-43   Erythranthe guttata [common monkey flower]
ref|XP_006853959.1|  PREDICTED: uncharacterized protein At1g51745       165   1e-43   Amborella trichopoda
gb|KFK39439.1|  hypothetical protein AALP_AA3G245000                    164   2e-43   Arabis alpina [alpine rockcress]
gb|EYU21406.1|  hypothetical protein MIMGU_mgv1a002564mg                163   3e-43   Erythranthe guttata [common monkey flower]
ref|XP_008447587.1|  PREDICTED: uncharacterized protein At1g51745...    163   5e-43   Cucumis melo [Oriental melon]
dbj|BAB01723.1|  unnamed protein product                                162   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078195.1|  uncharacterized protein                            162   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011463342.1|  PREDICTED: uncharacterized protein At1g51745...    160   6e-42   Fragaria vesca subsp. vesca
gb|KDO58664.1|  hypothetical protein CISIN_1g004313mg                   157   8e-42   Citrus sinensis [apfelsine]
gb|KDO58658.1|  hypothetical protein CISIN_1g004313mg                   157   8e-42   Citrus sinensis [apfelsine]
gb|KDO58663.1|  hypothetical protein CISIN_1g004313mg                   157   8e-42   Citrus sinensis [apfelsine]
gb|KDO58665.1|  hypothetical protein CISIN_1g004313mg                   157   9e-42   Citrus sinensis [apfelsine]
ref|XP_010267045.1|  PREDICTED: uncharacterized protein At1g51745...    160   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_011652363.1|  PREDICTED: uncharacterized protein At1g51745       158   3e-41   Cucumis sativus [cucumbers]
ref|XP_006466095.1|  PREDICTED: uncharacterized protein At1g51745...    157   6e-41   Citrus sinensis [apfelsine]
gb|KDO58661.1|  hypothetical protein CISIN_1g004313mg                   157   6e-41   Citrus sinensis [apfelsine]
ref|XP_006466094.1|  PREDICTED: uncharacterized protein At1g51745...    157   6e-41   Citrus sinensis [apfelsine]
ref|XP_006426470.1|  hypothetical protein CICLE_v10027499mg             157   6e-41   Citrus clementina [clementine]
ref|XP_006466092.1|  PREDICTED: uncharacterized protein At1g51745...    157   7e-41   Citrus sinensis [apfelsine]
gb|KDO58660.1|  hypothetical protein CISIN_1g004313mg                   157   7e-41   Citrus sinensis [apfelsine]
gb|KDO58662.1|  hypothetical protein CISIN_1g004313mg                   157   7e-41   Citrus sinensis [apfelsine]
ref|XP_006466093.1|  PREDICTED: uncharacterized protein At1g51745...    157   7e-41   Citrus sinensis [apfelsine]
ref|XP_010535212.1|  PREDICTED: uncharacterized protein At1g51745       155   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_004297615.1|  PREDICTED: uncharacterized protein At1g51745...    153   2e-39   Fragaria vesca subsp. vesca
ref|XP_011075809.1|  PREDICTED: uncharacterized protein LOC105160226    149   6e-38   Sesamum indicum [beniseed]
ref|XP_006647738.1|  PREDICTED: uncharacterized protein LOC102704308    150   6e-38   Oryza brachyantha
ref|XP_002452698.1|  hypothetical protein SORBIDRAFT_04g030860          150   6e-38   Sorghum bicolor [broomcorn]
ref|XP_010924938.1|  PREDICTED: uncharacterized protein At1g51745...    149   9e-38   Elaeis guineensis
ref|XP_004953538.1|  PREDICTED: uncharacterized protein At1g51745...    149   1e-37   Setaria italica
ref|XP_010911968.1|  PREDICTED: uncharacterized protein At1g51745...    149   2e-37   Elaeis guineensis
ref|XP_008646118.1|  PREDICTED: uncharacterized protein At1g51745...    149   2e-37   Zea mays [maize]
gb|KHN05521.1|  Hypothetical protein glysoja_020486                     148   2e-37   Glycine soja [wild soybean]
ref|XP_008646117.1|  PREDICTED: uncharacterized protein At1g51745...    149   2e-37   Zea mays [maize]
ref|XP_008678998.1|  PREDICTED: uncharacterized protein At1g51745...    149   2e-37   Zea mays [maize]
ref|XP_006590455.1|  PREDICTED: uncharacterized protein At1g51745...    147   2e-37   Glycine max [soybeans]
ref|XP_006590454.1|  PREDICTED: uncharacterized protein At1g51745...    147   2e-37   Glycine max [soybeans]
ref|NP_001047836.1|  Os02g0700000                                       148   2e-37   
emb|CAE03465.2|  OSJNBa0083N12.2                                        148   2e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87184.1|  hypothetical protein OsI_08586                          148   2e-37   Oryza sativa Indica Group [Indian rice]
gb|KHN35122.1|  Hypothetical protein glysoja_004888                     146   2e-37   Glycine soja [wild soybean]
ref|XP_009351866.1|  PREDICTED: uncharacterized protein At1g51745...    146   4e-37   
ref|XP_012090936.1|  PREDICTED: uncharacterized protein At1g51745       147   4e-37   Jatropha curcas
ref|XP_006573831.1|  PREDICTED: uncharacterized protein At1g51745...    145   6e-37   Glycine max [soybeans]
ref|XP_003570168.1|  PREDICTED: uncharacterized protein LOC100840926    147   6e-37   Brachypodium distachyon [annual false brome]
ref|XP_004235289.1|  PREDICTED: uncharacterized protein At1g51745       147   7e-37   Solanum lycopersicum
ref|XP_008376887.1|  PREDICTED: uncharacterized protein At1g51745...    147   7e-37   
ref|XP_008376888.1|  PREDICTED: uncharacterized protein LOC103439...    145   7e-37   
ref|XP_009361204.1|  PREDICTED: uncharacterized protein At1g51745...    147   7e-37   Pyrus x bretschneideri [bai li]
ref|XP_009351865.1|  PREDICTED: uncharacterized protein At1g51745...    147   8e-37   Pyrus x bretschneideri [bai li]
ref|XP_006347560.1|  PREDICTED: uncharacterized protein At1g51745...    146   9e-37   Solanum tuberosum [potatoes]
ref|XP_007131537.1|  hypothetical protein PHAVU_011G021400g             146   9e-37   Phaseolus vulgaris [French bean]
ref|XP_010549813.1|  PREDICTED: uncharacterized protein At1g51745...    146   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_008234589.1|  PREDICTED: uncharacterized protein LOC103333...    144   1e-36   Prunus mume [ume]
ref|XP_004511545.1|  PREDICTED: uncharacterized protein LOC101513863    144   1e-36   
emb|CBI26559.3|  unnamed protein product                                144   2e-36   Vitis vinifera
ref|XP_008234588.1|  PREDICTED: uncharacterized protein At1g51745...    145   2e-36   Prunus mume [ume]
ref|XP_008234587.1|  PREDICTED: uncharacterized protein At1g51745...    145   2e-36   Prunus mume [ume]
gb|EYU45368.1|  hypothetical protein MIMGU_mgv1a018253mg                144   3e-36   Erythranthe guttata [common monkey flower]
ref|XP_010243122.1|  PREDICTED: uncharacterized protein At1g51745...    145   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010671152.1|  PREDICTED: uncharacterized protein LOC104888033    145   3e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009395771.1|  PREDICTED: uncharacterized protein At1g51745...    145   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006590768.1|  PREDICTED: uncharacterized protein At1g51745...    144   3e-36   Glycine max [soybeans]
ref|XP_007029502.1|  Tudor/PWWP/MBT superfamily protein, putative...    145   3e-36   Theobroma cacao [chocolate]
ref|XP_010525044.1|  PREDICTED: uncharacterized protein At1g51745...    144   4e-36   Tarenaya hassleriana [spider flower]
gb|EMS66663.1|  hypothetical protein TRIUR3_34844                       145   4e-36   Triticum urartu
ref|XP_007220250.1|  hypothetical protein PRUPE_ppa001649mg             144   4e-36   
gb|EPS71227.1|  hypothetical protein M569_03532                         142   5e-36   Genlisea aurea
ref|XP_006592019.1|  PREDICTED: uncharacterized protein At1g51745...    144   6e-36   
ref|XP_002274927.1|  PREDICTED: uncharacterized protein At1g51745...    144   6e-36   Vitis vinifera
ref|XP_007157030.1|  hypothetical protein PHAVU_002G037800g             142   6e-36   Phaseolus vulgaris [French bean]
gb|KHN46442.1|  Hypothetical protein glysoja_035118                     144   7e-36   Glycine soja [wild soybean]
emb|CAN77845.1|  hypothetical protein VITISV_020829                     144   7e-36   Vitis vinifera
ref|XP_010034956.1|  PREDICTED: uncharacterized protein At1g51745...    143   8e-36   Eucalyptus grandis [rose gum]
emb|CDP04947.1|  unnamed protein product                                143   8e-36   Coffea canephora [robusta coffee]
ref|XP_010558652.1|  PREDICTED: uncharacterized protein At1g51745...    144   9e-36   Tarenaya hassleriana [spider flower]
ref|XP_002520007.1|  conserved hypothetical protein                     143   9e-36   Ricinus communis
ref|XP_006347475.1|  PREDICTED: uncharacterized protein At1g51745...    143   9e-36   Solanum tuberosum [potatoes]
ref|XP_008797875.1|  PREDICTED: uncharacterized protein At1g51745...    144   1e-35   Phoenix dactylifera
ref|XP_010662138.1|  PREDICTED: uncharacterized protein LOC100254...    142   1e-35   Vitis vinifera
gb|KHG23776.1|  hypothetical protein F383_28480                         142   2e-35   Gossypium arboreum [tree cotton]
ref|XP_003610874.1|  hypothetical protein MTR_5g007980                  141   2e-35   Medicago truncatula
dbj|BAJ91774.1|  predicted protein                                      142   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009402955.1|  PREDICTED: uncharacterized protein At1g51745...    142   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402956.1|  PREDICTED: uncharacterized protein At1g51745...    142   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN25604.1|  Hypothetical protein glysoja_018178                     141   3e-35   Glycine soja [wild soybean]
ref|XP_010087499.1|  hypothetical protein L484_019705                   142   3e-35   Morus notabilis
ref|XP_003569211.1|  PREDICTED: uncharacterized protein LOC100833692    142   3e-35   Brachypodium distachyon [annual false brome]
ref|XP_004307887.1|  PREDICTED: uncharacterized protein LOC101303560    141   4e-35   Fragaria vesca subsp. vesca
gb|KJB83995.1|  hypothetical protein B456_013G180600                    142   4e-35   Gossypium raimondii
ref|XP_010322496.1|  PREDICTED: uncharacterized protein At1g51745...    141   5e-35   Solanum lycopersicum
ref|XP_008785043.1|  PREDICTED: uncharacterized protein At1g51745       142   5e-35   Phoenix dactylifera
ref|XP_009402986.1|  PREDICTED: uncharacterized protein At1g51745...    142   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943463.1|  PREDICTED: uncharacterized protein At1g51745       142   5e-35   Elaeis guineensis
gb|EMS65717.1|  hypothetical protein TRIUR3_22307                       142   5e-35   Triticum urartu
ref|XP_008451676.1|  PREDICTED: uncharacterized protein At1g51745...    141   6e-35   Cucumis melo [Oriental melon]
ref|XP_010918108.1|  PREDICTED: uncharacterized protein LOC105042543    141   6e-35   Elaeis guineensis
ref|XP_009402985.1|  PREDICTED: uncharacterized protein At1g51745...    141   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010690078.1|  PREDICTED: uncharacterized protein At1g51745       140   7e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004505617.1|  PREDICTED: uncharacterized protein At1g51745...    140   8e-35   Cicer arietinum [garbanzo]
emb|CDY23461.1|  BnaC04g49890D                                          140   9e-35   Brassica napus [oilseed rape]
gb|ERN15621.1|  hypothetical protein AMTR_s00048p00187700               140   9e-35   Amborella trichopoda
ref|XP_009626996.1|  PREDICTED: uncharacterized protein At1g51745       140   1e-34   Nicotiana tomentosiformis
ref|XP_006299220.1|  hypothetical protein CARUB_v10015369mg             140   1e-34   Capsella rubella
ref|XP_010278764.1|  PREDICTED: uncharacterized protein At1g51745       141   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_004137270.1|  PREDICTED: uncharacterized protein At1g51745...    140   2e-34   Cucumis sativus [cucumbers]
ref|XP_006854154.2|  PREDICTED: uncharacterized protein At1g51745       140   2e-34   Amborella trichopoda
ref|XP_002455796.1|  hypothetical protein SORBIDRAFT_03g025340          139   2e-34   Sorghum bicolor [broomcorn]
ref|XP_009783633.1|  PREDICTED: uncharacterized protein At1g51745...    139   2e-34   Nicotiana sylvestris
ref|XP_009410801.1|  PREDICTED: uncharacterized protein At1g51745...    139   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009119103.1|  PREDICTED: uncharacterized protein At1g51745...    139   3e-34   Brassica rapa
gb|EMT12743.1|  hypothetical protein F775_06428                         139   3e-34   
ref|XP_008800030.1|  PREDICTED: uncharacterized protein At1g51745...    139   4e-34   Phoenix dactylifera
ref|XP_004968966.1|  PREDICTED: uncharacterized protein At1g51745...    138   4e-34   Setaria italica
emb|CDM83021.1|  unnamed protein product                                139   5e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010506908.1|  PREDICTED: uncharacterized protein At1g51745       138   8e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010463763.1|  PREDICTED: uncharacterized protein At1g51745...    138   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010485649.1|  PREDICTED: uncharacterized protein At1g51745...    138   9e-34   Camelina sativa [gold-of-pleasure]
gb|EEE54805.1|  hypothetical protein OsJ_02221                          137   9e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043335.1|  Os01g0558500                                       137   1e-33   
ref|XP_006408337.1|  hypothetical protein EUTSA_v10020126mg             137   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_011011282.1|  PREDICTED: uncharacterized protein At1g51745...    137   2e-33   Populus euphratica
ref|XP_010227249.1|  PREDICTED: uncharacterized protein At1g51745...    137   2e-33   
gb|EMT25308.1|  hypothetical protein F775_01904                         137   2e-33   
emb|CDY49929.1|  BnaCnng18390D                                          136   2e-33   Brassica napus [oilseed rape]
ref|XP_002325377.2|  hypothetical protein POPTR_0019s07270g             136   3e-33   
gb|KHG02245.1|  hypothetical protein F383_26198                         136   3e-33   Gossypium arboreum [tree cotton]
dbj|BAF01144.1|  hypothetical protein                                   136   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186964.1|  PWWP domain-containing protein                        136   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KJB18410.1|  hypothetical protein B456_003G051500                    136   5e-33   Gossypium raimondii
emb|CDY28740.1|  BnaCnng06260D                                          135   5e-33   Brassica napus [oilseed rape]
ref|XP_006443161.1|  hypothetical protein CICLE_v10018929mg             135   7e-33   Citrus clementina [clementine]
ref|XP_009130336.1|  PREDICTED: uncharacterized protein At1g51745...    134   1e-32   
emb|CDY43148.1|  BnaA05g32380D                                          134   1e-32   Brassica napus [oilseed rape]
ref|XP_011653393.1|  PREDICTED: uncharacterized protein At1g51745...    133   4e-32   Cucumis sativus [cucumbers]
ref|XP_011010169.1|  PREDICTED: uncharacterized protein At1g51745...    132   9e-32   Populus euphratica
ref|XP_002319249.2|  hypothetical protein POPTR_0013s08000g             132   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006392999.1|  hypothetical protein EUTSA_v10011307mg             130   2e-31   Eutrema salsugineum [saltwater cress]
ref|NP_564598.2|  Tudor/PWWP/MBT superfamily protein                    129   2e-31   
sp|P59278.2|Y1745_ARATH  RecName: Full=Uncharacterized protein At...    129   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAO22798.1|  unknown protein                                         129   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AES89591.2|  tudor/PWWP/MBT superfamily protein                      130   4e-31   Medicago truncatula
ref|XP_003607394.1|  hypothetical protein MTR_4g077550                  130   4e-31   
pir||D96556  hypothetical protein F19C24.5 [imported] - Arabidops...    129   2e-30
gb|EPS60051.1|  hypothetical protein M569_14754                         125   8e-30   Genlisea aurea
ref|XP_006304889.1|  hypothetical protein CARUB_v10012660mg             125   1e-29   Capsella rubella
ref|XP_010500759.1|  PREDICTED: uncharacterized protein At1g51745...    123   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010500760.1|  PREDICTED: uncharacterized protein At1g51745...    123   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010479675.1|  PREDICTED: uncharacterized protein At1g51745...    120   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010479677.1|  PREDICTED: uncharacterized protein At1g51745...    120   1e-27   Camelina sativa [gold-of-pleasure]
emb|CDY33863.1|  BnaC06g04900D                                          120   2e-27   Brassica napus [oilseed rape]
emb|CDY22868.1|  BnaA06g02090D                                          120   3e-27   Brassica napus [oilseed rape]
ref|XP_009147732.1|  PREDICTED: uncharacterized protein At1g51745...    118   3e-27   Brassica rapa
ref|XP_010462014.1|  PREDICTED: uncharacterized protein At1g51745...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010462016.1|  PREDICTED: uncharacterized protein At1g51745...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004245942.1|  PREDICTED: uncharacterized protein LOC101257099    117   4e-27   Solanum lycopersicum
ref|XP_006352937.1|  PREDICTED: uncharacterized protein At1g51745...    117   4e-27   Solanum tuberosum [potatoes]
ref|XP_004968965.1|  PREDICTED: uncharacterized protein LOC101785666    116   5e-27   Setaria italica
ref|XP_009597376.1|  PREDICTED: uncharacterized protein LOC104093...    114   4e-26   Nicotiana tomentosiformis
ref|XP_009776963.1|  PREDICTED: uncharacterized protein LOC104226632    111   3e-25   Nicotiana sylvestris
emb|CDX87840.1|  BnaC06g09020D                                          107   3e-23   
ref|XP_006652750.1|  PREDICTED: uncharacterized protein At1g51745...    107   5e-23   
ref|XP_006652748.1|  PREDICTED: uncharacterized protein At1g51745...    107   6e-23   
ref|XP_010034957.1|  PREDICTED: uncharacterized protein At1g51745...    106   8e-23   Eucalyptus grandis [rose gum]
gb|EEC77915.1|  hypothetical protein OsI_17245                          106   2e-22   Oryza sativa Indica Group [Indian rice]
gb|EPS63085.1|  hypothetical protein M569_11703                         103   2e-22   Genlisea aurea
ref|XP_008348496.1|  PREDICTED: uncharacterized protein At1g51745...    102   3e-22   
ref|XP_011013035.1|  PREDICTED: uncharacterized protein At1g51745...    105   3e-22   Populus euphratica
ref|XP_002304109.2|  hypothetical protein POPTR_0003s03970g             103   7e-22   
emb|CDP11755.1|  unnamed protein product                                101   2e-21   Coffea canephora [robusta coffee]
ref|XP_006369225.1|  hypothetical protein POPTR_0001s19480g             102   2e-21   
ref|XP_006369226.1|  hypothetical protein POPTR_0001s19480g             102   2e-21   
emb|CDY43925.1|  BnaA05g15350D                                        99.0    2e-20   Brassica napus [oilseed rape]
ref|XP_003565804.1|  PREDICTED: uncharacterized protein LOC100844359  99.0    4e-20   Brachypodium distachyon [annual false brome]
ref|XP_009144882.1|  PREDICTED: uncharacterized protein At1g51745     97.4    6e-20   Brassica rapa
ref|XP_004960986.1|  PREDICTED: uncharacterized protein LOC101752952  97.8    8e-20   
ref|NP_001136808.1|  uncharacterized protein LOC100216954             95.1    1e-19   Zea mays [maize]
ref|XP_009597377.1|  PREDICTED: uncharacterized protein LOC104093...  95.5    1e-19   Nicotiana tomentosiformis
ref|XP_008656118.1|  PREDICTED: uncharacterized protein LOC103635437  96.7    2e-19   Zea mays [maize]
gb|AFW79356.1|  hypothetical protein ZEAMMB73_849427                  95.1    7e-19   
ref|XP_006646000.1|  PREDICTED: uncharacterized protein At1g51745...  92.4    6e-18   Oryza brachyantha
emb|CAI44650.1|  OSJNba0093F12.23                                     84.3    4e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK01602.1|  predicted protein                                    84.0    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008676390.1|  PREDICTED: uncharacterized protein At1g51745     83.6    6e-15   
tpg|DAA59003.1|  TPA: hypothetical protein ZEAMMB73_224631            82.8    1e-14   
ref|XP_007029503.1|  Tudor/PWWP/MBT superfamily protein, putative...  82.8    1e-14   
ref|XP_008809885.1|  PREDICTED: uncharacterized protein At1g51745...  82.0    2e-14   
ref|XP_008451679.1|  PREDICTED: uncharacterized protein At1g51745...  81.6    3e-14   
ref|XP_010558655.1|  PREDICTED: uncharacterized protein At1g51745...  80.9    5e-14   Tarenaya hassleriana [spider flower]
gb|EMT19851.1|  hypothetical protein F775_09638                       80.5    6e-14   
ref|XP_011653394.1|  PREDICTED: uncharacterized protein At1g51745...  79.0    2e-13   Cucumis sativus [cucumbers]
ref|XP_008451678.1|  PREDICTED: uncharacterized protein At1g51745...  79.0    2e-13   
ref|XP_008657775.1|  PREDICTED: uncharacterized protein At1g51745...  78.2    4e-13   
ref|XP_011011283.1|  PREDICTED: uncharacterized protein At1g51745...  76.3    2e-12   Populus euphratica
ref|XP_008780396.1|  PREDICTED: uncharacterized protein At1g51745...  68.9    8e-12   Phoenix dactylifera
gb|KDO50576.1|  hypothetical protein CISIN_1g004827mg                 73.6    1e-11   Citrus sinensis [apfelsine]
gb|ACG24976.1|  hypothetical protein                                  67.8    2e-11   Zea mays [maize]
ref|NP_001031172.1|  Tudor/PWWP/MBT superfamily protein               70.9    7e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB35000.1|  hypothetical protein B456_006G096200                  69.3    2e-10   Gossypium raimondii
gb|KGN53740.1|  hypothetical protein Csa_4G114210                     62.8    6e-10   Cucumis sativus [cucumbers]
gb|KHG25774.1|  hypothetical protein F383_10403                       68.2    7e-10   Gossypium arboreum [tree cotton]
ref|XP_002891656.1|  hypothetical protein ARALYDRAFT_474292           65.5    4e-09   
gb|AAP45186.2|  Micronuclear linker histone polyprotein, putative     58.5    6e-07   Solanum bulbocastanum [ornamental nightshade]
ref|XP_002441636.1|  hypothetical protein SORBIDRAFT_09g030720        57.8    2e-06   
ref|XP_004971926.1|  PREDICTED: uncharacterized protein LOC101763824  54.7    8e-06   Setaria italica



