BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig464

Length=886
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349369.1|  PREDICTED: potassium channel AKT2/3-like           278   7e-83   Solanum tuberosum [potatoes]
dbj|BAA84085.1|  potassium channel                                      277   9e-83   Nicotiana paniculata
ref|XP_004230485.1|  PREDICTED: potassium channel AKT2/3-like           277   1e-82   Solanum lycopersicum
ref|XP_009791067.1|  PREDICTED: potassium channel AKT2/3-like           277   1e-82   Nicotiana sylvestris
ref|XP_009614130.1|  PREDICTED: potassium channel AKT2/3-like           276   3e-82   Nicotiana tomentosiformis
gb|ABF85695.1|  potassium channel                                       274   1e-81   Nicotiana rustica [wild tobacco]
ref|XP_011087731.1|  PREDICTED: potassium channel AKT2/3                274   1e-81   Sesamum indicum [beniseed]
dbj|BAD81033.1|  potassium channel NKT2                                 273   5e-81   Nicotiana tabacum [American tobacco]
emb|CDO97567.1|  unnamed protein product                                272   1e-80   Coffea canephora [robusta coffee]
ref|XP_009616703.1|  PREDICTED: potassium channel AKT2/3-like           266   1e-78   Nicotiana tomentosiformis
ref|XP_003593018.1|  Potassium channel                                  265   5e-78   Medicago truncatula
ref|XP_009795716.1|  PREDICTED: potassium channel AKT2/3-like           264   1e-77   Nicotiana sylvestris
ref|XP_010277671.1|  PREDICTED: potassium channel AKT2/3-like           259   8e-76   Nelumbo nucifera [Indian lotus]
ref|XP_004485488.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    258   2e-75   
ref|XP_007148520.1|  hypothetical protein PHAVU_006G215700g             257   3e-75   Phaseolus vulgaris [French bean]
ref|NP_001275259.1|  potassium channel AKT2/3-like                      256   1e-74   Solanum tuberosum [potatoes]
ref|XP_003540163.1|  PREDICTED: potassium channel AKT2/3-like iso...    255   2e-74   Glycine max [soybeans]
emb|CAA71598.1|  potassium channel                                      254   3e-74   Vicia faba [broad bean]
gb|KHN11238.1|  Potassium channel AKT2/3                                254   4e-74   Glycine soja [wild soybean]
ref|XP_003532990.1|  PREDICTED: potassium channel AKT2/3 isoform X1     254   4e-74   Glycine max [soybeans]
ref|XP_010327298.1|  PREDICTED: potassium channel AKT2/3-like           254   4e-74   Solanum lycopersicum
ref|XP_012071314.1|  PREDICTED: potassium channel AKT2/3                253   6e-74   Jatropha curcas
ref|XP_010245053.1|  PREDICTED: potassium channel AKT2/3-like iso...    253   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_007225285.1|  hypothetical protein PRUPE_ppa001379mg             251   8e-73   Prunus persica
ref|XP_010065457.1|  PREDICTED: potassium channel AKT2/3                250   9e-73   Eucalyptus grandis [rose gum]
gb|KFK28793.1|  hypothetical protein AALP_AA7G048900                    249   9e-73   Arabis alpina [alpine rockcress]
ref|XP_008218775.1|  PREDICTED: potassium channel AKT2/3                250   1e-72   Prunus mume [ume]
ref|XP_006431832.1|  hypothetical protein CICLE_v10000273mg             249   2e-72   Citrus clementina [clementine]
ref|XP_009355246.1|  PREDICTED: potassium channel AKT2/3 isoform X1     249   3e-72   Pyrus x bretschneideri [bai li]
gb|AEY75251.1|  potassium channel                                       249   4e-72   Malus hupehensis
ref|XP_010529461.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    248   5e-72   Tarenaya hassleriana [spider flower]
gb|KJB32473.1|  hypothetical protein B456_005G242200                    248   6e-72   Gossypium raimondii
gb|AAA96153.1|  AKT3                                                    247   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867783.1|  hypothetical protein ARALYDRAFT_492645             247   1e-71   