>ref|XP_009782512.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782513.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782514.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
 ref|XP_009782515.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana sylvestris]
Length=726

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE  AK ID    GLVWVRRRNG WWPG+IL P+ELP+  SVS RSGTPVKLLG +
Sbjct  1    MGSSGESSAKAIDASVGGLVWVRRRNGSWWPGRILGPDELPQSCSVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ SRKAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKAAAANSSRKAVKYARREDAIIHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASS--REGIENVNGDYSSSEDNSRSKPKLSHS  623
             LGK +P+F   +DK++G  + + +   SS   E  ++++ + +SSEDNS S  +LS S
Sbjct  121  RLGKDHPNFFSRIDKEDGEHHTMEDSHTSSNPHEDGKDLDEELTSSEDNSNSAQELSQS  179



>ref|XP_009614718.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Nicotiana tomentosiformis]
Length=726

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE  AK ID    GLVWVRRRNG WWPG+IL P+ELP+  SVS RSGTPVKLLG +
Sbjct  1    MGSSGESSAKAIDASVGGLVWVRRRNGSWWPGRILGPDELPQSCSVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ SRKAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKAAAANSSRKAVKYARREDAIIHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASSR--EGIENVNGDYSSSEDNSRSKPKLSHS  623
             LGK +P+F   +DK++G  + + +   SS   E  ++++ + +SSEDNS S  +LS S
Sbjct  121  RLGKDHPNFFSRIDKEDGEHHTMEDSHTSSNPLEDGKDLDEELTSSEDNSNSAQELSQS  179



>ref|XP_007135591.1| hypothetical protein PHAVU_010G142200g [Phaseolus vulgaris]
 gb|ESW07585.1| hypothetical protein PHAVU_010G142200g [Phaseolus vulgaris]
Length=780

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 126/180 (70%), Gaps = 7/180 (4%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSG+     ID    GLVWVRRRNG WWPG+IL   EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGKSNVNGIDASVGGLVWVRRRNGSWWPGRILGLHELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ ++KAVKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSNKKAVKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDK---QNGGQNLIGELPASSREGIENVNGDYSSSEDNSRSKPKLSHS  623
             L K + S   GLDK   ++GG    GELP  S    E+V GD S S+DNS S P+LS S
Sbjct  121  HLDKESLSLCSGLDKPGSEHGGS--AGELPLMSNS--EDVTGDLSDSDDNSNSAPELSQS  176



>ref|XP_008228331.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Prunus mume]
Length=752

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 124/180 (69%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E   K ID    GLVWVRRRNG WWPG+I+  +ELP+ S+VS RSGTPVKLLG  
Sbjct  4    MGSSSETSNKSIDASVGGLVWVRRRNGSWWPGRIMGLDELPDSSAVSPRSGTPVKLLGRD  63

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AAS ++KAVKY RREDAI+HALEIE +
Sbjct  64   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASSNKKAVKYARREDAIIHALEIENA  123

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIEN--VNGDYSSSEDNSRSKPKLSHS  623
             LGK N  FS  +    G       E PA S  G EN  +  D S SE++S S P+LS S
Sbjct  124  RLGKDNLDFSARMSNSGGEHGCSARESPAVSHSGEENEVMVDDVSDSENSSGSAPELSQS  183



>ref|XP_009614713.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614714.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614715.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009614716.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Nicotiana tomentosiformis]
Length=741

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 134/194 (69%), Gaps = 17/194 (9%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE  AK ID    GLVWVRRRNG WWPG+IL P+ELP+  SVS RSGTPVKLLG +
Sbjct  1    MGSSGESSAKAIDASVGGLVWVRRRNGSWWPGRILGPDELPQSCSVSPRSGTPVKLLGRE  60

Query  273  DTCI---------------DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYN  407
            D  +               DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ SRKAVKY 
Sbjct  61   DASVILFGNMGNLPSMGKRDWYNLEKSKRVKAFRCGEYDECIEKAKAAAANSSRKAVKYA  120

Query  408  RREDAILHALEIERSFLGKANPSFSLGLDKQNGGQNLIGELPASSR--EGIENVNGDYSS  581
            RREDAI+HALEIE + LGK +P+F   +DK++G  + + +   SS   E  ++++ + +S
Sbjct  121  RREDAIIHALEIESARLGKDHPNFFSRIDKEDGEHHTMEDSHTSSNPLEDGKDLDEELTS  180

Query  582  SEDNSRSKPKLSHS  623
            SEDNS S  +LS S
Sbjct  181  SEDNSNSAQELSQS  194



>ref|XP_009367513.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367514.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Pyrus x bretschneideri]
Length=741

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 123/180 (68%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID     LVWVRRRNG WWPG+I+  +ELP+   VS +SGTPVKLLG  
Sbjct  1    MGSSGETSEKSIDASVGTLVWVRRRNGSWWPGRIMGLDELPDSCVVSPKSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AASG++K VKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASGNKKKVKYARREDAIIHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASS--REGIENVNGDYSSSEDNSRSKPKLSHS  623
             LGK + +FS  +    G       E PA S   E  E++  D S SEDNS S P+LS S
Sbjct  121  HLGKDDLNFSARMSNSGGDHGCAARESPAMSLCSEENEDMVDDVSDSEDNSHSGPELSQS  180



>ref|XP_008380818.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Malus 
domestica]
 ref|XP_008380819.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Malus 
domestica]
Length=738

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 122/180 (68%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID     LVWVRRRNG WWPG+I+  +ELP+   VS +SGTPVKLLG  
Sbjct  1    MGSSGEISEKSIDASVGTLVWVRRRNGSWWPGRIMGLDELPDSCVVSPKSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AASG++K VKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASGNKKKVKYARREDAIIHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIEN--VNGDYSSSEDNSRSKPKLSHS  623
             LGK + +FS  +    G       E PA S    EN  +  D S SEDNS S P+LS S
Sbjct  121  HLGKDDLNFSARMSNSGGDHGCSARESPAMSLCSAENEDMADDVSDSEDNSHSGPELSQS  180



>ref|XP_007024422.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007024423.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27044.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27045.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=786

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 123/180 (68%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSPDEPNTKGIDASVGGLVWVRRRNGSWWPGRIMGLDELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ S+KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSSKKAVKYARREDAILHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQ-NLIGELPASSREGIEN--VNGDYSSSEDNSRSKPKLSHS  623
             LGK +P +    D   G Q + + E P  S  G EN  +  + S +ED+S S P+LS S
Sbjct  121  RLGKDHPDYFSRKDNSGGDQGSSVRESPTISHSGKENEDMTDEMSDTEDDSDSAPELSQS  180



>ref|XP_006343014.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum tuberosum]
Length=700

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+IL  +ELP+  SVS R GTPVKLLG +
Sbjct  1    MGSSGESVVKAIDASVGGLVWVRRRNGSWWPGRILGSDELPQSCSVSPRLGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   A++ S+KAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKAAASNSSKKAVKYARREDAIIHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASS  542
             LGK +P F   +DK+ G  + + E   SS
Sbjct  121  RLGKDHPDFFSRIDKEGGEHHTMEESHTSS  150



>ref|XP_004236393.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
 ref|XP_010318513.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
Length=703

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+IL  +ELP+  SVS R GTPVKLLG +
Sbjct  1    MGSSGESVVKAIDASVGGLVWVRRRNGSWWPGRILGSDELPQSCSVSPRLGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ S+KAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSSKKAVKYARREDAIIHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASS  542
             LGK +P F    +K+ G  N + E   SS
Sbjct  121  RLGKDHPDFFSRKEKEGGEHNTMEESHTSS  150



>gb|KJB70320.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
 gb|KJB70321.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
 gb|KJB70322.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
 gb|KJB70323.1| hypothetical protein B456_011G067800 [Gossypium raimondii]
Length=781

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSPDEPNIKGIDASVGGLVWVRRRNGSWWPGRIMGLDELSEGYLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEY++CIEKA   AA+ S+KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYNECIEKAKASAANSSKKAVKYARREDAILHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIENVNGDYSSSEDNSRSKPKLSHS  623
             LGK +P +    D+  G Q     E P  SR G EN + + S SED S S P+LS S
Sbjct  121  RLGKDHPDYFSRKDRSGGDQGCSAKESPNMSRSGKEN-DDEMSGSEDGSNSAPELSQS  177



>ref|XP_011080298.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
 ref|XP_011080306.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
Length=709

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 123/179 (69%), Gaps = 2/179 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+IL P+ELPE    + R+GTPVKLLG +
Sbjct  1    MGSSGEDPKKTIDASVGGLVWVRRRNGCWWPGKILGPDELPEGCVPTPRAGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AF CGEYD CIEKA   A+  S+KA KY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFHCGEYDDCIEKAKASASHLSKKAAKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASSR--EGIENVNGDYSSSEDNSRSKPKLSHS  623
              G+ +  FS   + Q+G  +   + P++    E  E+V+ D +SSED+S S  +LS S
Sbjct  121  RFGRDHQDFSATPETQDGEHHHAADSPSTCHPSEESEDVDDDLNSSEDDSDSAQELSQS  179



>gb|KHG19697.1| hypothetical protein F383_24275 [Gossypium arboreum]
Length=791

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSPDEPNIKGIDASVGGLVWVRRRNGSWWPGRIMGLDELSEGCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEY++CIEKA   AA+ S+KAVKY RREDAILHALEIE S
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYNECIEKAKASAANSSKKAVKYARREDAILHALEIESS  120

Query  453  FLGKANPSFSLGLDKQNGGQ-NLIGELPAS-SREGIEN--VNGDYSSSEDNSRSKPKLSH  620
             LGK +P +    D   G Q +L  E P S S  G EN   + + S SEDNS S P+LS 
Sbjct  121  RLGKDHPGYFSRKDNSGGDQGSLARESPTSMSHSGKENEDTSDEMSESEDNSDSAPELSQ  180

Query  621  S  623
            S
Sbjct  181  S  181



>gb|KHG23152.1| hypothetical protein F383_01193 [Gossypium arboreum]
Length=778

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSPDEPNIKGIDASVGGLVWVRRRNGSWWPGRIMGLDELSEGYLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEY++CIEKA   AA+ S+KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYNECIEKAKASAANSSKKAVKYARREDAILHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIENVNGDYSSSEDNSRSKPKLSHS  623
             LGK +P +    D+  G Q     E P  SR G E+ + + S SED S S P+LS S
Sbjct  121  RLGKDHPDYFSRKDRSGGDQGCSAKESPNMSRSGKES-DDEMSGSEDGSNSAPELSQS  177



>ref|XP_008228332.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Prunus mume]
Length=716

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 110/157 (70%), Gaps = 1/157 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E   K ID    GLVWVRRRNG WWPG+I+  +ELP+ S+VS RSGTPVKLLG  
Sbjct  4    MGSSSETSNKSIDASVGGLVWVRRRNGSWWPGRIMGLDELPDSSAVSPRSGTPVKLLGRD  63

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AAS ++KAVKY RREDAI+HALEIE +
Sbjct  64   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASSNKKAVKYARREDAIIHALEIENA  123

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIEN  560
             LGK N  FS  +    G       E PA S  G EN
Sbjct  124  RLGKDNLDFSARMSNSGGEHGCSARESPAVSHSGEEN  160



>gb|KJB56861.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
 gb|KJB56862.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
 gb|KJB56864.1| hypothetical protein B456_009G139300 [Gossypium raimondii]
Length=790

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 123/181 (68%), Gaps = 4/181 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSPDEPNIKGIDASVGGLVWVRRRNGSWWPGRIMGLDELSEGCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEY++CIEKA   AA+ S+KAVKY RREDAILHALEIE S
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYNECIEKAKASAANSSKKAVKYARREDAILHALEIESS  120

Query  453  FLGKANPSFSLGLDKQNGGQ-NLIGELPAS-SREGIEN--VNGDYSSSEDNSRSKPKLSH  620
             LGK +P +    D     Q +L  E P + S  G EN   + + S SEDNS S P+LS 
Sbjct  121  RLGKDHPGYFSRKDNSGADQGSLARESPTTMSHSGKENEDTSDEMSESEDNSDSAPELSQ  180

Query  621  S  623
            S
Sbjct  181  S  181



>ref|XP_010062582.1| PREDICTED: uncharacterized protein At1g51745 [Eucalyptus grandis]
 gb|KCW69713.1| hypothetical protein EUGRSUZ_F03102 [Eucalyptus grandis]
Length=770

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 119/178 (67%), Gaps = 2/178 (1%)
 Frame = +3

Query  96   GSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKD  275
            GS+GE   K ID    GLVWVRRRNG WWPG+I+  +ELPE   VS RSGTPVKLLG KD
Sbjct  3    GSAGEPCNKGIDGSVGGLVWVRRRNGSWWPGRIMGHDELPESCLVSPRSGTPVKLLGRKD  62

Query  276  TCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
              IDW+NLE SKRV+AFRCGEYD CIEKA   AA+ S+K VKY RREDAILHALE+E S 
Sbjct  63   ASIDWYNLEKSKRVKAFRCGEYDDCIEKAKAAAATLSKKVVKYARREDAILHALELESSR  122

Query  456  LGKANPSFSLGLDKQNGGQNLIGELPASSREG--IENVNGDYSSSEDNSRSKPKLSHS  623
            LGK +P F            L+ E P  S  G   + ++GD S  + +S S P+LS S
Sbjct  123  LGKDHPDFYCRNYSSGRDGALVMESPTISDSGRASDEISGDESGCDTDSHSGPELSQS  180



>emb|CDO97945.1| unnamed protein product [Coffea canephora]
Length=739

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 112/158 (71%), Gaps = 3/158 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E   K ID    GLVWVRRRNG WWPG+IL PEELPE   VS +SGTPVKLLG +
Sbjct  1    MGSDDEASNKGIDASVGGLVWVRRRNGSWWPGRILGPEELPESCLVSPKSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIEKA   AA+ S+K VKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDDCIEKA-KAAANSSKKVVKYARREDAILHALELENA  119

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPAS--SREGIEN  560
             LGK +P F   +DK++      G+ P S  S+E  E+
Sbjct  120  RLGKDHPDFCSTMDKKDEDPQDFGKSPNSLHSQEDTED  157



>ref|XP_004510340.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Cicer arietinum]
 ref|XP_004510341.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Cicer arietinum]
Length=789

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 117/180 (65%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE     I+    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGESNINGINASVGGLVWVRRRNGSWWPGRIMSLDELSEGCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AAS  +KAVKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAASLGKKAVKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDKQNGGQ-NLIGELPASSREGI--ENVNGDYSSSEDNSRSKPKLSHS  623
             L K         DK         GELP  S  G   E+V  D S S DNS S P+LS S
Sbjct  121  HLDKVPLPLCSRSDKSGSEHGESAGELPTMSNSGDVNEDVTDDLSDSGDNSNSAPELSQS  180



>ref|XP_007217004.1| hypothetical protein PRUPE_ppa002212mg [Prunus persica]
 gb|EMJ18203.1| hypothetical protein PRUPE_ppa002212mg [Prunus persica]
Length=700

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E   K ID    GLVWVRRRNG WWPG+I+  +ELP+ S+VS RSGTPVKLLG  
Sbjct  1    MGSSSETSNKSIDASVGGLVWVRRRNGSWWPGRIMGLDELPDSSAVSPRSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AAS ++KAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASSNKKAVKYARREDAIIHALEIENA  120

Query  453  FLGKANPSFS  482
             LGK N  FS
Sbjct  121  RLGKDNLDFS  130



>gb|KHN39281.1| Hypothetical protein glysoja_018053 [Glycine soja]
Length=784

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE     ID    GLVWVRRRNG WWPG+I+   EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGESNLNVIDASVGGLVWVRRRNGSWWPGRIMGLHELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ S+KAVKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSSKKAVKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDK---QNGGQNLIGELPASSREGIEN  560
             L K + S    LDK   ++GG    GELP  S  G +N
Sbjct  121  HLDKESSSLCSRLDKPGSEHGGS--AGELPLMSNSGEDN  157



>emb|CBI35983.3| unnamed protein product [Vitis vinifera]
Length=162

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGEPNTKAIDPSVGGLVWVRRRNGSWWPGRIMGLDELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ ++KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSNKKAVKYARREDAILHALEIENA  120

Query  453  FLGKANPSFSLGLDKQ  500
             LG+ N    L L K+
Sbjct  121  -LGQGNHLPCLILTKK  135



>gb|KHN11311.1| Hypothetical protein glysoja_023375 [Glycine soja]
Length=784

 Score =   180 bits (456),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 125/180 (69%), Gaps = 5/180 (3%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE     ID    GLVWVRRRNG WWPG+I+   EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGESNLNGIDASVGGLVWVRRRNGSWWPGRIMGLHELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEY++CIEKA   AA+ S+KAVKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYNECIEKAKASAANSSKKAVKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDK---QNGGQNLIGELPASSREGIENVNGDYSSSEDNSRSKPKLSHS  623
             L K + S    LDK   ++GG    GELP  S E  E+V  D S S+DNS + P+LS S
Sbjct  121  HLDKESLSLCSRLDKPGSEHGGS--AGELPLMSGEDNEDVADDLSDSDDNSNAAPELSQS  178



>ref|XP_003529739.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=784

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE     ID    GLVWVRRRNG WWPG+I+   EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGESNLNVIDASVGGLVWVRRRNGSWWPGRIMGLHELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ S+KAVKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSSKKAVKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDK---QNGGQNLIGELPASSREGIEN  560
             L K + S    LDK   ++GG    GELP  S  G +N
Sbjct  121  HLDKESLSLCSRLDKPGSEHGGS--AGELPLMSNSGEDN  157



>ref|XP_011072468.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
 ref|XP_011072469.1| PREDICTED: uncharacterized protein At1g51745 [Sesamum indicum]
Length=735

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 121/179 (68%), Gaps = 3/179 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+IL P+ELPE    + RSGTPVKLLG +
Sbjct  1    MGSSGEDPNKGIDPSVGGLVWVRRRNGSWWPGRILGPDELPEGCLPTPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIEKA   A+  S+KAVKY RREDAILHALE+E +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDDCIEKAKASASHLSKKAVKYARREDAILHALELESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLI--GELPASSREGIENVNGDYSSSEDNSRSKPKLSHS  623
             LGK     S     QN  + L+      +   E  E+ + D S+SED+S S P+LS S
Sbjct  121  RLGKDYDDLSARPGTQN-EERLVDDSPSSSHPSEESEDTDEDLSTSEDDSDSGPELSQS  178



>ref|XP_008380820.1| PREDICTED: uncharacterized protein At1g51745 isoform X3 [Malus 
domestica]
Length=702

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID     LVWVRRRNG WWPG+I+  +ELP+   VS +SGTPVKLLG  
Sbjct  1    MGSSGEISEKSIDASVGTLVWVRRRNGSWWPGRIMGLDELPDSCVVSPKSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AASG++K VKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASGNKKKVKYARREDAIIHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIEN  560
             LGK + +FS  +    G       E PA S    EN
Sbjct  121  HLGKDDLNFSARMSNSGGDHGCSARESPAMSLCSAEN  157



>ref|XP_009367515.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Pyrus x bretschneideri]
Length=705

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID     LVWVRRRNG WWPG+I+  +ELP+   VS +SGTPVKLLG  
Sbjct  1    MGSSGETSEKSIDASVGTLVWVRRRNGSWWPGRIMGLDELPDSCVVSPKSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AASG++K VKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLERSKRVKAFRCGEYDECIEKAKAHAASGNKKKVKYARREDAIIHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNG  506
             LGK + +FS  +    G
Sbjct  121  HLGKDDLNFSARMSNSGG  138



>ref|XP_010088115.1| hypothetical protein L484_001821 [Morus notabilis]
 gb|EXB31785.1| hypothetical protein L484_001821 [Morus notabilis]
Length=775

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 122/180 (68%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSG+   K ID    GLVWVRRRNG WWPG+IL  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGDASNKGIDASVGGLVWVRRRNGSWWPGRILGLDELSENCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIEKA   AA+ ++KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDDCIEKAKASAANSNKKAVKYARREDAILHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQ-NLIGELPASSREGIEN--VNGDYSSSEDNSRSKPKLSHS  623
               K +  F+  ++   G   N   E P+ S  G  N  ++ D S+SE++S +  +LS S
Sbjct  121  RQEKDHMDFNTRMNNLGGENGNSARESPSISHSGNANDDMDDDVSNSEESSDTVGELSES  180



>ref|XP_006297135.1| hypothetical protein CARUB_v10013137mg [Capsella rubella]
 gb|EOA30033.1| hypothetical protein CARUB_v10013137mg [Capsella rubella]
Length=669

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG +
Sbjct  1    MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDSTIVSPKSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A    ++ S+KAVKY RREDAI HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIETAKATVSTTSKKAVKYARREDAIAHALEIESA  120

Query  453  FLGKANP  473
             L K NP
Sbjct  121  HLAKDNP  127



>gb|KEH18280.1| tudor/PWWP/MBT superfamily protein [Medicago truncatula]
Length=782

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E     I+    GLVWVRRRNG WWPG+I+  +EL +   VS RSGTPVKLLG  
Sbjct  7    MGSSEESNINGINASVGGLVWVRRRNGSWWPGRIMSLDELSDGCLVSPRSGTPVKLLGRD  66

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRC EY + IEKA   AA   +KAVKY RREDAILHALE+E +
Sbjct  67   DASVDWYNLEKSKRVKAFRCREYAEAIEKAKASAAGLGKKAVKYARREDAILHALELESA  126

Query  453  FLGKANPSFSLGLDKQNGGQ-NLIGELPA---SSREGIENVNGDYSSSEDNSRSKPKLSH  620
             L KA        DK +       GELP    SS +G E+V  D S SEDNS S P+LS 
Sbjct  127  HLDKAPLPLCSRSDKSDSEHGEPAGELPVMSNSSDDGNEDVIDDLSDSEDNSNSAPELSQ  186

Query  621  S  623
            S
Sbjct  187  S  187



>ref|XP_008462373.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis melo]
Length=828

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  AK ID    GLVWVRRRNG WWPG+IL  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSSE--AKGIDSSVGGLVWVRRRNGSWWPGKILGLDELSESCLVSPRSGTPVKLLGRE  58

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  IDW+NLE SKRV+AFRCGEYD+CIEKA   AA+  +KAVKY RREDAILHALE+E +
Sbjct  59   DASIDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSCKKAVKYARREDAILHALELESA  118

Query  453  FLGKANPSFS  482
             LGK    FS
Sbjct  119  LLGKDQLDFS  128



>ref|XP_011659648.1| PREDICTED: uncharacterized protein At1g51745 [Cucumis sativus]
 gb|KGN45541.1| hypothetical protein Csa_7G451960 [Cucumis sativus]
Length=819

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  AK ID    GLVWVRRRNG WWPG+IL  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSSE--AKGIDSSVGGLVWVRRRNGSWWPGKILGLDELSESCLVSPRSGTPVKLLGRE  58