ref|XP_009405920.1|  PREDICTED: potassium channel AKT2                  247   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567651.1|  potassium channel AKT2/3                              247   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008378875.1|  PREDICTED: potassium channel AKT2/3 isoform X1     246   2e-71   
ref|XP_007042250.1|  Potassium transport 2/3 isoform 1                  246   3e-71   
ref|XP_010245052.1|  PREDICTED: potassium channel AKT2/3-like iso...    246   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_002529533.1|  Potassium channel AKT2/3, putative                 246   4e-71   
ref|XP_008378877.1|  PREDICTED: potassium channel AKT2/3 isoform X3     246   4e-71   
ref|XP_004961989.1|  PREDICTED: potassium channel AKT2-like isofo...    246   4e-71   Setaria italica
ref|XP_004961990.1|  PREDICTED: potassium channel AKT2-like isofo...    246   5e-71   
ref|XP_010539338.1|  PREDICTED: potassium channel AKT2/3 isoform X1     245   6e-71   Tarenaya hassleriana [spider flower]
ref|XP_010539356.1|  PREDICTED: potassium channel AKT2/3 isoform X3     245   6e-71   Tarenaya hassleriana [spider flower]
ref|XP_010539347.1|  PREDICTED: potassium channel AKT2/3 isoform X2     245   6e-71   Tarenaya hassleriana [spider flower]
ref|XP_006283121.1|  hypothetical protein CARUB_v10004143mg             245   7e-71   
ref|XP_006471022.1|  PREDICTED: potassium channel AKT2/3-like           245   7e-71   Citrus sinensis [apfelsine]
ref|XP_010101161.1|  Potassium channel                                  245   8e-71   Morus notabilis
ref|XP_008783360.1|  PREDICTED: potassium channel AKT2                  244   1e-70   
ref|XP_006413681.1|  hypothetical protein EUTSA_v10024449mg             240   3e-69   Eutrema salsugineum [saltwater cress]
ref|XP_010681787.1|  PREDICTED: potassium channel AKT2/3 isoform X4     239   3e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010439358.1|  PREDICTED: potassium channel AKT2/3                240   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010930758.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    240   5e-69   
ref|XP_010448923.1|  PREDICTED: potassium channel AKT2/3-like           239   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010681786.1|  PREDICTED: potassium channel AKT2/3 isoform X3     238   6e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681788.1|  PREDICTED: potassium channel AKT2/3 isoform X5     238   7e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|ERN20685.1|  hypothetical protein AMTR_s00070p00197870               239   8e-69   Amborella trichopoda
gb|AAD39492.1|AF145272_1  pulvinus inward-rectifying channel SPICK2     239   9e-69   Samanea saman [cow-tamarind]
ref|XP_006859218.2|  PREDICTED: potassium channel AKT2/3                239   9e-69   Amborella trichopoda
gb|AAD16278.1|  pulvinus inward-rectifying channel for potassium ...    239   2e-68   Samanea saman [cow-tamarind]
ref|XP_010681784.1|  PREDICTED: potassium channel AKT2/3 isoform X1     238   2e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010434070.1|  PREDICTED: potassium channel AKT2/3-like           238   2e-68   
emb|CDX79135.1|  BnaA01g12020D                                          237   5e-68   
gb|EYU26523.1|  hypothetical protein MIMGU_mgv1a001765mg                236   7e-68   Erythranthe guttata [common monkey flower]
ref|XP_009135705.1|  PREDICTED: potassium channel AKT2/3                236   1e-67   Brassica rapa
ref|XP_003568398.1|  PREDICTED: potassium channel AKT2                  236   2e-67   Brachypodium distachyon [annual false brome]
emb|CDX82921.1|  BnaC01g13710D                                          234   7e-67   