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  IDW+NLE SKRV+AFRCGEYD+CIEKA   AA+  +KAVKY RREDAILHALE+E +
Sbjct  59   DASIDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSCKKAVKYARREDAILHALELESA  118

Query  453  FLGKANPSFS  482
             LGK    FS
Sbjct  119  LLGKDQLDFS  128



>ref|XP_010654562.1| PREDICTED: uncharacterized protein At1g51745-like [Vitis vinifera]
Length=755

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 118/183 (64%), Gaps = 10/183 (5%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGEPNTKAIDPSVGGLVWVRRRNGSWWPGRIMGLDELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ ++KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSNKKAVKYARREDAILHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG----ELPASSREGIEN--VNGDYSSSEDNSRSKPKL  614
               K      L +   N G    G    E PA      EN  +  + S+ EDNS S  +L
Sbjct  121  RESKDR----LDVCSDNSGAEEHGSWARESPAMFDPDKENDDMADEVSTFEDNSNSAQEL  176

Query  615  SHS  623
            S S
Sbjct  177  SQS  179



>ref|XP_006406288.1| hypothetical protein EUTSA_v10020246mg [Eutrema salsugineum]
 gb|ESQ47741.1| hypothetical protein EUTSA_v10020246mg [Eutrema salsugineum]
Length=655

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +  ID    GLVWVRRRNG WWPG+I+   E+P+ S VS +SGTP+KLLG  
Sbjct  1    MGSSDERNSTAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDNSVVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A   A+ GS+KAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIETAKATASGGSKKAVKYARREDAIVHALEIENA  120

Query  453  FLGK  464
             L K
Sbjct  121  HLAK  124



>ref|XP_012069023.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 ref|XP_012069024.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 ref|XP_012069025.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 ref|XP_012069026.1| PREDICTED: uncharacterized protein At1g51745-like [Jatropha curcas]
 gb|KDP40807.1| hypothetical protein JCGZ_24806 [Jatropha curcas]
Length=770

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 116/172 (67%), Gaps = 7/172 (4%)
 Frame = +3

Query  93   MGSSGE--CRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLG  266
            MGSS +     + ID    GLVWVRRRNG WWPG+I+  +E+ E S VS RSGTPVKLLG
Sbjct  1    MGSSDDPNSSTQAIDASVGGLVWVRRRNGSWWPGRIMGLDEISEGSLVSPRSGTPVKLLG  60

Query  267  LKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIE  446
             +D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+G++KAVKY RREDAILHALEIE
Sbjct  61   REDASVDWYNLEKSKRVKAFRCGEYDECIEKAKANAANGNKKAVKYARREDAILHALEIE  120

Query  447  RSFLGKANPSFSLGLDKQNGGQN--LIGELPASSREGIENVNGDYSSSEDNS  596
             + LGK    F        GG+N  L  E P+ S  G E V  D +  E +S
Sbjct  121  NARLGKDGVDF-FSRTNNLGGENGSLAKESPSLSGSGKEGV--DMTDEESDS  169



>emb|CAN84040.1| hypothetical protein VITISV_024170 [Vitis vinifera]
Length=794

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 118/183 (64%), Gaps = 10/183 (5%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE   K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +
Sbjct  1    MGSSGEPNTKAIDPSVGGLVWVRRRNGSWWPGRIMGLDELSESCLVSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+ ++KAVKY RREDAILHALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDECIEKAKASAANSNKKAVKYARREDAILHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG----ELPASSREGIEN--VNGDYSSSEDNSRSKPKL  614
               K      L +   N G    G    E PA      EN  +  + S+ EDNS S  +L
Sbjct  121  RESKDR----LDVCSDNSGAEEHGSWARESPAMFDPDKENDDMADEVSTFEDNSNSAQEL  176

Query  615  SHS  623
            S S
Sbjct  177  SQS  179



>ref|XP_011013034.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Populus euphratica]
Length=778

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +3

Query  117  AKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHN  296
             K ID     LVWVRRRNG WWPG+I+  +E+ E S VS RSGTPVKLLG +D  +DW+N
Sbjct  17   TKAIDASVGALVWVRRRNGSWWPGRIVGLDEISEGSLVSPRSGTPVKLLGREDASVDWYN  76

Query  297  LENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPS  476
            LE SKRV+AFRCGEYD+CIEKA   AA+G+++AVKY RREDAILHALEIE + LGK    
Sbjct  77   LEKSKRVKAFRCGEYDECIEKAKTSAANGNKRAVKYARREDAILHALEIENARLGKDQLD  136

Query  477  F---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
            F   S  L +++G       +  S +E  +  +GD S SEDNS
Sbjct  137  FFSRSDNLGEEHGSSAKESSMSFSGKEDGDMTDGD-SYSEDNS  178



>ref|XP_010545639.1| PREDICTED: uncharacterized protein At1g51745-like [Tarenaya hassleriana]
Length=717

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 117/171 (68%), Gaps = 10/171 (6%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            VMGSS E   K ID    GLVWVRRRNG WWPG+I+C +E+P+   VS ++GTP+KLLG 
Sbjct  3    VMGSSDERNIKAIDASVGGLVWVRRRNGSWWPGRIMCLDEVPDGCLVSPKAGTPIKLLGR  62

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
             D  +DW+NLE SKRV+AFRCGEYD CIEKA   AA   +KAVKY RREDAI+HALEIE 
Sbjct  63   DDASVDWYNLEKSKRVKAFRCGEYDACIEKAKAAAAGSGKKAVKYARREDAIIHALEIEN  122

Query  450  SFLGKANPSFSLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNSRS  602
            S L K +P      D Q   QNL  E  +SSRE    ++  + SS+DN ++
Sbjct  123  SHLLKDHP------DLQMTKQNLPVEKTSSSRE----ISKRFRSSKDNEKT  163



>ref|XP_010468342.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
Length=602

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDEGNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDGTIVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A    ++ S+KAVKY RREDAI HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIEIAKASVSTTSKKAVKYARREDAIAHALEIESA  120

Query  453  FLGKANP  473
             L K NP
Sbjct  121  HLAKDNP  127



>ref|XP_010510070.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
Length=650

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDGTIVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A    ++ S+KAVKY RREDAI HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIEIAKASVSTTSKKAVKYARREDAIAHALEIESA  120

Query  453  FLGKANP  473
             L K NP
Sbjct  121  HLAKDNP  127



>ref|XP_010488139.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010488140.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
 ref|XP_010488141.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Camelina sativa]
Length=643

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 116/176 (66%), Gaps = 10/176 (6%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +  ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDERNSNAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDGTIVSPKSGTPIKLLGRA  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A    ++ S+KAVKY RREDAI HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIEIAKASVSTTSKKAVKYARREDAIAHALEIESA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPAS--SREGIENVNGDYSSSEDNSRSKPKL  614
             L K NP     ++K +      GE+P    SR+G E+ +GD   S D + +K  L
Sbjct  121  HLAKDNPEC---IEKASTS----GEVPKRCYSRKGNED-SGDVEDSGDMAETKVAL  168



>ref|XP_002515884.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46304.1| conserved hypothetical protein [Ricinus communis]
Length=786

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = +3

Query  93   MGSSGECRA--KPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLG  266
            MGSS +  +  K ID     LVWVRRRNG WWPG+I+  +E+ E S VS RSGTPVKLLG
Sbjct  1    MGSSDDPNSNIKAIDASVGSLVWVRRRNGSWWPGRIMGLDEISEGSLVSPRSGTPVKLLG  60

Query  267  LKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIE  446
             +D  +DW+NLE SKRV+AFRCGEYD+CIEKA   AA+G+RKAVKY RREDAILHALEIE
Sbjct  61   REDASVDWYNLEKSKRVKAFRCGEYDECIEKAKANAANGNRKAVKYARREDAILHALEIE  120

Query  447  RSFLGKANPSF  479
             + LGK   +F
Sbjct  121  NTRLGKDRVNF  131



>emb|CDY56919.1| BnaCnng31400D [Brassica napus]
Length=613

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 0/139 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG +
Sbjct  1    MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDDTIVSPKSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A   A   S+K VKY RREDAI+HALEIE +
Sbjct  61   DAGVDWYNLEKSKRVKAFRCGEYDACIETAKATATGASKKPVKYARREDAIVHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGG  509
             L   +   S   D   G 
Sbjct  121  LLVGKDEKASTSSDSTEGA  139



>ref|XP_011015418.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=779

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +3

Query  117  AKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHN  296
             K ID     LVWVRRRNG WWPG+I+  +E+ E S VS RSGTPVKLLG +D  +DW+N
Sbjct  18   TKAIDASVGALVWVRRRNGSWWPGRIVGLDEISEGSLVSPRSGTPVKLLGREDASVDWYN  77

Query  297  LENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPS  476
            LE SKRV+AFRCGEYD+CIEKA   AA+G+++ VKY RREDAILHALEIE + LG+    
Sbjct  78   LEKSKRVKAFRCGEYDECIEKAKASAANGNKRVVKYARREDAILHALEIENARLGQDQLD  137

Query  477  F---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
            F      L +++G       +  S +E  +  +GD S SEDNS
Sbjct  138  FFSRCDNLGEEHGSSAKESSMSFSGKEDGDMTDGD-SDSEDNS  179



>ref|XP_011011986.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=779

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +3

Query  117  AKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHN  296
             K ID     LVWVRRRNG WWPG+I+  +E+ E S VS RSGTPVKLLG +D  +DW+N
Sbjct  18   TKAIDASVGALVWVRRRNGSWWPGRIVGLDEISEGSLVSPRSGTPVKLLGREDASVDWYN  77

Query  297  LENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPS  476
            LE SKRV+AFRCGEYD+CIEKA   AA+G+++ VKY RREDAILHALEIE + LG+    
Sbjct  78   LEKSKRVKAFRCGEYDECIEKAKASAANGNKRVVKYARREDAILHALEIENARLGQDQLD  137

Query  477  F---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
            F      L +++G       +  S +E  +  +GD S SEDNS
Sbjct  138  FFSRCDNLGEKHGSSAKESSMSFSGKEDGDMTDGD-SDSEDNS  179



>ref|XP_009145492.1| PREDICTED: uncharacterized protein At1g51745 [Brassica rapa]
Length=604

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDDTIVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A   A   S+K VKY RREDAI+HALEIE +
Sbjct  61   DAGVDWYNLEKSKRVKAFRCGEYDACIETAKATATGASKKPVKYARREDAIVHALEIESA  120

Query  453  FL  458
             L
Sbjct  121  LL  122



>emb|CDY51454.1| BnaA05g36710D [Brassica napus]
Length=600

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDDTIVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A   A   S+K VKY RREDAI+HALEIE +
Sbjct  61   DAGVDWYNLEKSKRVKAFRCGEYDACIETAKATATGASKKPVKYARREDAIVHALEIESA  120

Query  453  FL  458
             L
Sbjct  121  LL  122



>gb|EYU45844.1| hypothetical protein MIMGU_mgv1a004135mg [Erythranthe guttata]
Length=542

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 96/129 (74%), Gaps = 2/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE  +K ID  A  LVWVRRRNG WWPG+IL P+ELPE S  S R+GTPVKLLG  
Sbjct  1    MGSSGEDPSKGIDTSAGALVWVRRRNGSWWPGKILGPDELPEGSVPSPRAGTPVKLLGRV  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIE--KALLVAASGSRKAVKYNRREDAILHALEIE  446
            D  +DW+NLE SKRV+AF CGEYD CIE  KA   A+  S++AVKY RREDAILHALE+E
Sbjct  61   DASVDWYNLEKSKRVKAFHCGEYDNCIEKVKAASTASHLSKRAVKYARREDAILHALELE  120

Query  447  RSFLGKANP  473
             S   + +P
Sbjct  121  ESARLEKDP  129



>ref|XP_006853959.1| PREDICTED: uncharacterized protein At1g51745 [Amborella trichopoda]
 gb|ERN15426.1| hypothetical protein AMTR_s00036p00215850 [Amborella trichopoda]
Length=737

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 101/143 (71%), Gaps = 1/143 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MG S E   K ID    GLVWVRRRNG WWPG+I+  +EL E S VS RSGTPVKLLG +
Sbjct  1    MGQS-EHNLKGIDATVGGLVWVRRRNGSWWPGRIMGLDELSETSLVSPRSGTPVKLLGRE  59

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+N+E SKRV+AFRCGEYD+CIEKA   AA  ++KAVKY RREDAILHALE+E +
Sbjct  60   DASVDWYNIEKSKRVKAFRCGEYDECIEKAKAYAAHPAKKAVKYARREDAILHALELESA  119

Query  453  FLGKANPSFSLGLDKQNGGQNLI  521
               KA+ +     D   G +N I
Sbjct  120  RNSKASENIYSRTDHSLGSKNGI  142



>gb|KFK39439.1| hypothetical protein AALP_AA3G245000 [Arabis alpina]
Length=664

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E +A  ID    GLVWVRRRNG WWPG+I+   E+P+   VS +SGTP+KLLG  
Sbjct  1    MGSSDERKA--IDASIGGLVWVRRRNGCWWPGRIMAHHEVPDGCIVSPKSGTPIKLLGRD  58

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIE A    +S S+K VKY RR+DAI+HALEIE +
Sbjct  59   DASVDWYNLEKSKRVKAFRCGEYDACIETAKATGSSSSKKGVKYARRDDAIVHALEIENA  118

Query  453  FLGKANPSFSLGLD  494
             L K +P    G D
Sbjct  119  HLAKDDPELLTGKD  132



>gb|EYU21406.1| hypothetical protein MIMGU_mgv1a002564mg [Erythranthe guttata]
Length=659

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  E     ID    GLVWVRRRNG WWPG+IL P+ELPE    + RSGTPVKLLG +
Sbjct  1    MGSCEEEANNGIDPTVGGLVWVRRRNGSWWPGRILGPDELPEGCVPTPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAAS-GSRKAVKYNRREDAILHALEIER  449
            D  +DW+NLE SKRV+AFRCGEYD CIEKA   A+S  S+KAVKY RREDAILHAL IE 
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDDCIEKAKACASSLPSKKAVKYARREDAILHALTIEN  120

Query  450  SFLGK  464
            + LGK
Sbjct  121  ARLGK  125



>ref|XP_008447587.1| PREDICTED: uncharacterized protein At1g51745-like [Cucumis melo]
Length=719

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = +3

Query  93   MGS-SGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            MGS  G    K ID    GLVWVRRRNG WWPG+I+  EEL E   VS +SGTPVKLLG 
Sbjct  1    MGSFDGSNTTKAIDASVGGLVWVRRRNGSWWPGRIMGLEELSESCLVSPKSGTPVKLLGR  60

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  IDW+NLE SKRV+AFRCGEYD+ IEKA    A  S++AVKY RREDAIL ALE+E 
Sbjct  61   EDASIDWYNLERSKRVKAFRCGEYDEFIEKAKASVAIASKRAVKYARREDAILQALELES  120

Query  450  SFLGKANPSFSLGLDKQNGGQNLIGELPASSR--EGIENVNGDYSSSEDNSRSKPKLSHS  623
            + +G+   +FS  +D   GG++ +    +  +   G   +  + S SED     P+LS S
Sbjct  121  ARVGQDQLAFSSKMD-TFGGEHDVSTTNSKLKPNSGEVELTNNMSDSEDRFNPMPELSQS  179



>dbj|BAB01723.1| unnamed protein product [Arabidopsis thaliana]
Length=695

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 11/165 (7%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E   K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDERNCKAIDASVGGLVWVRRRNGAWWPGRIMAHHEVPDGTIVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CI  A   A++  +KAVKY RREDAI HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIATAKATASTTGKKAVKYARREDAIAHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSE  587
             L K +P     ++K +      GE+   SR+GIE+ +GD + +E
Sbjct  121  HLAKDHPPC---IEKASTS----GEV---SRKGIED-SGDVAETE  154



>ref|NP_001078195.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76489.1| uncharacterized protein AT3G21295 [Arabidopsis thaliana]
Length=645

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 11/165 (7%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E   K ID    GLVWVRRRNG WWPG+I+   E+P+ + VS +SGTP+KLLG  
Sbjct  1    MGSSDERNCKAIDASVGGLVWVRRRNGAWWPGRIMAHHEVPDGTIVSPKSGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CI  A   A++  +KAVKY RREDAI HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIATAKATASTTGKKAVKYARREDAIAHALEIENA  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSE  587
             L K +P     ++K +      GE+   SR+GIE+ +GD + +E
Sbjct  121  HLAKDHPPC---IEKASTS----GEV---SRKGIED-SGDVAETE  154



>ref|XP_011463342.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=734

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 116/180 (64%), Gaps = 3/180 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE     ID     LVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG  
Sbjct  1    MGSSGESGNNGIDASVGSLVWVRRRNGSWWPGRIVGLDELSEDFVVSPRSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCGEYD+CI KA   AA+ ++KA KY RREDAI+HALEIE  
Sbjct  61   DASVDWYNLEKSKRVKPFRCGEYDECIAKAKAAAANPNKKAAKYARREDAIIHALEIENE  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIEN--VNGDYSSSEDNSRSKPKLSHS  623
             L K N + S  +    G ++    E PA+S  G EN  +  D S SE NS S  +LS S
Sbjct  121  RLAKDNVNISSRMSNSGGDRDCSARESPATSHSGEENGDMTDDVSPSEANSDSALELSQS  180



>gb|KDO58664.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=442

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  12   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  71

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  72   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  131

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  132  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  161



>gb|KDO58658.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
 gb|KDO58659.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=439

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  13   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  72

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  73   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  132

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  133  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  162



>gb|KDO58663.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=458

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  12   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  71

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  72   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  131

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  132  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  161



>gb|KDO58665.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=438

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  12   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  71

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  72   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  131

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  132  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  161



>ref|XP_010267045.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
 ref|XP_010267046.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
Length=880

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 89/116 (77%), Gaps = 2/116 (2%)
 Frame = +3

Query  105  GECRA--KPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDT  278
            G+C A  K ID    GLVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG +D 
Sbjct  3    GDCEANTKGIDCSVGGLVWVRRRNGSWWPGRIMGLDELSESCLVSPRSGTPVKLLGREDA  62

Query  279  CIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIE  446
             +DW+NLE SKRV+AFRCGEYD+CIEKA   AA  ++K VKY RREDAILHALE+E
Sbjct  63   SVDWYNLEKSKRVKAFRCGEYDECIEKAKAAAAQLNKKTVKYARREDAILHALELE  118



>ref|XP_011652363.1| PREDICTED: uncharacterized protein At1g51745 [Cucumis sativus]
 gb|KGN59837.1| hypothetical protein Csa_3G849930 [Cucumis sativus]
Length=729

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 115/183 (63%), Gaps = 10/183 (5%)
 Frame = +3

Query  93   MGS-SGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            MGS +G    K ID    GLVWVRRRNG WWPG+I+  EEL E   VS +SGTP+KLLG 
Sbjct  1    MGSFNGPNTTKAIDASVGGLVWVRRRNGMWWPGRIMGLEELSESCLVSPKSGTPMKLLGR  60

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  IDW+NLE S+RV+AFRCGEYD+ IEKA    A  S++AVKY RREDAIL ALE+E 
Sbjct  61   EDASIDWYNLERSERVKAFRCGEYDEFIEKAKASVAIASKRAVKYARREDAILQALELES  120

Query  450  SFLGKANPSFSLGLDKQNGGQNLIGEL-----PASSREGIENVNGDYSSSEDNSRSKPKL  614
            + +G+   +FS  +D   G ++ I        P S    + N   D+   ED   S P+L
Sbjct  121  ARVGQDQLAFSSKMD-TFGSEHDISTTHSKLKPNSGEVELTNNMSDF---EDRPDSMPEL  176

Query  615  SHS  623
            S S
Sbjct  177  SQS  179



>ref|XP_006466095.1| PREDICTED: uncharacterized protein At1g51745-like isoform X4 
[Citrus sinensis]
Length=750

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  13   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  72

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  73   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  132

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  133  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  162



>gb|KDO58661.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=751

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  12   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  71

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  72   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  131

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  132  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  161



>ref|XP_006466094.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Citrus sinensis]
Length=752

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  13   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  72

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  73   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  132

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  133  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  162



>ref|XP_006426470.1| hypothetical protein CICLE_v10027499mg [Citrus clementina]
 gb|ESR39710.1| hypothetical protein CICLE_v10027499mg [Citrus clementina]
Length=763

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +3

Query  114  RAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWH  293
            R   ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+
Sbjct  13   RNNNIDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWY  72

Query  294  NLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANP  473
            NLE SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P
Sbjct  73   NLEKSKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHP  132

Query  474  SFSLGLDKQNGGQ-NLIGELPASSREGIEN  560
             + +  D   G Q +L GE P  S    EN
Sbjct  133  DYWVRPDNSGGDQGSLTGESPVMSHSSKEN  162



>ref|XP_006466092.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Citrus sinensis]
Length=763

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+NLE 
Sbjct  17   IDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWYNLEK  76

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P + +
Sbjct  77   SKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHPDYWV  136

Query  486  GLDKQNGGQ-NLIGELPASSREGIEN  560
              D   G Q +L GE P  S    EN
Sbjct  137  RPDNSGGDQGSLTGESPVMSHSSKEN  162



>gb|KDO58660.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=762

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+NLE 
Sbjct  16   IDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWYNLEK  75

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P + +
Sbjct  76   SKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHPDYWV  135

Query  486  GLDKQNGGQ-NLIGELPASSREGIEN  560
              D   G Q +L GE P  S    EN
Sbjct  136  RPDNSGGDQGSLTGESPVMSHSSKEN  161



>gb|KDO58662.1| hypothetical protein CISIN_1g004313mg [Citrus sinensis]
Length=760

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+NLE 
Sbjct  16   IDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWYNLEK  75

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P + +
Sbjct  76   SKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHPDYWV  135

Query  486  GLDKQNGGQ-NLIGELPASSREGIEN  560
              D   G Q +L GE P  S    EN
Sbjct  136  RPDNSGGDQGSLTGESPVMSHSSKEN  161



>ref|XP_006466093.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Citrus sinensis]
Length=761

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 103/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            ID    GLVWVRRRNG WWPG+IL  +E+ E   VS RSGTPVKLLG +D  +DW+NLE 
Sbjct  17   IDPAVGGLVWVRRRNGTWWPGRILGLDEISEGCLVSPRSGTPVKLLGREDASVDWYNLEK  76

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGEYD+CI KA   AAS  +KAVKY RREDAILHALE+E + LGK +P + +
Sbjct  77   SKRVKAFRCGEYDECIAKAKASAASSGKKAVKYARREDAILHALELESARLGKDHPDYWV  136

Query  486  GLDKQNGGQ-NLIGELPASSREGIEN  560
              D   G Q +L GE P  S    EN
Sbjct  137  RPDNSGGDQGSLTGESPVMSHSSKEN  162



>ref|XP_010535212.1| PREDICTED: uncharacterized protein At1g51745 [Tarenaya hassleriana]
Length=660

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E   K  D    GLVWVRRRNG WWPG+I+  +E+PE S VS ++GTP+KLLG  
Sbjct  1    MGSSDEPNIKAFDASVGGLVWVRRRNGSWWPGRIMGFDEVPESSLVSPKAGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGEYD CIEKA   AAS  +KAVKY RREDAI+HALEIE +
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEYDACIEKAKAAAASSGKKAVKYARREDAIIHALEIEDA  120

Query  453  FLGK  464
             L K
Sbjct  121  HLAK  124



>ref|XP_004297615.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=698

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 107/163 (66%), Gaps = 3/163 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSGE     ID     LVWVRRRNG WWPG+I+  +EL E   VS RSGTPVKLLG  
Sbjct  1    MGSSGESGNNGIDASVGSLVWVRRRNGSWWPGRIVGLDELSEDFVVSPRSGTPVKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCGEYD+CI KA   AA+ ++KA KY RREDAI+HALEIE  
Sbjct  61   DASVDWYNLEKSKRVKPFRCGEYDECIAKAKAAAANPNKKAAKYARREDAIIHALEIENE  120

Query  453  FLGKANPSFSLGLDKQNGGQNLIG-ELPASSREGIENVNGDYS  578
             L K N + S  +    G ++    E PA+S  G E  NGD +
Sbjct  121  RLAKDNVNISSRMSNSGGDRDCSARESPATSHSGEE--NGDMT  161



>ref|XP_011075809.1| PREDICTED: uncharacterized protein LOC105160226 [Sesamum indicum]
 ref|XP_011075810.1| PREDICTED: uncharacterized protein LOC105160226 [Sesamum indicum]
Length=679

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL PEEL      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  17   VDCSVGSIVWVRRRNGSWWPGKILGPEELSSSHITSPRSGTPVKLLGREDASVDWYNLEK  76

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+ER  L K
Sbjct  77   SKRVKAFRCGEFDDCIERAEATQGMPPKKREKYARREDAILHALELERQLLEK  129



>ref|XP_006647738.1| PREDICTED: uncharacterized protein LOC102704308 [Oryza brachyantha]
Length=824

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL P+ELP    +S RSGTPVKLLG +D  +DW+N+E S
Sbjct  22   DTSPGTIVWVRRRNGSWWPGRILGPDELPPSQIMSPRSGTPVKLLGREDASVDWYNIEKS  81

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKAN  470
            KRV+AFRCGE+D CIEKA     +  +K  KY RREDAILHALE+E+  L   N
Sbjct  82   KRVKAFRCGEFDACIEKAEATEGNSLKKREKYARREDAILHALELEKKLLASKN  135



>ref|XP_002452698.1| hypothetical protein SORBIDRAFT_04g030860 [Sorghum bicolor]
 gb|EES05674.1| hypothetical protein SORBIDRAFT_04g030860 [Sorghum bicolor]
Length=818

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEELP    +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  27   IVWVRRRNGSWWPGRILGPEELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  86

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            RCGE+D CIEKA     +  +K  KY RREDAILHALE+ER  L 
Sbjct  87   RCGEFDACIEKAEATQGTVVKKREKYARREDAILHALELERKQLA  131



>ref|XP_010924938.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
 ref|XP_010924939.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
Length=830

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  +   K IDV A GLVW+RRRNG WWPG+IL  +ELP +  +  RSGTP+KLLG +
Sbjct  1    MGSDQDGCLKGIDVSAGGLVWIRRRNGSWWPGRILGRDELPAKCLLPPRSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRK---AVKYNRREDAILHALEI  443
            D  +DW+NLE SKRV+ FRCGEYD+CIE+A   A    +K   A KY RREDAILHALE+
Sbjct  61   DGSMDWYNLEKSKRVKPFRCGEYDECIERARASAVCSKKKPANAGKYVRREDAILHALEL  120

Query  444  ERSFLGKAN  470
            E++     N
Sbjct  121  EKAHFSNRN  129



>ref|XP_004953538.1| PREDICTED: uncharacterized protein At1g51745-like [Setaria italica]
Length=824

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEELP    +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  27   IVWVRRRNGSWWPGRILGPEELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  86

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            RCGE+D CIEKA     +  +K  KY RREDAILHALE+ER  L 
Sbjct  87   RCGEFDACIEKAEATQGTLVKKREKYARREDAILHALELERKQLA  131



>ref|XP_010911968.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
 ref|XP_010911976.1| PREDICTED: uncharacterized protein At1g51745-like [Elaeis guineensis]
Length=824

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MG   +   K  D  A GLVWVRRRNG WWPG+IL  +ELP +  +  RSGTP+KLLG +
Sbjct  1    MGGDQDGCLKGFDASAGGLVWVRRRNGSWWPGRILGRDELPAKCLLPPRSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRK---AVKYNRREDAILHALEI  443
            D  +DW+NLE SKRV+AFRCGEYD+CIE+A   A    +K   A KY RREDAILHALEI
Sbjct  61   DGSMDWYNLEKSKRVKAFRCGEYDECIERAKASAVCSKKKPANAGKYVRREDAILHALEI  120

Query  444  ERSFLGKAN  470
            E ++    N
Sbjct  121  ENAYFSNRN  129



>ref|XP_008646118.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Zea 
mays]
Length=818

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEELP    +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  27   IVWVRRRNGSWWPGRILGPEELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  86

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            RCGE+D CIEKA     +  +K  KY RREDA+LHALE+ER
Sbjct  87   RCGEFDACIEKAEATQGTLVKKREKYARREDAVLHALELER  127



>gb|KHN05521.1| Hypothetical protein glysoja_020486 [Glycine soja]
Length=740

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQIL P++L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  2    MDCGVGSIVWVRRRNGSWWPGQILGPDDLSAAHLTSPRSGTPVKLLGREDASVDWYNLEK  61

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+  L K   S + 
Sbjct  62   SKRVKAFRCGEFDDCIEKAEAAQGGPLKKREKYARREDAILHALELEKQILKKPGKSGAR  121

Query  486  GLDKQNGG  509
             L+  N G
Sbjct  122  SLNAVNKG  129



>ref|XP_008646117.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Zea 
mays]
 gb|AFW72946.1| hypothetical protein ZEAMMB73_974607 [Zea mays]
Length=822

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEELP    +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  27   IVWVRRRNGSWWPGRILGPEELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  86

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            RCGE+D CIEKA     +  +K  KY RREDA+LHALE+ER
Sbjct  87   RCGEFDACIEKAEATQGTLVKKREKYARREDAVLHALELER  127



>ref|XP_008678998.1| PREDICTED: uncharacterized protein At1g51745-like [Zea mays]
Length=817

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+ELP    +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  27   IVWVRRRNGSWWPGRILGPQELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  86

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            RCGE+D CIEKA     +  +K  KY RREDAILHALE+ER  L 
Sbjct  87   RCGEFDACIEKAEATQGTLVKKREKYARREDAILHALELERKQLA  131



>ref|XP_006590455.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Glycine max]
Length=625

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  123  PIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLE  302
            P+D     +VWVRRRNG WWPGQIL P+ L      S RSGTPVKLLG +D  +DW+NLE
Sbjct  8    PVDCDVGSIVWVRRRNGSWWPGQILGPDHLSASHLTSPRSGTPVKLLGREDASVDWYNLE  67

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
             SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  68   KSKRVKAFRCGEFDGCIERAESAQGMPLKKREKYARREDAILHALELEKQMLKK  121



>ref|XP_006590454.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Glycine max]
Length=626

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  123  PIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLE  302
            P+D     +VWVRRRNG WWPGQIL P+ L      S RSGTPVKLLG +D  +DW+NLE
Sbjct  8    PVDCDVGSIVWVRRRNGSWWPGQILGPDHLSASHLTSPRSGTPVKLLGREDASVDWYNLE  67

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
             SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  68   KSKRVKAFRCGEFDGCIERAESAQGMPLKKREKYARREDAILHALELEKQMLKK  121



>ref|NP_001047836.1| Os02g0700000 [Oryza sativa Japonica Group]
 dbj|BAD07514.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD07885.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09750.1| Os02g0700000 [Oryza sativa Japonica Group]
 gb|EAZ24294.1| hypothetical protein OsJ_08046 [Oryza sativa Japonica Group]
 dbj|BAG94731.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL P+ELP    +S RSGTPVKLLG +D  +DW+N+E S
Sbjct  21   DTSPGTIVWVRRRNGSWWPGRILGPDELPPSQIMSPRSGTPVKLLGREDASVDWYNIEKS  80

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            KRV+AFRCGE+D CIEKA     +  +K  KY RREDAILHALE+E+  L 
Sbjct  81   KRVKAFRCGEFDACIEKAEATEGTSVKKREKYARREDAILHALELEKKLLA  131



>emb|CAE03465.2| OSJNBa0083N12.2 [Oryza sativa Japonica Group]
 gb|EEE61605.1| hypothetical protein OsJ_16022 [Oryza sativa Japonica Group]
Length=863

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 101/159 (64%), Gaps = 14/159 (9%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+ELP    +S ++GTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  34   IVWVRRRNGSWWPGRILGPDELPASQVMSPKTGTPVKLLGREDASVDWYNLEKSKRVKAF  93

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSLGLDKQNG  506
            RCGE+D CIEKAL    +  ++  KY RREDAILHALE+ER           L    QN 
Sbjct  94   RCGEFDACIEKALTSRGTPVKRREKYARREDAILHALELERK---------QLASKYQNQ  144

Query  507  G--QNLIGELP-ASSREGIENVNGDYSSSEDNSRSKPKL  614
            G   + I  +P A  R   +N + +Y S   N+  KP+ 
Sbjct  145  GFRSDDISSVPFADMRREFDNSSTEYYSR--NNTQKPQF  181



>gb|EAY87184.1| hypothetical protein OsI_08586 [Oryza sativa Indica Group]
Length=827

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL P+ELP    +S RSGTPVKLLG +D  +DW+N+E S
Sbjct  21   DTSPGTIVWVRRRNGSWWPGRILGPDELPPSQIMSPRSGTPVKLLGREDASVDWYNIEKS  80

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            KRV+AFRCGE+D CIEKA     +  +K  KY RREDAILHALE+E+  L 
Sbjct  81   KRVKAFRCGEFDACIEKAEATEGTSVKKREKYARREDAILHALELEKKLLA  131



>gb|KHN35122.1| Hypothetical protein glysoja_004888 [Glycine soja]
Length=632

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +3

Query  123  PIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLE  302
            P+D     +VWVRRRNG WWPGQIL P+ L      S RSGTPVKLLG +D  +DW+NLE
Sbjct  8    PVDCDVGSIVWVRRRNGSWWPGQILGPDHLSASHLTSPRSGTPVKLLGREDASVDWYNLE  67

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
             SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  68   KSKRVKAFRCGEFDGCIERAESAQGMPLKKREKYARREDAILHALELEKQMLKK  121



>ref|XP_009351866.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Pyrus 
x bretschneideri]
Length=609

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 92/141 (65%), Gaps = 7/141 (5%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  19   IVWVRRRNGSWWPGKIVGPEELSTSHLTSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  78

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSLGLDKQ--  500
            RCGE+D CIEKA        +K  KY RREDAILHALE+E+  L K      LG++    
Sbjct  79   RCGEFDDCIEKAESAQGMPIKKREKYARREDAILHALELEKQLLKKQG---KLGVESTGV  135

Query  501  --NGGQNLIGELPASSREGIE  557
                 ++ I  LPA S E +E
Sbjct  136  ICKAKRSKIVYLPAESGESLE  156



>ref|XP_012090936.1| PREDICTED: uncharacterized protein At1g51745 [Jatropha curcas]
 gb|KDP21792.1| hypothetical protein JCGZ_00579 [Jatropha curcas]
Length=781

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSG   A   D     +VWVRRRNG WWPG+IL P+EL E +  S R+GTPVKLLG +
Sbjct  1    MGSSGSGAA---DCSIGPIVWVRRRNGSWWPGKILGPDELAECNLTSPRTGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKAFRCGEFDDCIERAESAQGMPIKKREKYARREDAILHALELEKQ  117

Query  453  FLGK  464
             L K
Sbjct  118  LLKK  121



>ref|XP_006573831.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=627

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = +3

Query  123  PIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLE  302
            P+D     +VWVRRRNG WWPGQIL P+ L      S RSGTPVKLLG +D  +DW+NLE
Sbjct  8    PVDCDVGSIVWVRRRNGSWWPGQILGPDHLSASHLTSPRSGTPVKLLGREDASVDWYNLE  67

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFS  482
             SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHAL++ER  L K      
Sbjct  68   KSKRVKAFRCGEFDGCIERAESAQGMPLKKREKYARREDAILHALDLERQML-KTQEKIG  126

Query  483  LG  488
            LG
Sbjct  127  LG  128



>ref|XP_003570168.1| PREDICTED: uncharacterized protein LOC100840926 [Brachypodium 
distachyon]
Length=816

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL  +ELP    +S RSGTPVKLLG +D  +DW+NLE S
Sbjct  20   DTSPGTIVWVRRRNGSWWPGRILGQDELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKS  79

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            KRV+AFRCGE+D CIE+A     + ++K  KY RREDAILHALE+ER  L 
Sbjct  80   KRVKAFRCGEFDACIERAEATQGTLAKKREKYARREDAILHALELERKLLA  130



>ref|XP_004235289.1| PREDICTED: uncharacterized protein At1g51745 [Solanum lycopersicum]
Length=776

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 101/163 (62%), Gaps = 4/163 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E     ++     +VWVRRRNG WWPG+IL   EL     +S RSGTPVKLLG +
Sbjct  1    MGSS-ETEGGMLECDTGSIVWVRRRNGSWWPGKILGTNELSATHLMSPRSGTPVKLLGRE  59

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D CI++A        +K  KY RREDAILHALE+ER 
Sbjct  60   DASVDWYNLEKSKRVKAFRCGEFDDCIKRAEASQGMPPKKREKYARREDAILHALELERL  119

Query  453  FLGKA-NPSFSLGLDKQNGGQ-NLIGELPASSREGIENVNGDY  575
             L K   P +S   DK N    + +G    +S E  EN NG +
Sbjct  120  LLDKKYGPGYS-STDKNNKSTADFVGRESLTSSEYPENGNGRH  161



>ref|XP_008376887.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Malus domestica]
Length=793

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 103/175 (59%), Gaps = 11/175 (6%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            +MGS+        D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG 
Sbjct  3    IMGSADSGAG---DFSVGSIVWVRRRNGSWWPGKIVGPEELSTSHLTSPRSGTPVKLLGR  59

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  +DW+NLE SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+
Sbjct  60   EDASVDWYNLEKSKRVKAFRCGEFDDCIEKAESAQGMPIKKREKYARREDAILHALELEK  119

Query  450  SFLGKANPSFSLGLDKQNGGQNLIGELP-----ASSREGIENVNGDYSSSEDNSR  599
              L K      LG+  +     L G +      +S   GI+NV  + S S  + R
Sbjct  120  QLLKKQG---KLGITSERLNNRLSGAVKKALVISSGSLGIDNVKLENSKSPMSHR  171



>ref|XP_008376888.1| PREDICTED: uncharacterized protein LOC103439999 isoform X2 [Malus 
domestica]
Length=609

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            +MGS+        D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG 
Sbjct  3    IMGSADSGAG---DFSVGSIVWVRRRNGSWWPGKIVGPEELSTSHLTSPRSGTPVKLLGR  59

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  +DW+NLE SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+
Sbjct  60   EDASVDWYNLEKSKRVKAFRCGEFDDCIEKAESAQGMPIKKREKYARREDAILHALELEK  119

Query  450  SFLGK  464
              L K
Sbjct  120  QLLKK  124



>ref|XP_009361204.1| PREDICTED: uncharacterized protein At1g51745-like [Pyrus x bretschneideri]
Length=793

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            VMGS+        D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG 
Sbjct  3    VMGSADSGAG---DFSVGSIVWVRRRNGSWWPGKIVGPEELSTSHLTSPRSGTPVKLLGR  59

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  +DW+NLE SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+
Sbjct  60   EDASVDWYNLEKSKRVKAFRCGEFDDCIEKAESAQGMPIKKREKYARREDAILHALELEK  119

Query  450  SFLGK  464
              L K
Sbjct  120  QLLKK  124



>ref|XP_009351865.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Pyrus 
x bretschneideri]
Length=793

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  19   IVWVRRRNGSWWPGKIVGPEELSTSHLTSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  78

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSLGLDKQNG  506
            RCGE+D CIEKA        +K  KY RREDAILHALE+E+  L K      LG++ +  
Sbjct  79   RCGEFDDCIEKAESAQGMPIKKREKYARREDAILHALELEKQLLKKQG---KLGINSERL  135

Query  507  GQNLIG----ELPASSRE-GIENV  563
               L G    EL  SS   GI+NV
Sbjct  136  NSKLSGVVKKELVISSESLGIDNV  159



>ref|XP_006347560.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Solanum tuberosum]
Length=776

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 99/162 (61%), Gaps = 2/162 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E     ++     +VWVRRRNG WWPG+IL   EL     +S RSGTPVKLLG +
Sbjct  1    MGSS-ETEGGMLECDTGSIVWVRRRNGSWWPGKILGTNELSATHLMSPRSGTPVKLLGRE  59

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D CI++A        +K  KY RREDAILHALE+ER 
Sbjct  60   DASVDWYNLEKSKRVKAFRCGEFDDCIKRAEASQGMPPKKREKYARREDAILHALELERL  119

Query  453  FLGKANPSFSLGLDKQN-GGQNLIGELPASSREGIENVNGDY  575
             L K   +     DK N    + +G    +S E  EN NG +
Sbjct  120  LLDKKYGAGYSSTDKNNKSTADFVGRESLTSSEYPENGNGRH  161



>ref|XP_007131537.1| hypothetical protein PHAVU_011G021400g [Phaseolus vulgaris]
 gb|ESW03531.1| hypothetical protein PHAVU_011G021400g [Phaseolus vulgaris]
Length=734

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 91/149 (61%), Gaps = 17/149 (11%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQIL P++L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  2    MDCGVGSIVWVRRRNGSWWPGQILGPDDLSASHLTSPRSGTPVKLLGREDASVDWYNLEK  61

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK-------  464
            SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+  L K       
Sbjct  62   SKRVKAFRCGEFDDCIEKAESAQGGPLKKREKYARREDAILHALELEKQILKKQGRSGGR  121

Query  465  ----------ANPSFSLGLDKQNGGQNLI  521
                      A+P  +LG D +N   + +
Sbjct  122  PSNTFKKGVFASPPETLGNDNENHASSFM  150



>ref|XP_010549813.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Tarenaya 
hassleriana]
Length=760

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 6/130 (5%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   + P D     +VWVRRRNG WWPG+IL PEEL      S RSGTPVKLLG +
Sbjct  1    MGSPG---SGPSDCTVGSIVWVRRRNGSWWPGKILGPEELDATHLTSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCG++D+CIE+         RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKAFRCGDFDECIERVESAQGLPIRKREKYARREDAILHALELEKE  117

Query  453  FL---GKANP  473
             L   GK+ P
Sbjct  118  MLKNEGKSIP  127



>ref|XP_008234589.1| PREDICTED: uncharacterized protein LOC103333519 isoform X3 [Prunus 
mume]
Length=581

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            VMGS+        D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG 
Sbjct  3    VMGSTESGTG---DFSVGSIVWVRRRNGSWWPGKIVGPEELSASHLTSPRSGTPVKLLGR  59

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  +DW+NLE SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+
Sbjct  60   EDASVDWYNLEKSKRVKAFRCGEFDDCIEKAESSQGMPVKKREKYARREDAILHALELEK  119

Query  450  SFLGK  464
              L K
Sbjct  120  QLLRK  124



>ref|XP_004511545.1| PREDICTED: uncharacterized protein LOC101513863 [Cicer arietinum]
Length=608

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQILC ++L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  7    VDCAVGSIVWVRRRNGSWWPGQILCSDDLSASHLTSPRSGTPVKLLGREDASVDWYNLEK  66

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKAN  470
            SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+ER  L K +
Sbjct  67   SKRVKPFRCGEFDGCIERAESAQGMPLKKREKYARREDAILHALELERQTLKKQD  121



>emb|CBI26559.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 1/154 (1%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGKILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSLGLD-KQN  503
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K      +  D   +
Sbjct  76   RCGEFDDCIERAESSQGIPIKKREKYARREDAILHALELEKQQLAKKQGKLGIASDCTSS  135

Query  504  GGQNLIGELPASSREGIENVNGDYSSSEDNSRSK  605
               N + +   +S E + N NG    S+    SK
Sbjct  136  KSCNAVKKELVTSSESLGNENGKLGISKSQQLSK  169



>ref|XP_008234588.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Prunus 
mume]
Length=715

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            VMGS+        D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG 
Sbjct  3    VMGSTESGTG---DFSVGSIVWVRRRNGSWWPGKIVGPEELSASHLTSPRSGTPVKLLGR  59

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  +DW+NLE SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+
Sbjct  60   EDASVDWYNLEKSKRVKAFRCGEFDDCIEKAESSQGMPVKKREKYARREDAILHALELEK  119

Query  450  SFLGK  464
              L K
Sbjct  120  QLLRK  124



>ref|XP_008234587.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Prunus 
mume]
Length=773

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            VMGS+        D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG 
Sbjct  3    VMGSTESGTG---DFSVGSIVWVRRRNGSWWPGKIVGPEELSASHLTSPRSGTPVKLLGR  59

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            +D  +DW+NLE SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+
Sbjct  60   EDASVDWYNLEKSKRVKAFRCGEFDDCIEKAESSQGMPVKKREKYARREDAILHALELEK  119

Query  450  SFLGK  464
              L K
Sbjct  120  QLLRK  124



>gb|EYU45368.1| hypothetical protein MIMGU_mgv1a018253mg [Erythranthe guttata]
Length=643

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEEL      S RSGTPVKLLG +D  +DW+NLE SKRV+ F
Sbjct  17   IVWVRRRNGSWWPGKILGPEELSSAHITSPRSGTPVKLLGREDASVDWYNLEKSKRVKVF  76

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCGE+D CIE+A        +K  KY RREDAILHALE+ER  + K
Sbjct  77   RCGEFDDCIERAEAAQGMPPKKREKYARREDAILHALELERQIVEK  122



>ref|XP_010243122.1| PREDICTED: uncharacterized protein At1g51745-like [Nelumbo nucifera]
Length=813

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 2/127 (2%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D  A  +VWVRRRNG WWPG+IL P EL     +S RSGTPVKLLG +D  +DW+NLE 
Sbjct  10   VDCSAGTIVWVRRRNGSWWPGRILGPNELSASHLMSPRSGTPVKLLGREDASVDWYNLEK  69

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K      L
Sbjct  70   SKRVKAFRCGEFDDCIERAESSQGVPIKKREKYARREDAILHALELEKQLLEKRQ--LKL  127