ref|XP_006654434.1|  PREDICTED: potassium channel AKT2-like             233   3e-66   Oryza brachyantha
ref|XP_002441141.1|  hypothetical protein SORBIDRAFT_09g021160          229   4e-65   Sorghum bicolor [broomcorn]
ref|XP_008456068.1|  PREDICTED: potassium channel AKT2/3                226   5e-65   Cucumis melo [Oriental melon]
sp|Q75HP9.1|AKT2_ORYSJ  RecName: Full=Potassium channel AKT2            228   1e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98139.1|  hypothetical protein OsI_20054                          228   1e-64   Oryza sativa Indica Group [Indian rice]
ref|NP_001147796.1|  potassium channel AKT2/3                           228   1e-64   Zea mays [maize]
ref|XP_008655420.1|  PREDICTED: potassium channel protein ZMK2 is...    228   2e-64   
ref|NP_001105120.1|  potassium channel protein ZMK2                     227   2e-64   
ref|XP_006385212.1|  potassium channel family protein                   227   3e-64   
emb|CBI23771.3|  unnamed protein product                                226   4e-64   Vitis vinifera
ref|XP_004146262.1|  PREDICTED: potassium channel AKT2/3                223   5e-64   Cucumis sativus [cucumbers]
ref|XP_002268924.1|  PREDICTED: potassium channel AKT2/3                226   6e-64   Vitis vinifera
ref|NP_001291251.1|  potassium channel AKT2/3                           226   9e-64   Populus euphratica
emb|CAC05489.1|  potassium channel 2                                    225   1e-63   Populus tremula x Populus tremuloides
ref|XP_010910948.1|  PREDICTED: potassium channel AKT2-like isofo...    223   7e-63   Elaeis guineensis
gb|KJB79211.1|  hypothetical protein B456_013G038200                    217   1e-61   Gossypium raimondii
ref|XP_004299918.1|  PREDICTED: potassium channel AKT2/3                219   2e-61   Fragaria vesca subsp. vesca
ref|XP_009403703.1|  PREDICTED: potassium channel AKT2-like isofo...    218   7e-61   
gb|KJB79210.1|  hypothetical protein B456_013G038200                    217   1e-60   Gossypium raimondii
gb|EMS50502.1|  Potassium channel AKT2/3                                216   1e-60   Triticum urartu
dbj|BAJ96949.1|  predicted protein                                      211   1e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABE99811.1|  inwardly rectifying potassium channel AKT2              211   1e-58   Hordeum vulgare [barley]
dbj|BAJ86681.1|  predicted protein                                      209   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT08371.1|  hypothetical protein F775_52637                         206   8e-57   
ref|XP_009403698.1|  PREDICTED: potassium channel AKT2-like isofo...    203   8e-56   
emb|CBI30869.3|  unnamed protein product                                202   1e-55   Vitis vinifera
ref|NP_001268073.1|  inward rectifying shaker-like K+ channel           201   3e-55   Vitis vinifera
ref|XP_002441145.1|  hypothetical protein SORBIDRAFT_09g021210          202   3e-55   Sorghum bicolor [broomcorn]
ref|NP_001046422.2|  Os02g0245800                                       198   4e-55   
gb|ABR17684.1|  unknown                                                 200   4e-55   Picea sitchensis
emb|CAK50799.1|  inwardly rectifying potassium channel subunit          200   8e-55   Daucus carota [carrots]
gb|EEC72823.1|  hypothetical protein OsI_06546                          199   2e-54   Oryza sativa Indica Group [Indian rice]
gb|AAL24466.1|AF359522_1  inward rectifying potassium channel           199   2e-54   Vitis vinifera
sp|Q6K3T2.1|KAT1_ORYSJ  RecName: Full=Potassium channel KAT1            199   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647116.1|  PREDICTED: potassium channel KAT1-like             198   2e-54   Oryza brachyantha
ref|XP_002519693.1|  Potassium channel KAT2, putative                   199   3e-54   
ref|XP_007133476.1|  hypothetical protein PHAVU_011G1818001g            189   6e-54   Phaseolus vulgaris [French bean]
ref|XP_006585489.1|  PREDICTED: potassium channel AKT2/3 isoform X2     197   7e-54   
ref|XP_010056887.1|  PREDICTED: potassium channel KAT3                  197   8e-54   
ref|XP_002453600.1|  hypothetical protein SORBIDRAFT_04g008780          197   9e-54   Sorghum bicolor [broomcorn]
ref|XP_008783944.1|  PREDICTED: potassium channel KAT3 isoform X2       196   2e-53   
ref|XP_008783946.1|  PREDICTED: potassium channel KAT3 isoform X4       196   2e-53   Phoenix dactylifera
ref|NP_001284388.1|  potassium channel KAT3-like                        194   4e-53   Cucumis melo [Oriental melon]
ref|XP_003530386.1|  PREDICTED: potassium channel KAT1-like             195   5e-53   Glycine max [soybeans]
ref|XP_010915561.1|  PREDICTED: potassium channel KAT3-like             195   5e-53   Elaeis guineensis
gb|AFW65934.1|  potassium channel3                                      188   5e-53   
ref|XP_010693510.1|  PREDICTED: potassium channel KAT3-like             194   5e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012072096.1|  PREDICTED: potassium channel KAT1                  195   6e-53   Jatropha curcas
ref|XP_009403704.1|  PREDICTED: potassium channel AKT2-like isofo...    194   9e-53   
ref|XP_004233118.1|  PREDICTED: potassium channel KAT1-like             194   9e-53   Solanum lycopersicum
ref|NP_001275475.1|  uncharacterized protein LOC102583546               194   1e-52   Solanum tuberosum [potatoes]
ref|XP_002441143.1|  hypothetical protein SORBIDRAFT_09g021190          194   1e-52   
ref|XP_008348557.1|  PREDICTED: potassium channel KAT1-like isofo...    189   1e-52   
ref|XP_008645574.1|  PREDICTED: potassium channel KAT1-like             193   1e-52   Zea mays [maize]
ref|XP_009602723.1|  PREDICTED: potassium channel KAT3-like isofo...    192   3e-52   Nicotiana tomentosiformis
ref|XP_009602722.1|  PREDICTED: potassium channel KAT3-like isofo...    192   3e-52   Nicotiana tomentosiformis
ref|XP_010665823.1|  PREDICTED: potassium channel KAT3-like isofo...    192   3e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|AAX19659.1|  inward rectifying potassium channel                     192   3e-52   Brassica rapa subsp. pekinensis [bai cai]
emb|CDX99479.1|  BnaC01g10730D                                          192   3e-52   
gb|KGN65561.1|  hypothetical protein Csa_1G448920                       191   3e-52   Cucumis sativus [cucumbers]
ref|XP_008348556.1|  PREDICTED: potassium channel KAT1-like isofo...    189   3e-52   
emb|CDX78839.1|  BnaA01g09060D                                          192   3e-52   
ref|XP_009131562.1|  PREDICTED: potassium channel KAT2-like             192   4e-52   Brassica rapa
ref|XP_010110981.1|  Potassium channel KAT2                             192   5e-52   Morus notabilis
ref|XP_011657374.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    191   5e-52   Cucumis sativus [cucumbers]
ref|NP_001291250.1|  uncharacterized protein LOC105118640               191   8e-52   Populus euphratica
ref|XP_004951327.1|  PREDICTED: potassium channel KAT1-like             191   8e-52   Setaria italica
ref|XP_011096553.1|  PREDICTED: potassium channel KAT3-like             191   8e-52   Sesamum indicum [beniseed]
ref|XP_006449685.1|  hypothetical protein CICLE_v10014336mg             191   8e-52   Citrus clementina [clementine]
gb|EYU43265.1|  hypothetical protein MIMGU_mgv1a002597mg                191   9e-52   Erythranthe guttata [common monkey flower]
ref|XP_010234093.1|  PREDICTED: potassium channel KAT1-like             187   1e-51   Brachypodium distachyon [annual false brome]
ref|XP_006414124.1|  hypothetical protein EUTSA_v10024618mg             190   1e-51   Eutrema salsugineum [saltwater cress]