Query  486  GLDKQNG  506
            G+   +G
Sbjct  128  GIASTSG  134



>ref|XP_010671152.1| PREDICTED: uncharacterized protein LOC104888033 [Beta vulgaris 
subsp. vulgaris]
Length=807

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  17   IVWVRRRNGSWWPGKILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  76

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            RCGE+D CIE+A       ++K  KY RREDAILHALE+E+ FL
Sbjct  77   RCGEFDDCIERAEASLGFPAKKREKYARREDAILHALELEKQFL  120



>ref|XP_009395771.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395772.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395773.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
Length=799

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  +     I+V A GLVWVRRRNG WWPG+ +   ELP +  +  RSGTP+KLLG +
Sbjct  1    MGSQQDASLSSINVSAGGLVWVRRRNGSWWPGRTVGLHELPVKCLLPPRSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAV---KYNRREDAILHALEI  443
            D  +DW+NLE S RV+AFRCGE+D+CI+KA+  A   S+ +    KY  REDAILHALEI
Sbjct  61   DGSMDWYNLEKSTRVKAFRCGEFDECIQKAMASAVHSSKFSTSTGKYVHREDAILHALEI  120

Query  444  ERSFL  458
            E+S+ 
Sbjct  121  EKSYF  125



>ref|XP_006590768.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=740

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQIL  ++L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  2    MDCGVGSIVWVRRRNGSWWPGQILGHDDLSAAHLTSPRSGTPVKLLGREDASVDWYNLEK  61

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+  L K   S + 
Sbjct  62   SKRVKAFRCGEFDDCIEKAEAAQGGPLKKREKYARREDAILHALELEKQILKKPGKSGAR  121

Query  486  GLDKQNGG  509
             L+  N G
Sbjct  122  SLNAVNKG  129



>ref|XP_007029502.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY10004.1| Tudor/PWWP/MBT superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=777

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+ELP     S R+GTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  15   IVWVRRRNGSWWPGKILGPDELPASHLTSPRTGTPVKLLGREDASVDWYNLEKSKRVKAF  74

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  75   RCGEFDDCIERAESSQGMPPKKREKYARREDAILHALELEKELLRK  120



>ref|XP_010525044.1| PREDICTED: uncharacterized protein At1g51745-like [Tarenaya hassleriana]
Length=767

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +3

Query  105  GECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCI  284
            G  R+ P D     +VWVRRRNG WWPG+IL P+EL      S RSGTPVKLLG +D  +
Sbjct  2    GSPRSGPADCTVGSIVWVRRRNGSWWPGKILGPKELDATHLTSPRSGTPVKLLGREDASV  61

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRCG++D+CIE+         RK  KY RREDAI+HALE+E+  L K
Sbjct  62   DWYNLEKSKRVKAFRCGDFDECIERVESAQGLPIRKREKYARREDAIIHALELEKEMLKK  121



>gb|EMS66663.1| hypothetical protein TRIUR3_34844 [Triticum urartu]
Length=863

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL   ELP    +S RSGTPVKLLG +D  +DW+NLE S
Sbjct  44   DTSPGTIVWVRRRNGSWWPGRILGQSELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKS  103

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
            KRV+AFRCGE+D CIE+A     + S+K  KY RREDAILHALE+ER  
Sbjct  104  KRVKAFRCGEFDACIERAEATQGTLSKKREKYARREDAILHALELERKL  152



>ref|XP_007220250.1| hypothetical protein PRUPE_ppa001649mg [Prunus persica]
 gb|EMJ21449.1| hypothetical protein PRUPE_ppa001649mg [Prunus persica]
Length=786

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG +D  +DW+NLE S
Sbjct  10   DFSVGSIVWVRRRNGSWWPGKIVGPEELSASHLTSPRSGTPVKLLGREDASVDWYNLEKS  69

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            KRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+  L K
Sbjct  70   KRVKAFRCGEFDDCIEKAESSQGMPVKKREKYARREDAILHALELEKQLLRK  121



>gb|EPS71227.1| hypothetical protein M569_03532, partial [Genlisea aurea]
Length=620

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 84/124 (68%), Gaps = 1/124 (1%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS +     +D     +VWVRRRNG WWPG+IL PEEL      S RSGTPVKLLG +
Sbjct  1    MGSS-DTGGGLVDCSVGSIVWVRRRNGSWWPGKILGPEELSVAHVSSPRSGTPVKLLGRE  59

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+ER 
Sbjct  60   DASVDWYNLEKSKRVKPFRCGEFDACIERAEAAQGMPPKKREKYARREDAILHALELERH  119

Query  453  FLGK  464
             + K
Sbjct  120  TIEK  123



>ref|XP_006592019.1| PREDICTED: uncharacterized protein At1g51745-like [Glycine max]
Length=740

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQIL P++L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  2    MDCGVGSIVWVRRRNGSWWPGQILGPDDLSASHLTSPRSGTPVKLLGREDASVDWYNLEK  61

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+    K   S + 
Sbjct  62   SKRVKAFRCGEFDDCIEKAETAQGGPLKKREKYARREDAILHALELEKQISKKPGKSSAS  121

Query  486  GLD  494
             L+
Sbjct  122  SLN  124



>ref|XP_002274927.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Vitis 
vinifera]
Length=838

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 1/154 (1%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGKILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSLGLD-KQN  503
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K      +  D   +
Sbjct  76   RCGEFDDCIERAESSQGIPIKKREKYARREDAILHALELEKQQLAKKQGKLGIASDCTSS  135

Query  504  GGQNLIGELPASSREGIENVNGDYSSSEDNSRSK  605
               N + +   +S E + N NG    S+    SK
Sbjct  136  KSCNAVKKELVTSSESLGNENGKLGISKSQQLSK  169



>ref|XP_007157030.1| hypothetical protein PHAVU_002G037800g [Phaseolus vulgaris]
 gb|ESW29024.1| hypothetical protein PHAVU_002G037800g [Phaseolus vulgaris]
Length=627

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQIL P+ L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  9    VDCDVGSIVWVRRRNGSWWPGQILGPDHLSASHLTSPRSGTPVKLLGREDASVDWYNLEK  68

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+ER  L K
Sbjct  69   SKRVKTFRCGEFDGCIERAESAQGIPLKKREKYARREDAILHALELERQILKK  121



>gb|KHN46442.1| Hypothetical protein glysoja_035118 [Glycine soja]
Length=740

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQIL P++L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  2    MDCGVGSIVWVRRRNGSWWPGQILGPDDLSAAHLTSPRSGTPVKLLGREDASVDWYNLEK  61

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGE+D CIEKA        +K  KY RREDAILHALE+E+    K   S + 
Sbjct  62   SKRVKAFRCGEFDDCIEKAETAQGGPLKKREKYARREDAILHALELEKQISKKPGKSSAS  121

Query  486  GLD  494
             L+
Sbjct  122  SLN  124



>emb|CAN77845.1| hypothetical protein VITISV_020829 [Vitis vinifera]
Length=797

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 96/154 (62%), Gaps = 1/154 (1%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGKILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSLGLD-KQN  503
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K      +  D   +
Sbjct  76   RCGEFDDCIERAESSQGIPIKKREKYARREDAILHALELEKQQLAKKQGKLGIASDCTSS  135

Query  504  GGQNLIGELPASSREGIENVNGDYSSSEDNSRSK  605
               N + +   +S E + N NG    S+    SK
Sbjct  136  KSCNAVKKELVTSSESLGNENGKLGISKSQQLSK  169



>ref|XP_010034956.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Eucalyptus 
grandis]
 gb|KCW46191.1| hypothetical protein EUGRSUZ_K00094 [Eucalyptus grandis]
Length=744

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = +3

Query  96   GSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKD  275
            G SG+C    + +    +VWVRRRNG WWPG+IL P+EL      S R+GTPVKLLG +D
Sbjct  5    GGSGDCG---VGLGVGSIVWVRRRNGSWWPGKILGPDELSTAHLTSPRAGTPVKLLGRED  61

Query  276  TCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
              +DW+NLE SKRV+AFRCGE+D+CIE+A        +K  KY RREDAILHALE+E+  
Sbjct  62   ASVDWYNLEKSKRVKAFRCGEFDECIERAESSQGMPMKKREKYARREDAILHALELEKEM  121

Query  456  LGK  464
            L K
Sbjct  122  LRK  124



>emb|CDP04947.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL P++L     +S RSGTPVKLLG +D  +DW+NLE S
Sbjct  11   DCSIGSIVWVRRRNGSWWPGKILGPDDLSASHVMSPRSGTPVKLLGREDASVDWYNLEKS  70

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            KRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+ER  L K
Sbjct  71   KRVKAFRCGEFDDCIERAEASQGMPPKKREKYARREDAILHALELERQMLEK  122



>ref|XP_010558652.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010558654.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Tarenaya hassleriana]
Length=773

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MG  G   + P D     +VWVRRRNG WWPG+I+ PEEL     +S RSGTPVKLLG +
Sbjct  1    MGGPG---SGPADCTVGSIVWVRRRNGSWWPGKIVGPEELDATHLMSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCG++D+CIE+         RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKAFRCGDFDECIERVESAQGIPMRKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             + K
Sbjct  118  IMKK  121



>ref|XP_002520007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42331.1| conserved hypothetical protein [Ricinus communis]
Length=757

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL P+EL E +  S R+GTPVKLLG +D  +DW+NLE 
Sbjct  9    VDYGIGPIVWVRRRNGSWWPGKILEPDELAECNLTSPRTGTPVKLLGREDASVDWYNLEK  68

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  69   SKRVKAFRCGEFDDCIERAESAQGMPIKKREKYARREDAILHALELEKELLRK  121



>ref|XP_006347475.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum tuberosum]
Length=743

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E  +   D     +VWVRRRNG WWPG+ILCP+E      +S RSGTPVKLLG +
Sbjct  1    MGSS-EIESGTGDCGVGSIVWVRRRNGSWWPGKILCPDEFSASHLMSPRSGTPVKLLGRE  59

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D  I++A        +K  KY RREDAILHALE+ER 
Sbjct  60   DASVDWYNLEKSKRVKAFRCGEFDDFIQRAEASLGLPPKKREKYARREDAILHALELERQ  119

Query  453  FLGKANPSFSL-GLDKQNGGQ-NLIGELPASSREGIENVNG  569
             LGK   S      D+ N    +  G    +S + +EN NG
Sbjct  120  -LGKRYGSLGCSSTDRTNKSTCDFSGRESQTSSKYLENRNG  159



>ref|XP_008797875.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=830

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MG   +   K I   A GLVWVRRRNG WWPG+IL  +ELP +  +  RSGTP+KLLG +
Sbjct  1    MGGDQDGCLKGIAASAGGLVWVRRRNGSWWPGRILGWDELPAKCLLPPRSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRK---AVKYNRREDAILHALEI  443
            D  +DW+NLE SKRV+AFRC EYD+CIE+A   A    +K   A KY RREDAILHALEI
Sbjct  61   DGSMDWYNLEKSKRVKAFRCREYDECIERAKASAVCSKKKPANAGKYVRREDAILHALEI  120

Query  444  ERSFLGKAN  470
            E+++    N
Sbjct  121  EKAYFSNRN  129



>ref|XP_010662138.1| PREDICTED: uncharacterized protein LOC100254467 isoform X2 [Vitis 
vinifera]
Length=649

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGKILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  76   RCGEFDDCIERAESSQGIPIKKREKYARREDAILHALELEKQQLAK  121



>gb|KHG23776.1| hypothetical protein F383_28480 [Gossypium arboreum]
Length=776

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P ELP     S R+GTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  15   IVWVRRRNGSWWPGKILGPAELPASHLASPRTGTPVKLLGREDASVDWYNLEKSKRVKAF  74

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  75   RCGEFDDCIERAESSLGVPPKKREKYARREDAILHALELEKELLRK  120



>ref|XP_003610874.1| hypothetical protein MTR_5g007980 [Medicago truncatula]
 gb|AES93832.1| tudor/PWWP/MBT superfamily protein [Medicago truncatula]
Length=621

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     LVWVRRRNG WWPGQIL P++L      S RSGTPVKLLG +D  +DW+NLE S
Sbjct  10   DCAVGSLVWVRRRNGSWWPGQILDPDDLAASHLTSPRSGTPVKLLGREDASVDWYNLEKS  69

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKAN  470
            KRV+ FRCGE+D  IE+A        +K  KY RREDAILHALE+ER  L K +
Sbjct  70   KRVKPFRCGEFDASIERAETALGMPLKKREKYARREDAILHALELERQMLRKQD  123



>dbj|BAJ91774.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPG+IL  +ELPE   V  RS GTP+KLLG  D  IDW+NLE 
Sbjct  27   DAEVGALVWVRRRNGSWWPGRILGQDELPENCVVPPRSAGTPIKLLGRPDGSIDWYNLEK  86

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERSFL  458
            SKRV+AFRCGEY++CIEKA ++A    R     KY RREDAI+HALEIERS L
Sbjct  87   SKRVKAFRCGEYEECIEKAKILARQQKRTYNEGKYVRREDAIMHALEIERSRL  139



>ref|XP_009402955.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=850

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            ++WVRRRNG WWPG+IL PEEL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  21   IIWVRRRNGSWWPGRILGPEELSVSHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  80

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            RCGE+D CIEKA        +K  KY RREDAILHALE+ER  L
Sbjct  81   RCGEFDACIEKAEASLGVPIKKREKYARREDAILHALELERKQL  124



>ref|XP_009402956.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=849

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            ++WVRRRNG WWPG+IL PEEL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  21   IIWVRRRNGSWWPGRILGPEELSVSHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  80

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            RCGE+D CIEKA        +K  KY RREDAILHALE+ER  L
Sbjct  81   RCGEFDACIEKAEASLGVPIKKREKYARREDAILHALELERKQL  124



>gb|KHN25604.1| Hypothetical protein glysoja_018178 [Glycine soja]
Length=647

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +3

Query  123  PIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLE  302
            P+D     +VWVRRRNG W PGQIL P+ L      S RSGTPVKLLG +D  +DW+NLE
Sbjct  8    PVDCDVGSIVWVRRRNGSWGPGQILGPDHLSASHLTSPRSGTPVKLLGREDASVDWYNLE  67

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
             SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHAL++ER  L
Sbjct  68   KSKRVKAFRCGEFDGCIERAESAQGMPLKKREKYARREDAILHALDLERQML  119



>ref|XP_010087499.1| hypothetical protein L484_019705 [Morus notabilis]
 gb|EXB29180.1| hypothetical protein L484_019705 [Morus notabilis]
Length=815

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS+    A    V    +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG +
Sbjct  1    MGSTDSGTAAEFSV--GSIVWVRRRNGSWWPGKIVGPEELSASHLTSPRSGTPVKLLGRE  58

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+ 
Sbjct  59   DASVDWYNLEKSKRVKAFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHALELEKQ  118

Query  453  FLGK  464
             + K
Sbjct  119  QMKK  122



>ref|XP_003569211.1| PREDICTED: uncharacterized protein LOC100833692 [Brachypodium 
distachyon]
Length=760

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 82/117 (70%), Gaps = 3/117 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPG+IL  +ELPE   V  RS GTP+KLLG  D  IDW+NLE 
Sbjct  18   DAEVGALVWVRRRNGSWWPGRILGQDELPENCVVPPRSAGTPIKLLGRPDGSIDWYNLEK  77

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSR--KAVKYNRREDAILHALEIERSFLGKAN  470
            SKRV+AFRCGEY++CIEKA ++A    R     KY RREDAILHALEIERS     N
Sbjct  78   SKRVKAFRCGEYEECIEKAKVLAHQHKRAYNEGKYVRREDAILHALEIERSRFPDEN  134



>ref|XP_004307887.1| PREDICTED: uncharacterized protein LOC101303560 [Fragaria vesca 
subsp. vesca]
Length=745

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+I+ PEEL      S RSGTPVKLLG +D  +DW+NLE S
Sbjct  8    DFSVGSIVWVRRRNGSWWPGKIVGPEELSTSHLTSPRSGTPVKLLGREDASVDWYNLEKS  67

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            KRV+ FRCG++D CI KA        +K  KY RREDAILHALE+ER  L K
Sbjct  68   KRVKPFRCGDFDDCIHKAESAQGMPPKKREKYARREDAILHALELERELLRK  119



>gb|KJB83995.1| hypothetical protein B456_013G180600 [Gossypium raimondii]
Length=776

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEELP     S R GTPVKLLG +D  +DW+NLE SKRV+ F
Sbjct  15   IVWVRRRNGSWWPGKILGPEELPASHLASPRIGTPVKLLGREDASVDWYNLEKSKRVKEF  74

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  75   RCGEFDDCIERAESSQGVPPKKREKYARREDAILHALELEKELLRK  120



>ref|XP_010322496.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum lycopersicum]
Length=741

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 85/125 (68%), Gaps = 2/125 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSS E      D     +VWVRRRNG WWPG+ILCP+E      +S RSGTPVKLLG +
Sbjct  1    MGSS-ETELGTGDCGVGSIVWVRRRNGSWWPGKILCPDEFSASHLMSPRSGTPVKLLGRE  59

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D  I++A        +K  KY RREDAILHALE+ER 
Sbjct  60   DATVDWYNLEKSKRVKAFRCGEFDDFIQRAEASLGLPPKKREKYARREDAILHALELERQ  119

Query  453  FLGKA  467
             LGK 
Sbjct  120  -LGKT  123



>ref|XP_008785043.1| PREDICTED: uncharacterized protein At1g51745 [Phoenix dactylifera]
Length=822

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE 
Sbjct  14   VDCSVGTIVWVRRRNGSWWPGRILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEK  73

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+
Sbjct  74   SKRVKAFRCGEFDACIERAEAAQGIPIKKREKYARREDAILHALELEK  121



>ref|XP_009402986.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=847

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  21   IVWVRRRNGSWWPGRILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  80

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            RCGE+D CIEKA        +K  KY RREDAILHALE+ER  L
Sbjct  81   RCGEFDACIEKAEASLGVPIKKREKYARREDAILHALELERKQL  124



>ref|XP_010943463.1| PREDICTED: uncharacterized protein At1g51745 [Elaeis guineensis]
Length=827

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE 
Sbjct  14   VDCSVGTIVWVRRRNGSWWPGRILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEK  73

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+
Sbjct  74   SKRVKAFRCGEFDACIERAEAAQGIPIKKREKYARREDAILHALELEK  121



>gb|EMS65717.1| hypothetical protein TRIUR3_22307 [Triticum urartu]
Length=847

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+I+  EEL     V+ R+GTPVKLLG +D  IDW+NLE S
Sbjct  25   DCSPGTIVWVRRRNGSWWPGRIVGQEELAASQVVTPRTGTPVKLLGREDASIDWYNLEKS  84

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            KRV+ FRCGE+D CIEKA+    +  ++  KY RREDAILHALE+ER  L 
Sbjct  85   KRVKEFRCGEFDACIEKAMAFQGTPVKRREKYARREDAILHALELERKQLA  135



>ref|XP_008451676.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Cucumis 
melo]
Length=735

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   +  +D     +VWVRRRNG WWPG+IL  +EL      S RSGTPVKLLG +
Sbjct  1    MGSPG---SGAVDYAVGSIVWVRRRNGSWWPGKILGSDELSSSHLTSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             L K
Sbjct  118  LLNK  121



>ref|XP_010918108.1| PREDICTED: uncharacterized protein LOC105042543 [Elaeis guineensis]
Length=847

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE 
Sbjct  14   VDCSVGTIVWVRRRNGSWWPGRILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEK  73

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            SKRV+AFRCG++D CIE+A        +K  KY RREDAILHALE+E+  L
Sbjct  74   SKRVKAFRCGDFDACIERAEAAQGVPIKKREKYARREDAILHALELEKKQL  124



>ref|XP_009402985.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=868

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV+AF
Sbjct  21   IVWVRRRNGSWWPGRILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEKSKRVKAF  80

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            RCGE+D CIEKA        +K  KY RREDAILHALE+ER  L
Sbjct  81   RCGEFDACIEKAEASLGVPIKKREKYARREDAILHALELERKQL  124



>ref|XP_010690078.1| PREDICTED: uncharacterized protein At1g51745 [Beta vulgaris subsp. 
vulgaris]
Length=710

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 108/185 (58%), Gaps = 9/185 (5%)
 Frame = +3

Query  96   GSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKD  275
            GS+ E   K +D    GLVWVRRRNG WWPGQI+  +EL E    S RSGTPVKLLG  D
Sbjct  5    GSNEEEGRKRLDETVGGLVWVRRRNGSWWPGQIVGVDELSENGVSSPRSGTPVKLLGRDD  64

Query  276  TCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
            + +DW++LE +K ++AFRCGEYD CIE+A +      ++++KY RRE AI+ ALEIE + 
Sbjct  65   SSVDWYDLETTKGIKAFRCGEYDNCIEQAKISGPKFLKRSLKYPRREIAIIRALEIENTC  124

Query  456  LGKANPSFSLGLD------KQNGGQNL---IGELPASSREGIENVNGDYSSSEDNSRSKP  608
            L K  PS +   D      ++NG  +      +   SS+E              NS S  
Sbjct  125  LFKDAPSLNDKPDNGRPVNRENGTASTSRPTKDSECSSKETSSEETASAREENSNSNSTQ  184

Query  609  KLSHS  623
            +LSHS
Sbjct  185  ELSHS  189



>ref|XP_004505617.1| PREDICTED: uncharacterized protein At1g51745-like [Cicer arietinum]
Length=741

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPGQI+ P+++      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  1    MDFGVGSIVWVRRRNGSWWPGQIIDPDDIAASHLTSPRSGTPVKLLGREDASVDWYNLEK  60

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            SKRV+AFRCGE+D+CIE+         +K  KY RREDA+LHALE+ER  + K
Sbjct  61   SKRVKAFRCGEFDECIERVESSHEMPLKKREKYARREDAVLHALELERQLVKK  113



>emb|CDY23461.1| BnaC04g49890D [Brassica napus]
Length=715

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSG   +  +D     +VWVRRRNG WWPG+IL  ++L   +  S RSGTPVKLLG +
Sbjct  1    MGSSG---SGAVDWKVGSIVWVRRRNGSWWPGRILGQDDLDSNTITSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCG++D CIEK         RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGDFDDCIEKVETSQGLTVRKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             L K
Sbjct  118  ILKK  121



>gb|ERN15621.1| hypothetical protein AMTR_s00048p00187700 [Amborella trichopoda]
Length=719

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MG +     KP++     +VWVRRRNG WWPG+IL   EL     +S RSGTPVKLLG +
Sbjct  1    MGLADGSNGKPVNSSVGSIVWVRRRNGSWWPGRILGLNELSATHLMSPRSGTPVKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D CI +A       ++K  KY RREDAILHALE+E+ 
Sbjct  61   DASVDWYNLEKSKRVKAFRCGEFDDCIGRAESSQGMPAKKREKYARREDAILHALELEKQ  120

Query  453  FL  458
             L
Sbjct  121  LL  122



>ref|XP_009626996.1| PREDICTED: uncharacterized protein At1g51745 [Nicotiana tomentosiformis]
Length=761