ref|XP_002870057.1|  hypothetical protein ARALYDRAFT_329707             191   1e-51   Arabidopsis lyrata subsp. lyrata
gb|AFW65933.1|  potassium channel3                                      191   1e-51   
ref|XP_006283236.1|  hypothetical protein CARUB_v10004269mg             190   2e-51   Capsella rubella
ref|XP_006845349.1|  PREDICTED: potassium channel KAT3                  191   2e-51   Amborella trichopoda
ref|XP_010517557.1|  PREDICTED: potassium channel KAT2-like             190   2e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001105240.1|  potassium channel3                                 190   2e-51   
ref|NP_001289500.1|  potassium channel KAT3-like                        190   2e-51   Nicotiana sylvestris
gb|KDO78166.1|  hypothetical protein CISIN_1g003951mg                   191   2e-51   Citrus sinensis [apfelsine]
ref|XP_006281669.1|  hypothetical protein CARUB_v10027805mg             190   2e-51   Capsella rubella
ref|XP_006467473.1|  PREDICTED: potassium channel KAT2-like             190   2e-51   Citrus sinensis [apfelsine]
ref|XP_008381130.1|  PREDICTED: potassium channel KAT1-like             190   2e-51   Malus domestica [apple tree]
ref|XP_009101530.1|  PREDICTED: potassium channel KAT1-like             189   3e-51   Brassica rapa
ref|XP_010538533.1|  PREDICTED: potassium channel KAT1                  190   3e-51   Tarenaya hassleriana [spider flower]
emb|CAC28122.1|  inward rectifying K+ channel                           189   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085251.1|  PREDICTED: potassium channel KAT1-like             190   3e-51   Sesamum indicum [beniseed]
ref|NP_193563.3|  potassium channel KAT2                                189   4e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA63601.1|  K+ channel                                             189   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199436.1|  potassium channel KAT1                                189   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349191.1|  PREDICTED: potassium channel KAT1-like             187   4e-51   
gb|KFK31483.1|  hypothetical protein AALP_AA6G118100                    188   5e-51   Arabis alpina [alpine rockcress]
ref|XP_009804745.1|  PREDICTED: potassium channel KAT3-like isofo...    189   6e-51   Nicotiana sylvestris
ref|XP_009804747.1|  PREDICTED: potassium channel KAT3-like isofo...    189   6e-51   Nicotiana sylvestris
ref|XP_010481478.1|  PREDICTED: potassium channel KAT1-like             188   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010441608.1|  PREDICTED: potassium channel KAT1-like             188   6e-51   Camelina sativa [gold-of-pleasure]
emb|CDX76529.1|  BnaA08g08710D                                          189   7e-51   
emb|CAD18901.1|  inwardly rectifying potassium channel                  189   7e-51   Zea mays [maize]
ref|XP_010919840.1|  PREDICTED: potassium channel KAT3-like             189   7e-51   
ref|XP_010496011.1|  PREDICTED: potassium channel KAT1                  188   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010439874.1|  PREDICTED: potassium channel KAT2-like             188   8e-51   Camelina sativa [gold-of-pleasure]
gb|EYU33359.1|  hypothetical protein MIMGU_mgv1a002393mg                188   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_009114367.1|  PREDICTED: potassium channel KAT1                  187   1e-50   Brassica rapa
ref|XP_008812840.1|  PREDICTED: potassium channel KAT3-like             188   1e-50   
ref|XP_006398319.1|  hypothetical protein EUTSA_v10000798mg             188   1e-50   Eutrema salsugineum [saltwater cress]
emb|CDY35154.1|  BnaA09g17910D                                          187   1e-50   Brassica napus [oilseed rape]