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +3

Query  138  ASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRV  317
            A  +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV
Sbjct  6    AGSIVWVRRRNGSWWPGKILGPDELSASHLISPRSGTPVKLLGREDASVDWYNLEKSKRV  65

Query  318  RAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL-GLD  494
            +AFRCGE+D+ I++A        +K  KY RREDAILHALE+E+  L K          D
Sbjct  66   KAFRCGEFDELIQRAETSLGMPPKKREKYARREDAILHALELEKQQLDKRYGGLGCSSTD  125

Query  495  KQNGGQNL-IGELPASSREGIENVNG  569
            + N   ++ IG    +S + +EN NG
Sbjct  126  RSNTSIDVFIGRESRTSSKYLENGNG  151



>ref|XP_006299220.1| hypothetical protein CARUB_v10015369mg [Capsella rubella]
 gb|EOA32118.1| hypothetical protein CARUB_v10015369mg [Capsella rubella]
Length=761

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   A   D     +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +
Sbjct  1    MGSPGSVAA---DWTVGSIVWVRRRNGSWWPGKILGQEDLDSTHITSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCG++D+CIE+     A   RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGDFDECIERVESSQALTIRKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             L K
Sbjct  118  MLKK  121



>ref|XP_010278764.1| PREDICTED: uncharacterized protein At1g51745 [Nelumbo nucifera]
Length=850

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 94/152 (62%), Gaps = 9/152 (6%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL   EL     +S RSGTPVKLLG +D  +DW+NLE 
Sbjct  10   VDCSVGTIVWVRRRNGSWWPGRILGENELSASHLMSPRSGTPVKLLGREDASVDWYNLEK  69

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL  485
            SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K       
Sbjct  70   SKRVKAFRCGEFDDCIERAESAQGIPIKKREKYARREDAILHALELEKQLLEKRQQKL--  127

Query  486  GLDKQNGGQNLIGELP-ASSREGIENVNGDYS  578
                  G  + I ++P A  +E  EN+  D++
Sbjct  128  ------GVASPIRKIPGAPKKEAAENLGSDHA  153



>ref|XP_004137270.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Cucumis 
sativus]
Length=735

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   +  +D     +VWVRRRNG WWPG+IL  ++L      S RSGTPVKLLG +
Sbjct  1    MGSPG---SGAVDYAVGSIVWVRRRNGSWWPGKILGSDDLSSSHLTSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             L K
Sbjct  118  LLNK  121



>ref|XP_006854154.2| PREDICTED: uncharacterized protein At1g51745 [Amborella trichopoda]
Length=760

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 83/122 (68%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MG +     KP++     +VWVRRRNG WWPG+IL   EL     +S RSGTPVKLLG +
Sbjct  42   MGLADGSNGKPVNSSVGSIVWVRRRNGSWWPGRILGLNELSATHLMSPRSGTPVKLLGRE  101

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+AFRCGE+D CI +A       ++K  KY RREDAILHALE+E+ 
Sbjct  102  DASVDWYNLEKSKRVKAFRCGEFDDCIGRAESSQGMPAKKREKYARREDAILHALELEKQ  161

Query  453  FL  458
             L
Sbjct  162  LL  163



>ref|XP_002455796.1| hypothetical protein SORBIDRAFT_03g025340 [Sorghum bicolor]
 gb|EES00916.1| hypothetical protein SORBIDRAFT_03g025340 [Sorghum bicolor]
Length=737

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPG+IL  +ELPE   +  RS GTP+KLLG  D  IDW+NLE 
Sbjct  19   DAEVGALVWVRRRNGSWWPGRILGMDELPENIVIPPRSAGTPIKLLGRPDGSIDWYNLEK  78

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERS  452
            SKRV++FRCGEYD+CIEKA ++A    R     +Y RREDAI+HALEIERS
Sbjct  79   SKRVKSFRCGEYDECIEKAKVLARQQKRTHTEGRYVRREDAIMHALEIERS  129



>ref|XP_009783633.1| PREDICTED: uncharacterized protein At1g51745-like [Nicotiana 
sylvestris]
Length=761

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +3

Query  138  ASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRV  317
            A  +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE SKRV
Sbjct  6    AGSIVWVRRRNGSWWPGKILGPDELSASHLISPRSGTPVKLLGREDASVDWYNLEKSKRV  65

Query  318  RAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSFSL-GLD  494
            +AFRCGE+D+ I++A        +K  KY RREDAILHALE+E+  L K          D
Sbjct  66   KAFRCGEFDELIQRAESSLGMPPKKREKYARREDAILHALELEKQQLDKRYGGLGCSSTD  125

Query  495  KQNGGQNL-IGELPASSREGIENVNG  569
            + N   ++ IG    +S + +EN NG
Sbjct  126  RSNTSIDVFIGRESRTSSKYLENGNG  151



>ref|XP_009410801.1| PREDICTED: uncharacterized protein At1g51745-like [Musa acuminata 
subsp. malaccensis]
Length=807

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 11/145 (8%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  +      +V A GLVWVRR NG WWPG+++  +ELP +  +  RSGTP+KLLG +
Sbjct  1    MGSEQDGILSSNNVSAGGLVWVRRPNGSWWPGRVVGRDELPAKCVLPPRSGTPIKLLGRE  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAV---KYNRREDAILHALEI  443
            D  +DW+NL  S RV+AFRCGE+D+CI+KA+  A    + +    KY RREDAILHALEI
Sbjct  61   DGSMDWYNLAKSTRVKAFRCGEFDECIQKAMAFAIRSKKSSTSTGKYIRREDAILHALEI  120

Query  444  ERSFL--GKAN------PSFSLGLD  494
            E+++   GK N      P  ++G D
Sbjct  121  EKAYFLTGKQNGSGVKDPFRTMGYD  145



>ref|XP_009119103.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
Length=716

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGSSG   +  +D     +VWVRRRNG WWPG+IL  ++L   +  S RSGTPVKLLG +
Sbjct  1    MGSSG---SGAVDWKVGLIVWVRRRNGSWWPGRILGQDDLDSNTITSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCG++D CIEK         RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGDFDDCIEKVETSQGLTVRKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             L K
Sbjct  118  ILKK  121



>gb|EMT12743.1| hypothetical protein F775_06428 [Aegilops tauschii]
Length=848

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+I+  +EL     V+ R+GTPVKLLG +D  IDW+NLE S
Sbjct  25   DCSPGTIVWVRRRNGSWWPGRIVGQDELAASQVVTPRTGTPVKLLGREDASIDWYNLEKS  84

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            KRV+ FRCGE+D CIEKA+    +  ++  KY RREDAI+HALE+ER  L 
Sbjct  85   KRVKEFRCGEFDACIEKAMACQGTPVKRREKYARREDAIIHALELERKQLA  135



>ref|XP_008800030.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=851

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL P+EL     +S RSGTPVKLLG +D  +DW+NLE 
Sbjct  14   VDCSVGTIVWVRRRNGSWWPGRILGPDELSASHLMSPRSGTPVKLLGREDASVDWYNLEK  73

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            SKRV+AFRCGE+  CIE+A        +K  KY RREDAILHALE+E+
Sbjct  74   SKRVKAFRCGEFGACIERAEAAQGVPIKKREKYARREDAILHALELEK  121



>ref|XP_004968966.1| PREDICTED: uncharacterized protein At1g51745-like [Setaria italica]
Length=717

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPG+IL  +ELPE + +  RS GTP+KLLG  D  IDW+NLE 
Sbjct  19   DAEVGALVWVRRRNGSWWPGRILGMDELPENTVIPPRSAGTPIKLLGRPDGSIDWYNLEK  78

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERS  452
            SKRV++FRCGEYD+CI+KA  +A    +     +Y RREDAI+HALEIERS
Sbjct  79   SKRVKSFRCGEYDECIQKAKALARHQKKTQTEGRYVRREDAIIHALEIERS  129



>emb|CDM83021.1| unnamed protein product [Triticum aestivum]
Length=759

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPG+IL  +ELPE   V  RS GTP+KLLG  D  IDW+NLE 
Sbjct  18   DAEVGALVWVRRRNGSWWPGRILGQDELPENCVVPPRSAGTPIKLLGRPDGSIDWYNLEK  77

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERS  452
            SKRV+AFRCGEY++CIEKA  +A    R     KY RREDAI+HALEIERS
Sbjct  78   SKRVKAFRCGEYEECIEKAKNLARQQKRTYNEGKYVRREDAIMHALEIERS  128



>ref|XP_010506908.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
 ref|XP_010506986.1| PREDICTED: uncharacterized protein At1g51745 [Camelina sativa]
Length=765

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G       D     +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +
Sbjct  1    MGSPGSGSP---DWTVGSIVWVRRRNGSWWPGKILGQEDLDSTHITSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCG++D+CIE+     A   RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGDFDECIERVESSQALTIRKREKYARREDAILHALELEKD  117

Query  453  FLGK  464
             L K
Sbjct  118  LLKK  121



>ref|XP_010463763.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
Length=756

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +D  +DW+NLE SKRV+ F
Sbjct  16   IVWVRRRNGSWWPGKILGQEDLDSTHITSPRSGTPVKLLGREDASVDWYNLEKSKRVKPF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCG++D+CIE+     A   RK  KY RREDAILHALE+E+  L K
Sbjct  76   RCGDFDECIERVESSQALTIRKREKYARREDAILHALELEKDLLKK  121



>ref|XP_010485649.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
 ref|XP_010485650.1| PREDICTED: uncharacterized protein At1g51745-like [Camelina sativa]
Length=765

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G       D     +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +
Sbjct  1    MGSPGSGSP---DWTVGSIVWVRRRNGSWWPGKILGQEDLDSTHITSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCG++D+CIE+     A   RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGDFDECIERVESSQALTIRKREKYARREDAILHALELEKD  117

Query  453  FLGK  464
             L K
Sbjct  118  LLKK  121



>gb|EEE54805.1| hypothetical protein OsJ_02221 [Oryza sativa Japonica Group]
Length=731

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPGQIL  +ELPE   V  RS GTP+KLLG  D  IDW+NLE 
Sbjct  21   DAEVGALVWVRRRNGSWWPGQILSADELPENCVVPPRSSGTPIKLLGRPDGSIDWYNLEK  80

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSR--KAVKYNRREDAILHALEIERS  452
            SKRV+ FRCGEY++CIEKA   A    R     KY RREDAI+HALE+ER+
Sbjct  81   SKRVKPFRCGEYEECIEKAKAQARQHKRAYNEGKYVRREDAIMHALELERA  131



>ref|NP_001043335.1| Os01g0558500 [Oryza sativa Japonica Group]
 dbj|BAB85386.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC00676.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05249.1| Os01g0558500 [Oryza sativa Japonica Group]
 gb|EAY74529.1| hypothetical protein OsI_02419 [Oryza sativa Indica Group]
Length=774

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKDTCIDWHNLEN  305
            D     LVWVRRRNG WWPGQIL  +ELPE   V  RS GTP+KLLG  D  IDW+NLE 
Sbjct  21   DAEVGALVWVRRRNGSWWPGQILSADELPENCVVPPRSSGTPIKLLGRPDGSIDWYNLEK  80

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSR--KAVKYNRREDAILHALEIERS  452
            SKRV+ FRCGEY++CIEKA   A    R     KY RREDAI+HALE+ER+
Sbjct  81   SKRVKPFRCGEYEECIEKAKAQARQHKRAYNEGKYVRREDAIMHALELERA  131



>ref|XP_006408337.1| hypothetical protein EUTSA_v10020126mg [Eutrema salsugineum]
 gb|ESQ49790.1| hypothetical protein EUTSA_v10020126mg [Eutrema salsugineum]
Length=765

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 81/124 (65%), Gaps = 3/124 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   A   D     +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +
Sbjct  1    MGSPGSGAA---DWTVGSIVWVRRRNGSWWPGKILGQEDLDSTHITSPRSGTPVKLLGRE  57

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+NLE SKRV+ FRCG++D CIE+         RK  KY RREDAILHALE+E+ 
Sbjct  58   DASVDWYNLEKSKRVKPFRCGDFDDCIERVESSQGLTIRKREKYARREDAILHALELEKE  117

Query  453  FLGK  464
             L K
Sbjct  118  MLKK  121



>ref|XP_011011282.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Populus euphratica]
Length=782

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPGQI+  +EL E +  S R+GTPVKLLG  D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGQIMEADELAEYNLTSPRTGTPVKLLGRDDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPS  476
            RC E+  CIE+A        +K  KY RREDAILHALE+E+  L K   S
Sbjct  76   RCAEFSDCIERAESAMGMPIKKREKYARREDAILHALELEKQLLRKQGAS  125



>ref|XP_010227249.1| PREDICTED: uncharacterized protein At1g51745-like [Brachypodium 
distachyon]
Length=791

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL P+EL     VS ++GTPVKLLG  D  +DW+NLE S
Sbjct  24   DCSPGTIVWVRRRNGSWWPGRILGPDELRASQVVSPKTGTPVKLLGRDDASVDWYNLEKS  83

Query  309  KRVRAFRCGEYDKCIEKALLVAASGS--RKAVKYNRREDAILHALEIERSFLG  461
            KRV+ FRCG++D CIEKA+ ++  G+  ++  KY RREDAILHAL++E   L 
Sbjct  84   KRVKEFRCGDFDACIEKAMAMSCQGTPVKRREKYARREDAILHALKLESKQLA  136



>gb|EMT25308.1| hypothetical protein F775_01904 [Aegilops tauschii]
Length=838

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG W PG+I    ELP    +S RSGTPVKLLG +D  +DW+NLE S
Sbjct  20   DTSPGTIVWVRRRNGSWRPGRIPGQAELPPSQIMSPRSGTPVKLLGREDASVDWYNLEKS  79

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
            KRV+AFRCGE+D CIE+A     + S+K  KY RREDAILHALE+ER  
Sbjct  80   KRVKAFRCGEFDACIERAEATQGTLSKKREKYARREDAILHALELERKL  128



>emb|CDY49929.1| BnaCnng18390D [Brassica napus]
Length=713

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL  ++L   +  S RSGTPVKLLG +D  +DW+NLE SKRV+ F
Sbjct  12   IVWVRRRNGSWWPGRILGQDDLDSNTITSPRSGTPVKLLGREDASVDWYNLEKSKRVKPF  71

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCG++D CIEK         RK  KY RREDAILHALE+E+  L K
Sbjct  72   RCGDFDDCIEKVETSQGLTVRKREKYARREDAILHALELEKEILKK  117



>ref|XP_002325377.2| hypothetical protein POPTR_0019s07270g [Populus trichocarpa]
 gb|EEE99758.2| hypothetical protein POPTR_0019s07270g [Populus trichocarpa]
Length=782

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPGQI+  +EL E +  S R+GTPVKLLG  D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGQIMEADELAEYNLTSPRTGTPVKLLGRDDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPS  476
            RC E+  CIE+A        +K  KY RREDAILHALE+E+  L K   S
Sbjct  76   RCAEFSDCIERAESALGMPIKKREKYARREDAILHALELEKQLLRKQGAS  125



>gb|KHG02245.1| hypothetical protein F383_26198 [Gossypium arboreum]
Length=778

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  VWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAFR  329
            VWVRRRNG WWPG+IL PEELP    +S R+GTPVKLLG +D  +DW+NLE SKRV+AFR
Sbjct  16   VWVRRRNGSWWPGKILGPEELPTSHLMSPRTGTPVKLLGREDASVDWYNLEKSKRVKAFR  75

Query  330  CGEYDKCIEKALLVAASGSRKAVKYNRREDAILHA  434
            CGE+D CIE+A        +K  KY RREDAILHA
Sbjct  76   CGEFDDCIERAESSQGMPPKKREKYARREDAILHA  110



>dbj|BAF01144.1| hypothetical protein [Arabidopsis thaliana]
Length=769

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  9    VDWTVGSIVWVRRRNGSWWPGRILGQEDLDSTHITSPRSGTPVKLLGREDASVDWYNLEK  68

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            SKRV+ FRCG++D+CIE+     A   +K  KY RREDAILHALE+E+  L +
Sbjct  69   SKRVKPFRCGDFDECIERVESSQAMIIKKREKYARREDAILHALELEKEMLKR  121



>ref|NP_186964.1| PWWP domain-containing protein [Arabidopsis thaliana]
 gb|AAF26110.1|AC012328_13 hypothetical protein [Arabidopsis thaliana]
 gb|AEE73906.1| PWWP domain-containing protein [Arabidopsis thaliana]
Length=769

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL  E+L      S RSGTPVKLLG +D  +DW+NLE 
Sbjct  9    VDWTVGSIVWVRRRNGSWWPGRILGQEDLDSTHITSPRSGTPVKLLGREDASVDWYNLEK  68

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            SKRV+ FRCG++D+CIE+     A   +K  KY RREDAILHALE+E+  L +
Sbjct  69   SKRVKPFRCGDFDECIERVESSQAMIIKKREKYARREDAILHALELEKEMLKR  121



>gb|KJB18410.1| hypothetical protein B456_003G051500 [Gossypium raimondii]
Length=778

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  VWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAFR  329
            VWVRRRNG WWPG+IL PEELP    +S R+GTPVKLLG +D  +DW+NLE SKRV+AFR
Sbjct  16   VWVRRRNGSWWPGKILGPEELPTSHLMSPRTGTPVKLLGREDASVDWYNLEKSKRVKAFR  75

Query  330  CGEYDKCIEKALLVAASGSRKAVKYNRREDAILHA  434
            CGE+D CIE+A        +K  KY RREDAILHA
Sbjct  76   CGEFDDCIERAESSQGMPPKKREKYARREDAILHA  110



>emb|CDY28740.1| BnaCnng06260D [Brassica napus]
Length=736

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            D     +VWVRRRNG WWPG+IL  ++L      S RSGTPVKLLG +D  +DW+NLE S
Sbjct  6    DCTVGSIVWVRRRNGSWWPGKILGQDDLDSTHITSPRSGTPVKLLGREDASVDWYNLEKS  65

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            KRV+ FRCG++D CIEK         RK  KY RREDAILHALE+E+  L K
Sbjct  66   KRVKPFRCGDFDDCIEKVENSQGLTIRKREKYARREDAILHALELEKEILKK  117



>ref|XP_006443161.1| hypothetical protein CICLE_v10018929mg [Citrus clementina]
 ref|XP_006478897.1| PREDICTED: uncharacterized protein At1g51745-like [Citrus sinensis]
 gb|ESR56401.1| hypothetical protein CICLE_v10018929mg [Citrus clementina]
Length=785

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL PEEL      S R+GTPVKLLG  D  +DW+NLE SKRV+AF
Sbjct  18   IVWVRRRNGSWWPGKILEPEELTTSHLTSPRTGTPVKLLGRDDASVDWYNLEKSKRVKAF  77

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHA  434
            RCGE+D CIE+A       +RK  KY RREDAILHA
Sbjct  78   RCGEFDDCIERAEASLGMPTRKREKYARREDAILHA  113



>ref|XP_009130336.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
 ref|XP_009130337.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
 ref|XP_009130338.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
Length=741

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL  ++L      S RSGTPVKLLG +D  +DW+NLE SKRV+ F
Sbjct  12   IVWVRRRNGSWWPGKILGQDDLDSTHITSPRSGTPVKLLGREDASVDWYNLEKSKRVKPF  71

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCG++D CIEK         RK  KY RREDAILHALE+E+  L K
Sbjct  72   RCGDFDDCIEKVENSQGLTIRKREKYARREDAILHALELEKEILKK  117



>emb|CDY43148.1| BnaA05g32380D [Brassica napus]
Length=741

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG+IL  ++L      S RSGTPVKLLG +D  +DW+NLE SKRV+ F
Sbjct  12   IVWVRRRNGSWWPGKILGQDDLDSTHITSPRSGTPVKLLGREDASVDWYNLEKSKRVKPF  71

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RCG++D CIEK         RK  KY RREDAILHALE+E+  L K
Sbjct  72   RCGDFDDCIEKVENSQGLTIRKREKYARREDAILHALELEKEILKK  117



>ref|XP_011653393.1| PREDICTED: uncharacterized protein At1g51745 isoform X1 [Cucumis 
sativus]
Length=741

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 83/130 (64%), Gaps = 9/130 (7%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   +  +D     +VWVRRRNG WWPG+IL  ++L      S RSGTPVKLLG +
Sbjct  1    MGSPG---SGAVDYAVGSIVWVRRRNGSWWPGKILGSDDLSSSHLTSPRSGTPVKLLGRE  57

Query  273  DTCI------DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHA  434
            D  +      DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHA
Sbjct  58   DASVLNTEERDWYNLEKSKRVKPFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHA  117

Query  435  LEIERSFLGK  464
            LE+E+  L K
Sbjct  118  LELEKELLNK  127



>ref|XP_011010169.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
 ref|XP_011010170.1| PREDICTED: uncharacterized protein At1g51745-like [Populus euphratica]
Length=775

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG I+  +EL E +  S R+GTPVKLLG  D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGHIMEADELAEYNLTSPRTGTPVKLLGRDDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RC E+  CI++A        +K  KY RREDAILHALE+E+  L K
Sbjct  76   RCAEFSDCIKRAESALGMPIKKREKYARREDAILHALELEKRLLIK  121



>ref|XP_002319249.2| hypothetical protein POPTR_0013s08000g [Populus trichocarpa]
 gb|EEE95172.2| hypothetical protein POPTR_0013s08000g [Populus trichocarpa]
Length=775

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAF  326
            +VWVRRRNG WWPG I+  +EL E +  S R+GTPVKLLG  D  +DW+NLE SKRV+AF
Sbjct  16   IVWVRRRNGSWWPGHIMEADELAEYNLTSPRTGTPVKLLGRDDASVDWYNLEKSKRVKAF  75

Query  327  RCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            RC E+  CI++A        +K  KY RREDAILHALE+E+  L K
Sbjct  76   RCAEFSDCIKRAESALGMPIKKREKYARREDAILHALELEKRLLIK  121



>ref|XP_006392999.1| hypothetical protein EUTSA_v10011307mg [Eutrema salsugineum]
 gb|ESQ30285.1| hypothetical protein EUTSA_v10011307mg [Eutrema salsugineum]
Length=643

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 83/118 (70%), Gaps = 3/118 (3%)
 Frame = +3

Query  120  KPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNL  299
            K I      LVWVRRRNG WWPGQ L  +E+PE S VS + GTP+KLLG  D  ++W+ L
Sbjct  9    KAIYASVGRLVWVRRRNGSWWPGQTLVHDEVPENSLVSPKIGTPIKLLGRDDVSVEWYTL  68

Query  300  ENSKRVRAFRCGEYDKCIEKALLVAASGS---RKAVKYNRREDAILHALEIERSFLGK  464
            E SK V+AFRCGEYD  IEKA   AA+GS   +K+VK  RREDAI +ALEIE++ L K
Sbjct  69   EKSKMVKAFRCGEYDDFIEKAKAAAAAGSSSNKKSVKCTRREDAINNALEIEKAHLAK  126



>ref|NP_564598.2| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
 gb|AEE32710.1| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
Length=563

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++P+ S V  + GTP+KLLG  
Sbjct  1    MESNDDRNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVPDNSLVGPKVGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+ LENSK V+AFRCGEYD CIEKA   A+S  +++ K   REDAI +AL+IE  
Sbjct  61   DVSVDWYILENSKTVKAFRCGEYDTCIEKAK--ASSSKKRSGKCTLREDAINNALKIENE  118

Query  453  FLGKANPSF  479
             L K + + 
Sbjct  119  HLAKEDDNL  127



>sp|P59278.2|Y1745_ARATH RecName: Full=Uncharacterized protein At1g51745 [Arabidopsis 
thaliana]
Length=597

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++P+ S V  + GTP+KLLG  
Sbjct  1    MESNDDRNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVPDNSLVGPKVGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+ LENSK V+AFRCGEYD CIEKA   A+S  +++ K   REDAI +AL+IE  
Sbjct  61   DVSVDWYILENSKTVKAFRCGEYDTCIEKAK--ASSSKKRSGKCTLREDAINNALKIENE  118

Query  453  FLGKANPSF  479
             L K + + 
Sbjct  119  HLAKEDDNL  127



>gb|AAO22798.1| unknown protein [Arabidopsis thaliana]
Length=597

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++P+ S V  + GTP+KLLG  
Sbjct  1    MESNDDRNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVPDNSLVGPKVGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERS  452
            D  +DW+ LENSK V+AFRCGEYD CIEKA   A+S  +++ K   REDAI +AL+IE  
Sbjct  61   DVSVDWYILENSKTVKAFRCGEYDTCIEKAK--ASSSKKRSGKCTLREDAINNALKIENE  118

Query  453  FLGKANPSF  479
             L K + + 
Sbjct  119  HLAKEDDNL  127



>gb|AES89591.2| tudor/PWWP/MBT superfamily protein [Medicago truncatula]
Length=736

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSG-RSGTPVKLLGLKDTCIDWHNLE  302
            +D     +VWVRRRNG WWPGQI+ P++       S  RSGTPVKLLG +D  +DW+NLE
Sbjct  1    MDCGVGSIVWVRRRNGSWWPGQIIGPDDHSTSHLTSPPRSGTPVKLLGREDASVDWYNLE  60

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
             SKRV+AFRCGE+D  IEK         +K  KY RREDAILHALE+ER  + K
Sbjct  61   KSKRVKAFRCGEFDDYIEKIEASHEMPLKKREKYARREDAILHALELERELVKK  114



>ref|XP_003607394.1| hypothetical protein MTR_4g077550 [Medicago truncatula]
Length=745

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSG-RSGTPVKLLGLKDTCIDWHNLE  302
            +D     +VWVRRRNG WWPGQI+ P++       S  RSGTPVKLLG +D  +DW+NLE
Sbjct  1    MDCGVGSIVWVRRRNGSWWPGQIIGPDDHSTSHLTSPPRSGTPVKLLGREDASVDWYNLE  60

Query  303  NSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
             SKRV+AFRCGE+D  IEK         +K  KY RREDAILHALE+ER  + K
Sbjct  61   KSKRVKAFRCGEFDDYIEKIEASHEMPLKKREKYARREDAILHALELERELVKK  114



>pir||D96556 hypothetical protein F19C24.5 [imported] - Arabidopsis thaliana
 gb|AAG50888.1|AC025294_26 hypothetical protein [Arabidopsis thaliana]
Length=896

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            I+     LVWVRRRNG WWPGQ L  +++P+ S V  + GTP+KLLG  D  +DW+ LEN
Sbjct  273  INASVGRLVWVRRRNGSWWPGQTLVHDQVPDNSLVGPKVGTPIKLLGRDDVSVDWYILEN  332

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGKANPSF  479
            SK V+AFRCGEYD CIEKA   A+S  +++ K   REDAI +AL+IE   L K + + 
Sbjct  333  SKTVKAFRCGEYDTCIEKAK--ASSSKKRSGKCTLREDAINNALKIENEHLAKEDDNL  388



>gb|EPS60051.1| hypothetical protein M569_14754, partial [Genlisea aurea]
Length=516

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = +3

Query  144  GLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRVRA  323
            GLVWVR++NG WWPG+IL PEELPE    + +SGTP+ LLG K T + W NLE SKR++A
Sbjct  2    GLVWVRQKNGSWWPGKILNPEELPESRVAAPKSGTPLMLLGKKGTTVHWFNLEKSKRIKA  61

Query  324  FRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
            F CGEY+ CIEKA   +  G RK     R EDAIL ALE+E + 
Sbjct  62   FHCGEYEDCIEKAKSASNKGIRKG---GRLEDAILKALELETAL  102



>ref|XP_006304889.1| hypothetical protein CARUB_v10012660mg [Capsella rubella]
 gb|EOA37787.1| hypothetical protein CARUB_v10012660mg [Capsella rubella]
Length=643

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +E+P+ S VS + GTP+KLLG  
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVLDEIPDNSLVSPKVGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY---NRREDAILHALEI  443
            D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ S    K     RREDAI +ALEI
Sbjct  61   DVSVDWYILENSKTVKAFRCGEYDSCIEKAKAAAAAASSSNKKAAKCTRREDAIKNALEI  120

Query  444  ERSFLGKAN  470
            E   L K +
Sbjct  121  ENEHLAKED  129



>ref|XP_010500759.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=645

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 83/128 (65%), Gaps = 2/128 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++ + S VS + GTP+KLLG  
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVSDNSLVSPKVGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY--NRREDAILHALEIE  446
            D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ S         RREDAI +ALEIE
Sbjct  61   DVSVDWYILENSKTVKAFRCGEYDTCIEKAKAAAAASSANKKAAKCTRREDAINNALEIE  120

Query  447  RSFLGKAN  470
             S L K +
Sbjct  121  NSHLAKED  128



>ref|XP_010500760.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=644

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 83/128 (65%), Gaps = 2/128 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++ + S VS + GTP+KLLG  
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVSDNSLVSPKVGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY--NRREDAILHALEIE  446
            D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ S         RREDAI +ALEIE
Sbjct  61   DVSVDWYILENSKTVKAFRCGEYDTCIEKAKAAAAASSANKKAAKCTRREDAINNALEIE  120

Query  447  RSFLGKAN  470
             S L K +
Sbjct  121  NSHLAKED  128



>ref|XP_010479675.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010479676.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=642

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSS-VSGRSGTPVKLLGL  269
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++ + +S VS + GTP+KLLG 
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVSDNNSLVSTKVGTPIKLLGR  60

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY--NRREDAILHALEI  443
             D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ +         RREDAI +ALEI
Sbjct  61   DDVSVDWYILENSKTVKAFRCGEYDTCIEKAKAAAAASAGNKKAAKCTRREDAINNALEI  120

Query  444  ERSFLGKAN  470
            E S L K +
Sbjct  121  ENSHLAKED  129



>ref|XP_010479677.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=641

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSS-VSGRSGTPVKLLGL  269
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++ + +S VS + GTP+KLLG 
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVSDNNSLVSTKVGTPIKLLGR  60

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY--NRREDAILHALEI  443
             D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ +         RREDAI +ALEI
Sbjct  61   DDVSVDWYILENSKTVKAFRCGEYDTCIEKAKAAAAASAGNKKAAKCTRREDAINNALEI  120

Query  444  ERSFLGKAN  470
            E S L K +
Sbjct  121  ENSHLAKED  129



>emb|CDY33863.1| BnaC06g04900D [Brassica napus]
Length=911

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 87/139 (63%), Gaps = 4/139 (3%)
 Frame = +3

Query  63   NHHTIS*IRVMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRS  242
            +HH IS     G+  +   K I+     LVWVR RNG WWPGQ L  EE+PE S +S + 
Sbjct  286  SHHPISNKPHTGNDDQ-NLKAINASVGRLVWVRLRNGSWWPGQTLLHEEVPESSLLSPKL  344

Query  243  GTPVKLLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIE---KALLVAASGSRKAVKYNRR  413
            GTP+KLLG  D  IDW+ LE SK V+AFRCGEYD  IE    +   A + S+K VK  RR
Sbjct  345  GTPIKLLGRDDVGIDWYVLEKSKSVKAFRCGEYDAHIEKAKASAAAARASSKKTVKCTRR  404

Query  414  EDAILHALEIERSFLGKAN  470
            E+AI+ ALEIE + L K +
Sbjct  405  ENAIISALEIENAHLAKED  423



>emb|CDY22868.1| BnaA06g02090D [Brassica napus]
Length=909

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = +3

Query  66   HHTIS*IRVMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSG  245
            HH+ S  +   S+ +   K I+     LVWVR RNG WWPGQ L  EELPE S +S + G
Sbjct  295  HHSNS-NKTHTSNDDKNLKAINASVGRLVWVRLRNGSWWPGQTLLHEELPESSLLSPKLG  353

Query  246  TPVKLLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIE---KALLVAASGSRKAVKYNRRE  416
            TP+KLLG  D  IDW+ LE SK V+AFRC EYD  IE    +   A + S+K VK  RRE
Sbjct  354  TPIKLLGRDDVGIDWYVLEKSKSVKAFRCAEYDAHIEKAKASAAAARASSKKTVKCTRRE  413

Query  417  DAILHALEIERSFLGKAN  470
            +AI+ ALEIE + L K +
Sbjct  414  NAIISALEIENAHLAKED  431



>ref|XP_009147732.1| PREDICTED: uncharacterized protein At1g51745-like [Brassica rapa]
Length=607

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 81/127 (64%), Gaps = 3/127 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            M S+ +   K I+     LVWVR RNG WWPGQ L  EE+PE   +S + GTP+KLLG  
Sbjct  1    MESNDDKNLKAINASVGRLVWVRLRNGSWWPGQTLLHEEVPESPLLSPKLGTPIKLLGRD  60

Query  273  DTCIDWHNLENSKRVRAFRCGEYDKCIE---KALLVAASGSRKAVKYNRREDAILHALEI  443
            D  IDW+ LE SK V+AFRCGEYD  IE    +   A + S+K VK  RRE+AI+ ALEI
Sbjct  61   DVGIDWYVLEKSKSVKAFRCGEYDAHIEKAKASAAAARASSKKTVKCTRRENAIISALEI  120

Query  444  ERSFLGK  464
            E + L K
Sbjct  121  ENAHLAK  127



>ref|XP_010462014.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
 ref|XP_010462015.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Camelina sativa]
Length=644

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSS-VSGRSGTPVKLLGL  269
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++ + +S VS + GTP+KLLG 
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVSDNNSLVSPKVGTPIKLLGR  60

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY--NRREDAILHALEI  443
             D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ S         RREDAI +ALEI
Sbjct  61   DDVSVDWYILENSKTVKAFRCGEYDSCIEKAKAAAAASSANKKAAKCTRREDAINNALEI  120

Query  444  ERSFLGK  464
            E S L K
Sbjct  121  ENSHLAK  127



>ref|XP_010462016.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Camelina sativa]
Length=643

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSS-VSGRSGTPVKLLGL  269
            M S+ +   + I+     LVWVRRRNG WWPGQ L  +++ + +S VS + GTP+KLLG 
Sbjct  1    MESNDDQNLEAINASVGRLVWVRRRNGSWWPGQTLVHDQVSDNNSLVSPKVGTPIKLLGR  60

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY--NRREDAILHALEI  443
             D  +DW+ LENSK V+AFRCGEYD CIEKA   AA+ S         RREDAI +ALEI
Sbjct  61   DDVSVDWYILENSKTVKAFRCGEYDSCIEKAKAAAAASSANKKAAKCTRREDAINNALEI  120

Query  444  ERSFLGKAN  470
            E S L K +
Sbjct  121  ENSHLAKED  129



>ref|XP_004245942.1| PREDICTED: uncharacterized protein LOC101257099 [Solanum lycopersicum]
Length=463

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPER---SSVSGRSGTPVKLLGLKDTCIDWHNLENSKRV  317
            +VWV R+NG WWPG+ILC  E+P     S     S  P+KLLG  D  + W+NLE S RV
Sbjct  13   VVWVLRQNGTWWPGRILCINEIPTSGILSCTDFSSRFPIKLLGRDDASVYWYNLEKSSRV  72

Query  318  RAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            +AFRCGE+D CI+KA         +++KY  REDAILHALE+E+  L K
Sbjct  73   KAFRCGEFDSCIKKAESSKTLTYTRSLKYAHREDAILHALELEKQDLEK  121



>ref|XP_006352937.1| PREDICTED: uncharacterized protein At1g51745-like [Solanum tuberosum]
Length=467

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELP-----ERSSVSGRSGTPVKLLGLKDTCIDWHNLENSK  311
            +VWV R+NG WWPG+ILC  E+P      R+  S R   P+KLLG  D  + W+NLE S 
Sbjct  13   VVWVLRQNGTWWPGRILCSNEIPTSGILSRTDFSSR--FPIKLLGRDDASVCWYNLEKSS  70

Query  312  RVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            RV+AFRCGE+D CI+KA         K++KY  REDAILHALE+E+
Sbjct  71   RVKAFRCGEFDGCIKKAESSKNFTYTKSLKYAHREDAILHALELEK  116



>ref|XP_004968965.1| PREDICTED: uncharacterized protein LOC101785666 [Setaria italica]
Length=457

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +3

Query  129  DVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGR-SGTPVKLLGLKDTCIDWHNLEN  305
            D+    LVWV RRNG WWPG+IL  +ELPE  S+  R + TP+KLLG  D  IDW++LE 
Sbjct  20   DIEVGALVWVVRRNGSWWPGRILGMDELPEDCSIPPRHTVTPIKLLGRPDGSIDWYSLEK  79

Query  306  SKRVRAFRCGEYDKCIEKALLVA--ASGSRKAVKYNRREDAILHALEIERS  452
            SKRV+ FRCGE+D+CIE A + A   + S+   K   RE AI+HALEIE+S
Sbjct  80   SKRVKPFRCGEFDECIENAKVQAHVQNMSQNEGKCACREYAIMHALEIEKS  130



>ref|XP_009597376.1| PREDICTED: uncharacterized protein LOC104093351 isoform X1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 3/107 (3%)
 Frame = +3

Query  138  ASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGT---PVKLLGLKDTCIDWHNLENS  308
            A  +VWV+R+NG WWPG+ILC  E+     VS  S +   P+KLLG  +  + W+NLE S
Sbjct  21   AGSIVWVQRKNGTWWPGKILCNNEISTTGIVSPNSFSSRFPIKLLGRDNASVYWYNLEKS  80

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
             RV+AFRCGE+D CI+KA         K +KY  REDAILHAL++E+
Sbjct  81   SRVKAFRCGEFDDCIKKAESSKVYMYNKKLKYALREDAILHALQLEK  127



>ref|XP_009776963.1| PREDICTED: uncharacterized protein LOC104226632 [Nicotiana sylvestris]
Length=408

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 3/107 (3%)
 Frame = +3

Query  138  ASGLVWVRRRNGQWWPGQILCPEELPER---SSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            A  +VWV+R+NG WWPG+ILC  E+      S  S  S  P+KLLG  +  + W+NLE S
Sbjct  8    AGSVVWVQRKNGTWWPGKILCNNEISTTGIYSPTSFSSRFPIKLLGRDNASVYWYNLEKS  67

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
             RV+AFRCGE+D CI+KA         K +KY  +EDAILHAL++E+
Sbjct  68   SRVKAFRCGEFDDCIKKAESSKVFTFNKKLKYALQEDAILHALQLEK  114



>emb|CDX87840.1| BnaC06g09020D [Brassica napus]
Length=677

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = +3

Query  90   VMGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGL  269
            VM ++ +   K I+     LVWVR RN  WWP Q L  EELPE S ++ ++GTP+KLLG 
Sbjct  141  VMEANDDLNLKAINASVGRLVWVRLRNASWWPAQTLLLEELPETSLLTPQAGTPIKLLGR  200

Query  270  KDTCIDWHNLENSKRVRAFRCGEYDKCIE--KALLVAASGSRKAVKYNRREDAILHALEI  443
             D  ++W+ LE SK V+AFRCGEYD  IE  KA+  A +  +K  K  RRE+AI  AL+I
Sbjct  201  DDVNVEWYVLEKSKSVKAFRCGEYDAHIEKAKAVAAAKATKKKTAKLTRRENAINIALQI  260

Query  444  ERSFL  458
            E + L
Sbjct  261  ENAHL  265



>ref|XP_006652750.1| PREDICTED: uncharacterized protein At1g51745-like isoform X3 
[Oryza brachyantha]
Length=763

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 80/133 (60%), Gaps = 8/133 (6%)
 Frame = +3

Query  228  VSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYN  407
            +S ++GTPVKLLG +D  +DW+NLE SKRV+AFRCGE+D CIEKAL    +  ++  KY 
Sbjct  1    MSPKTGTPVKLLGREDASVDWYNLEKSKRVKAFRCGEFDACIEKALCSRGTPVKRREKYA  60

Query  408  RREDAILHALEIERSFLGKANPSFSLGLDKQNGGQNLIGELP-ASSREGIENVNGDYSSS  584
            RREDAILHALE+ER  L    P +      Q+     I  +P A  R    N + +Y S 
Sbjct  61   RREDAILHALELERKQLA---PKYQ----NQDFRSGDISSVPFAEMRRDFNNCSSEYYSK  113

Query  585  EDNSRSKPKLSHS  623
             D  + +  L +S
Sbjct  114  NDTQKPQFPLGNS  126



>ref|XP_006652748.1| PREDICTED: uncharacterized protein At1g51745-like isoform X1 
[Oryza brachyantha]
 ref|XP_006652749.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Oryza brachyantha]
Length=802

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 80/133 (60%), Gaps = 8/133 (6%)
 Frame = +3

Query  228  VSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYN  407
            +S ++GTPVKLLG +D  +DW+NLE SKRV+AFRCGE+D CIEKAL    +  ++  KY 
Sbjct  1    MSPKTGTPVKLLGREDASVDWYNLEKSKRVKAFRCGEFDACIEKALCSRGTPVKRREKYA  60

Query  408  RREDAILHALEIERSFLGKANPSFSLGLDKQNGGQNLIGELP-ASSREGIENVNGDYSSS  584
            RREDAILHALE+ER  L    P +      Q+     I  +P A  R    N + +Y S 
Sbjct  61   RREDAILHALELERKQLA---PKYQ----NQDFRSGDISSVPFAEMRRDFNNCSSEYYSK  113

Query  585  EDNSRSKPKLSHS  623
             D  + +  L +S
Sbjct  114  NDTQKPQFPLGNS  126



>ref|XP_010034957.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Eucalyptus 
grandis]
Length=729

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 72/123 (59%), Gaps = 18/123 (15%)
 Frame = +3

Query  96   GSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKD  275
            G SG+C    + +    +VWVRRRNG WWPG+IL P+EL      S R+GTPVKLLG +D
Sbjct  5    GGSGDCG---VGLGVGSIVWVRRRNGSWWPGKILGPDELSTAHLTSPRAGTPVKLLGRED  61

Query  276  TCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
              +               CGE+D+CIE+A        +K  KY RREDAILHALE+E+  
Sbjct  62   ASV---------------CGEFDECIERAESSQGMPMKKREKYARREDAILHALELEKEM  106

Query  456  LGK  464
            L K
Sbjct  107  LRK  109



>gb|EEC77915.1| hypothetical protein OsI_17245 [Oryza sativa Indica Group]
Length=803

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 80/132 (61%), Gaps = 14/132 (11%)
 Frame = +3

Query  228  VSGRSGTPVKLLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYN  407
            +S ++GTPVKLLG +D  +DW+NLE SKRV+AFRCGE+D CIEKAL    +  ++  KY 
Sbjct  1    MSPKTGTPVKLLGREDASVDWYNLEKSKRVKAFRCGEFDACIEKALTSRGTPVKRREKYA  60

Query  408  RREDAILHALEIERSFLGKANPSFSLGLDKQNGG--QNLIGELP-ASSREGIENVNGDYS  578
            RREDAILHALE+ER           L    QN G   + I  +P A  R   +N + +Y 
Sbjct  61   RREDAILHALELERK---------QLASKYQNQGFRSDDISSVPFADMRREFDNSSTEYY  111

Query  579  SSEDNSRSKPKL  614
            S   N+  KP+ 
Sbjct  112  SR--NNTQKPQF  121



>gb|EPS63085.1| hypothetical protein M569_11703 [Genlisea aurea]
Length=508

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +3

Query  126  IDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLEN  305
            +D     +VWVRRRNG WWPG+IL P+ELP     S RSGTPVKLLG +D  +DW+NLE 
Sbjct  10   VDCNVGSIVWVRRRNGSWWPGEILDPKELPASHFASRRSGTPVKLLGREDPSVDWYNLEK  69

Query  306  SKRVRAFRCGEYDKCIEKALLVAASGSRKAVKY  404
            SKRV++F C E+   IE+A        +K  KY
Sbjct  70   SKRVKSFCCDEFYDFIERAEAAGRMPPKKRGKY  102



>ref|XP_008348496.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Malus 
domestica]
Length=438

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query  282  IDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLG  461
            +DW+NLE SKRV+AFRCGEYD+CIEKA   AASG++K VKY RREDAI+HALEIE + LG
Sbjct  12   LDWYNLERSKRVKAFRCGEYDECIEKAKAHAASGNKKKVKYARREDAIIHALEIENAHLG  71

Query  462  KANPSFSLGLDKQNGGQNLIG-ELPASSREGIEN  560
            K + +FS  +    G       E PA S    EN
Sbjct  72   KDDLNFSARMSNSGGDHGCSARESPAMSLCSAEN  105



>ref|XP_011013035.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Populus euphratica]
Length=740

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRCGEYD+CIEKA   AA+G+++AVKY RREDAILHALEIE + LGK
Sbjct  35   DWYNLEKSKRVKAFRCGEYDECIEKAKTSAANGNKRAVKYARREDAILHALEIENARLGK  94

Query  465  ANPSF---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
                F   S  L +++G       +  S +E  +  +GD S SEDNS
Sbjct  95   DQLDFFSRSDNLGEEHGSSAKESSMSFSGKEDGDMTDGD-SYSEDNS  140



>ref|XP_002304109.2| hypothetical protein POPTR_0003s03970g [Populus trichocarpa]
 gb|EEE79088.2| hypothetical protein POPTR_0003s03970g [Populus trichocarpa]
Length=707

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRCGEYD+CIEKA   AA+G+++AVKY RREDAILHALEIE + LG+
Sbjct  16   DWYNLEKSKRVKAFRCGEYDECIEKAKTSAANGNKRAVKYARREDAILHALEIENARLGR  75

Query  465  ANPSF---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
                F   S  L +++G       +  S +E  +  +GD S SEDNS
Sbjct  76   DQLDFFSRSDNLGEEHGSSAKESSMSFSGKEDGDMTDGD-SYSEDNS  121