ref|XP_009360884.1|  PREDICTED: potassium channel KAT1-like             188   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_004486026.1|  PREDICTED: potassium channel KAT1-like isofo...    188   2e-50   Cicer arietinum [garbanzo]
ref|XP_004486027.1|  PREDICTED: potassium channel KAT1-like isofo...    188   2e-50   
ref|XP_004293533.2|  PREDICTED: potassium channel KAT1-like             187   2e-50   Fragaria vesca subsp. vesca
ref|XP_002305337.2|  K+ channel family protein                          187   2e-50   
emb|CDY03233.1|  BnaC09g19230D                                          187   2e-50   
ref|XP_008225478.1|  PREDICTED: potassium channel KAT1-like             187   2e-50   Prunus mume [ume]
ref|XP_002863415.1|  hypothetical protein ARALYDRAFT_494350             186   3e-50   
emb|CAC87141.1|  K+ channel protein                                     187   4e-50   Populus tremula x Populus tremuloides
ref|XP_008677784.1|  PREDICTED: potassium channel3 isoform X1           186   4e-50   Zea mays [maize]
ref|XP_009108358.1|  PREDICTED: potassium channel KAT2-like             186   5e-50   Brassica rapa
ref|XP_007213639.1|  hypothetical protein PRUPE_ppa001715mg             186   5e-50   Prunus persica
ref|XP_010559246.1|  PREDICTED: potassium channel KAT1                  186   6e-50   Tarenaya hassleriana [spider flower]
ref|XP_007025090.1|  Potassium channel in 2                             186   7e-50   
ref|XP_003593936.1|  Potassium channel                                  186   8e-50   
ref|XP_003541662.1|  PREDICTED: potassium channel KAT2-like             186   8e-50   Glycine max [soybeans]
gb|KHN47317.1|  Potassium channel KAT2                                  186   8e-50   Glycine soja [wild soybean]
gb|AES64187.2|  inwardly rectifying potassium channel subunit           186   1e-49   Medicago truncatula
ref|XP_004511133.1|  PREDICTED: potassium channel KAT1-like             185   1e-49   Cicer arietinum [garbanzo]
ref|XP_010279668.1|  PREDICTED: potassium channel KAT3                  185   2e-49   
gb|KJB69811.1|  hypothetical protein B456_011G043500                    184   3e-49   Gossypium raimondii
ref|XP_007147900.1|  hypothetical protein PHAVU_006G164300g             184   3e-49   Phaseolus vulgaris [French bean]
ref|XP_009381861.1|  PREDICTED: potassium channel KAT3-like             184   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG04443.1|  Potassium channel KAT1 -like protein                    184   4e-49   Gossypium arboreum [tree cotton]
emb|CAM88967.1|  AKT2 inward rectifier channel                          185   4e-49   Physcomitrella patens
gb|KHN33141.1|  Potassium channel KAT1                                  184   5e-49   Glycine soja [wild soybean]
ref|XP_006597528.1|  PREDICTED: potassium channel KAT1-like             184   5e-49   Glycine max [soybeans]
gb|KJB57249.1|  hypothetical protein B456_009G155200                    182   9e-49   Gossypium raimondii
gb|KJB57248.1|  hypothetical protein B456_009G155200                    183   9e-49   Gossypium raimondii
ref|XP_008783945.1|  PREDICTED: potassium channel KAT3 isoform X3       182   1e-48   Phoenix dactylifera
ref|XP_009393618.1|  PREDICTED: potassium channel AKT1-like             183   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783943.1|  PREDICTED: potassium channel KAT2 isoform X1       182   2e-48   
ref|XP_009406246.1|  PREDICTED: potassium channel KAT2-like isofo...    182   2e-48   
ref|XP_009396647.1|  PREDICTED: potassium channel AKT1-like             182   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355247.1|  PREDICTED: potassium channel AKT2/3 isoform X2     182   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009406249.1|  PREDICTED: potassium channel KAT3-like isofo...    181   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406247.1|  PREDICTED: potassium channel KAT3-like isofo...    181   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406245.1|  PREDICTED: potassium channel KAT3-like isofo...    181   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004244802.1|  PREDICTED: potassium channel KAT3                  181   4e-48   Solanum lycopersicum