>emb|CDP11755.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 72/107 (67%), Gaps = 10/107 (9%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQIL------CPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNLENS  308
            LVWV+R+NG WWPG+++      CP +    S+V     TP+KLLG ++  ++WHNLE S
Sbjct  8    LVWVQRKNGSWWPGKVVGLDEAACPLKHLSPSAVK----TPIKLLGKENGSVEWHNLETS  63

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
            KR++AFR  E+D  I+ A  V +S + K  KY  REDA+LHAL++E+
Sbjct  64   KRIKAFRSAEFDGFIKDAESVQSSLAIKNGKYAHREDAVLHALQLEK  110



>ref|XP_006369225.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
 gb|ERP65794.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
Length=698

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRCGEYD+CIEKA   AA+G+++ VKY RREDAILHALEIE + LG+
Sbjct  32   DWYNLEKSKRVKAFRCGEYDECIEKAKASAANGNKRVVKYARREDAILHALEIENARLGQ  91

Query  465  ANPSF---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
                F   S  L +++G       +  S +E  +  +GD S SEDNS
Sbjct  92   DQLDFFSRSDNLGEEHGSSAKESSMSFSGKEDGDMTDGD-SDSEDNS  137



>ref|XP_006369226.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
 gb|ERP65795.1| hypothetical protein POPTR_0001s19480g [Populus trichocarpa]
Length=737

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRCGEYD+CIEKA   AA+G+++ VKY RREDAILHALEIE + LG+
Sbjct  32   DWYNLEKSKRVKAFRCGEYDECIEKAKASAANGNKRVVKYARREDAILHALEIENARLGQ  91

Query  465  ANPSF---SLGLDKQNGGQNLIGELPASSREGIENVNGDYSSSEDNS  596
                F   S  L +++G       +  S +E  +  +GD S SEDNS
Sbjct  92   DQLDFFSRSDNLGEEHGSSAKESSMSFSGKEDGDMTDGD-SDSEDNS  137



>emb|CDY43925.1| BnaA05g15350D [Brassica napus]
Length=530

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +3

Query  120  KPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNL  299
            K I      LVWVR RN  WWP Q L  E+LP+ SS S + GTP+KLLG  D  ++W+ L
Sbjct  10   KAIKASVGRLVWVRLRNASWWPAQTLLLEQLPQTSS-SPQLGTPIKLLGRDDVNVEWYVL  68

Query  300  ENSKRVRAFRCGEYDKCIE----KALLVAASGSRKAVKYNRREDAILHALEIERSFLGKA  467
            E SK V+AFRCGEYD  I+     A   AA+  +K  K  RRE+AI  AL+IE + L  +
Sbjct  69   EKSKSVKAFRCGEYDSHIDKAMAVAAAKAANNKKKTAKLTRRENAINIALQIENAHLCSS  128

Query  468  NP  473
            +P
Sbjct  129  SP  130



>ref|XP_003565804.1| PREDICTED: uncharacterized protein LOC100844359 [Brachypodium 
distachyon]
Length=684

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 82/137 (60%), Gaps = 22/137 (16%)
 Frame = +3

Query  108  ECRAKP--IDVPASG-LVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKD  275
            E +A P  +DV A+G LVWVRR NG WWPGQ+L   ++P+      RS  TP+ LLG +D
Sbjct  5    EAQAAPEVVDVSAAGTLVWVRRPNGSWWPGQVLSRADVPDGCPAPPRSPATPIMLLGRRD  64

Query  276  --TCIDWHNLENSKRVRAFRCG--EYDKCIEKALLV-------AASGSRKAV-------K  401
                +DW NLE SKRV+ FRCG  + D CI KA          + S +R+ V       +
Sbjct  65   GPAFVDWCNLERSKRVKPFRCGDLDLDDCIRKAQQQQAARRRGSTSTNRRRVCNTANGAR  124

Query  402  YNRREDAILHALEIERS  452
            Y R+EDA+L AL+IER+
Sbjct  125  YARKEDAVLQALQIERA  141



>ref|XP_009144882.1| PREDICTED: uncharacterized protein At1g51745 [Brassica rapa]
Length=534

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +3

Query  120  KPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCIDWHNL  299
            K I      LVWVR RN  WWP Q L  E+LP+ SS S + GTP+KLLG  D  ++W+ L
Sbjct  10   KAIKASVGRLVWVRLRNASWWPAQTLLLEQLPQTSS-SPQLGTPIKLLGRDDVNVEWYVL  68

Query  300  ENSKRVRAFRCGEYDKCIE----KALLVAASGSRKAVKYNRREDAILHALEIERSFLGKA  467
            E SK V+AFRCG+YD  I+     A   AAS  +K  K  RRE+AI  AL+IE + L  +
Sbjct  69   EKSKSVKAFRCGDYDSHIDKAMAVAAAKAASNKKKTAKLTRRENAINIALQIENAHLCSS  128

Query  468  NP  473
            +P
Sbjct  129  SP  130



>ref|XP_004960986.1| PREDICTED: uncharacterized protein LOC101752952 [Setaria italica]
Length=730

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = +3

Query  117  AKPIDVPASG-LVWVRRRNGQWWPGQILCPEELPERSSVSGRSG-TPVKLLGLK---DTC  281
            A  +DV A G LVW+RR NG WWP  ++ PE++P   +   R G TP+ LLG +    T 
Sbjct  19   APEVDVSAEGTLVWLRRPNGSWWPSIVISPEDVPSACTAPPRCGATPIMLLGRRRDGPTF  78

Query  282  IDWHNLENSKRVRAFRCGEYD--KCIEKALLVAASGSRKAVK--YNRREDAILHALEIER  449
            IDW NL+   RV+ FRCGE D  + I  A  VAA+GS    K  Y R+EDAIL AL IER
Sbjct  79   IDWCNLDRCSRVKPFRCGELDFEQRITNAQAVAATGSCNYNKGRYARKEDAILQALNIER  138



>ref|NP_001136808.1| uncharacterized protein LOC100216954 [Zea mays]
 gb|ACF82682.1| unknown [Zea mays]
Length=378

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 13/131 (10%)
 Frame = +3

Query  126  IDVPASG-LVWVRRRNGQWWPGQILCPEELPERSSVSGR-SGTPVKLLGLK---DTCIDW  290
            +DV   G LVW+RR NG WWP  ++ P+++PE  +   R   TP+ LLG +    T +DW
Sbjct  12   VDVSVEGTLVWLRRPNGSWWPSIVISPQDVPEGCAPPPRCPATPIMLLGRRPDGPTFVDW  71

Query  291  HNLENSKRVRAFRCGEYD--KCIEKALLVAASGSRKAVKYN-----RREDAILHALEIER  449
             NL   KRV+ FRCGE D  + I  AL +AASG+R +  YN     R E AIL AL+IE+
Sbjct  72   CNLARCKRVKPFRCGELDFEQRITNALTLAASGNRSSWSYNKGRYARMEGAILQALDIEK  131

Query  450  -SFLGKANPSF  479
             S LG    ++
Sbjct  132  DSALGPVTKAY  142



>ref|XP_009597377.1| PREDICTED: uncharacterized protein LOC104093351 isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 12/107 (11%)
 Frame = +3

Query  138  ASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGT---PVKLLGLKDTCIDWHNLENS  308
            A  +VWV+R+NG WWPG+ILC  E+     VS  S +   P+KLLG  +  +        
Sbjct  21   AGSIVWVQRKNGTWWPGKILCNNEISTTGIVSPNSFSSRFPIKLLGRDNASV--------  72

Query  309  KRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
             RV+AFRCGE+D CI+KA         K +KY  REDAILHAL++E+
Sbjct  73   -RVKAFRCGEFDDCIKKAESSKVYMYNKKLKYALREDAILHALQLEK  118



>ref|XP_008656118.1| PREDICTED: uncharacterized protein LOC103635437 [Zea mays]
 gb|AFW81341.1| hypothetical protein ZEAMMB73_344943 [Zea mays]
Length=734

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 78/134 (58%), Gaps = 13/134 (10%)
 Frame = +3

Query  117  AKPIDVPASG-LVWVRRRNGQWWPGQILCPEELPERSSVSGR-SGTPVKLLGLK---DTC  281
            A  +DV   G LVW+RR NG WWP  ++ P+++PE  +   R   TP+ LLG +    T 
Sbjct  9    APAVDVSVEGTLVWLRRPNGSWWPSIVISPQDVPEGCAPPPRCPATPIMLLGRRPDGPTY  68

Query  282  IDWHNLENSKRVRAFRCGEYD--KCIEKALLVAASGSRKAVKYN-----RREDAILHALE  440
            +DW NL+  KRV+ FRCGE D  + I  AL +AA+  R    YN     R EDAIL AL+
Sbjct  69   VDWCNLDRCKRVKPFRCGELDLEQRIANALTLAATSDRSTWSYNKGRYARMEDAILQALD  128

Query  441  IERSF-LGKANPSF  479
            IE+   LG A  ++
Sbjct  129  IEKELALGPATKAY  142



>gb|AFW79356.1| hypothetical protein ZEAMMB73_849427 [Zea mays]
Length=647

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 78/131 (60%), Gaps = 13/131 (10%)
 Frame = +3

Query  126  IDVPASG-LVWVRRRNGQWWPGQILCPEELPERSSVSGR-SGTPVKLLGLK---DTCIDW  290
            +DV   G LVW+RR NG WWP  ++ P+++PE  +   R   TP+ LLG +    T +DW
Sbjct  12   VDVSVEGTLVWLRRPNGSWWPSIVISPQDVPEGCAPPPRCPATPIMLLGRRPDGPTFVDW  71

Query  291  HNLENSKRVRAFRCGEYD--KCIEKALLVAASGSRKAVKYN-----RREDAILHALEIER  449
             NL   KRV+ FRCGE D  + I  AL +AASG+R +  YN     R E AIL AL+IE+
Sbjct  72   CNLARCKRVKPFRCGELDFEQRITNALTLAASGNRSSWSYNKGRYARMEGAILQALDIEK  131

Query  450  -SFLGKANPSF  479
             S LG    ++
Sbjct  132  DSALGPVTKAY  142



>ref|XP_006646000.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Oryza 
brachyantha]
Length=724

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +3

Query  240  SGTPVKLLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSR--KAVKYNRR  413
            SGTP+KLLG  D  IDW+NLE SKRV+ FRCGEY++CIEKA   A    R     KY RR
Sbjct  8    SGTPIKLLGRPDGSIDWYNLEKSKRVKPFRCGEYEECIEKAKAQARLHKRAYNEGKYVRR  67

Query  414  EDAILHALEIERS  452
            EDAI+HALE+ER+
Sbjct  68   EDAIMHALELERA  80



>emb|CAI44650.1| OSJNba0093F12.23 [Oryza sativa Japonica Group]
Length=886

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 65/113 (58%), Gaps = 14/113 (12%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRCGE+D CIEKAL    +  ++  KY RREDAILHALE+ER     
Sbjct  78   DWYNLEKSKRVKAFRCGEFDACIEKALTSRGTPVKRREKYARREDAILHALELERK----  133

Query  465  ANPSFSLGLDKQNGG--QNLIGELP-ASSREGIENVNGDYSSSEDNSRSKPKL  614
                  L    QN G   + I  +P A  R   +N + +Y S   N+  KP+ 
Sbjct  134  -----QLASKYQNQGFRSDDISSVPFADMRREFDNSSTEYYSR--NNTQKPQF  179



>dbj|BAK01602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=760

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 66/113 (58%), Gaps = 7/113 (6%)
 Frame = +3

Query  129  DVPASG-LVWVRRRNGQWWPGQILCPEELPERSSVSGRS-GTPVKLLGLKD--TCIDWHN  296
            DV A G LVWVRR NG WWPG++    ELP+      RS  TP+ LLG +D    ++W N
Sbjct  5    DVSAVGALVWVRRPNGSWWPGRVASRLELPDDCPAPPRSPATPILLLGRRDGTAFVEWCN  64

Query  297  LENSKRVRAFRCGE--YDKCIEKALLVAASGSRKAVKYN-RREDAILHALEIE  446
            LE SKRV+ FRCGE   D  I +     A   R     N R+EDA+L AL+IE
Sbjct  65   LERSKRVKPFRCGEADLDDLIRRTEEQTARRRRAGSSRNARKEDAVLQALDIE  117



>ref|XP_008676390.1| PREDICTED: uncharacterized protein At1g51745, partial [Zea mays]
Length=678

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 59/98 (60%), Gaps = 8/98 (8%)
 Frame = +3

Query  282  IDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERSF  455
            +DW+NLE SKRV++FRCGEYD+CIEKA  +A    R     +Y RREDAILHALEIERS 
Sbjct  3    LDWYNLEKSKRVKSFRCGEYDECIEKAKALARQQKRTHAEGRYVRREDAILHALEIERSH  62

Query  456  LGKANPSFSLGLDKQNGGQNLIGELPASSREGIENVNG  569
                   F     ++  G +L       S + I N+NG
Sbjct  63   FSNNCDDF-----EEETGNDLCASQNMCSAKSI-NING  94



>tpg|DAA59003.1| TPA: hypothetical protein ZEAMMB73_224631 [Zea mays]
Length=693

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERSFL  458
            DW+NLE SKRV++FRCGEYD+CIEKA  +A    R     +Y RREDAILHALEIERS  
Sbjct  21   DWYNLEKSKRVKSFRCGEYDECIEKAKALARQQKRTHAEGRYVRREDAILHALEIERSHF  80

Query  459  GKANPSFSLGLDKQNGGQNLIGELPASSREGIENVNG  569
                  F     ++  G +L       S + I N+NG
Sbjct  81   SNNCDDF-----EEETGNDLCASQNMCSAKSI-NING  111



>ref|XP_007029503.1| Tudor/PWWP/MBT superfamily protein, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY10005.1| Tudor/PWWP/MBT superfamily protein, putative isoform 2, partial 
[Theobroma cacao]
Length=770

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  TCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
             C DW+NLE SKRV+AFRCGE+D CIE+A        +K  KY RREDAILHALE+E+  
Sbjct  52   ACSDWYNLEKSKRVKAFRCGEFDDCIERAESSQGMPPKKREKYARREDAILHALELEKEL  111

Query  456  LGK  464
            L K
Sbjct  112  LRK  114



>ref|XP_008809885.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=777

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAV---KYNRREDAILHALEIERSF  455
            DW+NLE SKRV+AFRCGEYD+CIE+A   A    +KA    KY RREDAILHALE+E++ 
Sbjct  8    DWYNLEKSKRVKAFRCGEYDECIERAKASAVCSKKKAANAGKYVRREDAILHALELEKAH  67

Query  456  LGKAN  470
                N
Sbjct  68   FSNRN  72



>ref|XP_008451679.1| PREDICTED: uncharacterized protein At1g51745 isoform X3 [Cucumis 
melo]
Length=726

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  276  TCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSF  455
             C DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+E+  
Sbjct  50   VCKDWYNLEKSKRVKPFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHALELEKEL  109

Query  456  LGK  464
            L K
Sbjct  110  LNK  112



>ref|XP_010558655.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Tarenaya hassleriana]
Length=718

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  CIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            C DW+NLE SKRV+AFRCG++D+CIE+         RK  KY RREDAILHALE+E+  +
Sbjct  5    CRDWYNLEKSKRVKAFRCGDFDECIERVESAQGIPMRKREKYARREDAILHALELEKEIM  64

Query  459  GK  464
             K
Sbjct  65   KK  66



>gb|EMT19851.1| hypothetical protein F775_09638 [Aegilops tauschii]
Length=740

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAV--KYNRREDAILHALEIERS  452
            DW+NLE SKRV+AFRCGEY++CIEKA ++A    R     KY RREDAI+HALEIERS
Sbjct  51   DWYNLEKSKRVKAFRCGEYEECIEKAKILARQQKRTYNEGKYVRREDAIMHALEIERS  108



>ref|XP_011653394.1| PREDICTED: uncharacterized protein At1g51745 isoform X3 [Cucumis 
sativus]
Length=708

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  35   DWYNLEKSKRVKPFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHALELEKELLNK  94



>ref|XP_008451678.1| PREDICTED: uncharacterized protein At1g51745 isoform X2 [Cucumis 
melo]
Length=732

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+ FRCGE+D CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  59   DWYNLEKSKRVKPFRCGEFDDCIERAESSQGMPIKKREKYARREDAILHALELEKELLNK  118



>ref|XP_008657775.1| PREDICTED: uncharacterized protein At1g51745-like, partial [Zea 
mays]
Length=682

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIE--KALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            DW+NLE SKRV++FRCGEYD+CIE  KAL+     +    +Y RREDAI+HALEIERS  
Sbjct  16   DWYNLEKSKRVKSFRCGEYDECIEKAKALVRRQKKTHTEGRYVRREDAIMHALEIERSHF  75



>ref|XP_011011283.1| PREDICTED: uncharacterized protein At1g51745-like isoform X2 
[Populus euphratica]
Length=726

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFLGK  464
            DW+NLE SKRV+AFRC E+  CIE+A        +K  KY RREDAILHALE+E+  L K
Sbjct  6    DWYNLEKSKRVKAFRCAEFSDCIERAESAMGMPIKKREKYARREDAILHALELEKQLLRK  65



>ref|XP_008780396.1| PREDICTED: uncharacterized protein At1g51745-like [Phoenix dactylifera]
Length=92

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS  +     ID  A GLVWVRRRNG WWPG+IL  +ELP +     RSGTP+KLLG +
Sbjct  19   MGSDQDGCLNGIDASAGGLVWVRRRNGSWWPGRILGRDELPAKCLFPPRSGTPIKLLGRE  78

Query  273  D  275
            D
Sbjct  79   D  79



>gb|KDO50576.1| hypothetical protein CISIN_1g004827mg [Citrus sinensis]
Length=728

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHA  434
            DW+NLE SKRV+AFRCGE+D CIE+A       +RK  KY RREDAILHA
Sbjct  7    DWYNLEKSKRVKAFRCGEFDDCIERAEASLGMPTRKREKYARREDAILHA  56



>gb|ACG24976.1| hypothetical protein [Zea mays]
 gb|AFW63511.1| hypothetical protein ZEAMMB73_379388 [Zea mays]
Length=81

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  147  LVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLKDTCI  284
            +VWVRRRNG WWPG+IL P+ELP    +S RSGTPVKLLG +D  +
Sbjct  27   IVWVRRRNGSWWPGRILGPQELPPSQIMSPRSGTPVKLLGREDASV  72



>ref|NP_001031172.1| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
 gb|AEE32711.1| Tudor/PWWP/MBT superfamily protein [Arabidopsis thaliana]
Length=504

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +3

Query  279  CIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            C DW+ LENSK V+AFRCGEYD CIEKA   A+S  +++ K   REDAI +AL+IE   L
Sbjct  4    CEDWYILENSKTVKAFRCGEYDTCIEKAK--ASSSKKRSGKCTLREDAINNALKIENEHL  61

Query  459  GKANPSF  479
             K + + 
Sbjct  62   AKEDDNL  68



>gb|KJB35000.1| hypothetical protein B456_006G096200 [Gossypium raimondii]
Length=657

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  282  IDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            +D  ++E  KRV+AF  G+YD+CIEKA+  A + S+KAVKY +R+ AILHALEI+   L
Sbjct  1    MDCCDIEKPKRVKAFHSGDYDECIEKAMAAATNSSKKAVKYAQRKYAILHALEIKSEHL  59



>gb|KGN53740.1| hypothetical protein Csa_4G114210 [Cucumis sativus]
Length=61

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +3

Query  93   MGSSGECRAKPIDVPASGLVWVRRRNGQWWPGQILCPEELPERSSVSGRSGTPVKLLGLK  272
            MGS G   +  +D     +VWVRRRNG WWPG+IL  ++L      S RSGTPVKLLG +
Sbjct  1    MGSPG---SGAVDYAVGSIVWVRRRNGSWWPGKILGSDDLSSSHLTSPRSGTPVKLLGRE  57

Query  273  DTCI  284
            D  +
Sbjct  58   DASV  61



>gb|KHG25774.1| hypothetical protein F383_10403 [Gossypium arboreum]
Length=656

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 33/129 (26%)
 Frame = +3

Query  258  LLGLKDTCIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHAL  437
            L GL D C    +++  KRV+A   G+YD+CIEKA   A + S+KAVKY +R+ AILHAL
Sbjct  2    LPGLGDCC----DIQRPKRVKACHSGDYDECIEKATAAATNSSKKAVKYAQRKYAILHAL  57

Query  438  EIERSFLGKANPSFSLGLDKQNGGQNLIGELPASSREGI---------ENVNGDYSSSED  590
            EI+                     +NL+ +  +S+RE +         E++  + S SED
Sbjct  58   EIK--------------------SENLVEDHCSSARESLTDSYSGKENEDLTDEMSESED  97

Query  591  NSRSKPKLS  617
            +S S  +LS
Sbjct  98   DSDSALELS  106



>ref|XP_002891656.1| hypothetical protein ARALYDRAFT_474292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67915.1| hypothetical protein ARALYDRAFT_474292 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +3

Query  279  CIDWHNLENSKRVRAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIERSFL  458
            C DW+ LENSK V+AFRCG+YD CIEKA   A+S  +K  K  RREDAI +ALEIE   L
Sbjct  4    CEDWYTLENSKTVKAFRCGDYDTCIEKA--KASSSKKKTGKCTRREDAINNALEIENEHL  61

Query  459  GK  464
             K
Sbjct  62   AK  63



>gb|AAP45186.2| Micronuclear linker histone polyprotein, putative [Solanum bulbocastanum]
Length=423

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 45/104 (43%), Gaps = 44/104 (42%)
 Frame = +3

Query  153  WVRRRNGQWWPGQILCPEELP-----ERSSVSGRSGTPVKLLGLKDTCIDWHNLENSKRV  317
            WV R+NG WWPG+ILC  E+P      R+  S R   P+KLLG  D  +           
Sbjct  15   WVLRQNGTWWPGRILCSNEIPTSGILSRTDFSSR--FPIKLLGRDDASV-----------  61

Query  318  RAFRCGEYDKCIEKALLVAASGSRKAVKYNRREDAILHALEIER  449
                                      +KY  REDAILHALE+E+
Sbjct  62   --------------------------LKYAHREDAILHALELEK  79



>ref|XP_002441636.1| hypothetical protein SORBIDRAFT_09g030720 [Sorghum bicolor]
 gb|EES20066.1| hypothetical protein SORBIDRAFT_09g030720 [Sorghum bicolor]
Length=751

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 7/62 (11%)
 Frame = +3

Query  285  DWHNLENSKRVRAFRCGEYD--KCIEKALLVAASGSRKAVKYN-----RREDAILHALEI  443
            DW NL+  KRV+ FRCGE D  + I  AL +AA+G+R    YN     R EDAIL AL+I
Sbjct  92   DWCNLDRCKRVKPFRCGELDFEQRITNALTLAATGNRSTWSYNKGRYARMEDAILQALDI  151

Query  444  ER  449
            E+
Sbjct  152  EK  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 899714680832