ref|XP_009416516.1|  PREDICTED: potassium channel KAT1-like             178   5e-48   
ref|XP_009386140.1|  PREDICTED: potassium channel AKT1                  181   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010051190.1|  PREDICTED: potassium channel AKT1-like             181   8e-48   Eucalyptus grandis [rose gum]
ref|XP_010540570.1|  PREDICTED: potassium channel KAT2-like isofo...    178   8e-48   Tarenaya hassleriana [spider flower]
ref|XP_010540571.1|  PREDICTED: potassium channel KAT2-like isofo...    178   8e-48   Tarenaya hassleriana [spider flower]
ref|XP_008378876.1|  PREDICTED: potassium channel AKT2/3 isoform X2     180   1e-47   
ref|XP_010434553.1|  PREDICTED: potassium channel KAT2                  179   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009408890.1|  PREDICTED: potassium channel KAT3-like isofo...    180   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH19291.1|  inwardly rectifying potassium channel subunit           179   1e-47   Medicago truncatula
ref|XP_009389833.1|  PREDICTED: potassium channel KAT3-like             178   1e-47   
ref|XP_006356880.1|  PREDICTED: potassium channel KAT1-like             179   2e-47   Solanum tuberosum [potatoes]
ref|XP_009396648.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    177   2e-47   
ref|XP_010540569.1|  PREDICTED: potassium channel KAT3-like isofo...    178   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_010540568.1|  PREDICTED: potassium channel KAT3-like isofo...    178   2e-47   Tarenaya hassleriana [spider flower]
gb|KCW81436.1|  hypothetical protein EUGRSUZ_C02815                     179   4e-47   Eucalyptus grandis [rose gum]
ref|XP_009403508.1|  PREDICTED: potassium channel KAT3                  178   5e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009760491.1|  PREDICTED: potassium channel KAT3-like isofo...    177   6e-47   Nicotiana sylvestris
gb|ABR16408.1|  unknown                                                 169   7e-47   Picea sitchensis
ref|XP_009760492.1|  PREDICTED: potassium channel KAT3-like isofo...    177   8e-47   Nicotiana sylvestris
ref|XP_009400651.1|  PREDICTED: potassium channel AKT1-like             178   1e-46   
ref|XP_002456376.1|  hypothetical protein SORBIDRAFT_03g034980          175   1e-46   Sorghum bicolor [broomcorn]
gb|ERN03604.1|  hypothetical protein AMTR_s00042p00201380               177   2e-46   Amborella trichopoda
ref|XP_006841929.2|  PREDICTED: potassium channel AKT1                  177   2e-46   
ref|XP_009616641.1|  PREDICTED: potassium channel KAT3 isoform X2       175   3e-46   Nicotiana tomentosiformis
ref|XP_009616640.1|  PREDICTED: potassium channel KAT3 isoform X1       175   3e-46   Nicotiana tomentosiformis
ref|XP_010047933.1|  PREDICTED: potassium channel AKT1-like isofo...    173   5e-46   
ref|XP_012077507.1|  PREDICTED: potassium channel AKT6-like             176   6e-46   
gb|KDP33617.1|  hypothetical protein JCGZ_07188                         176   8e-46   Jatropha curcas
ref|XP_010047780.1|  PREDICTED: potassium channel AKT1-like isofo...    172   9e-46   
gb|AAF81249.1|AF267753_1  putative potassium channel protein Mkt1p      175   1e-45   Mesembryanthemum crystallinum
gb|KCW79762.1|  hypothetical protein EUGRSUZ_C011051                    172   1e-45   Eucalyptus grandis [rose gum]
ref|XP_010419342.1|  PREDICTED: potassium channel AKT6-like             174   2e-45   Camelina sativa [gold-of-pleasure]
tpg|DAA58342.1|  TPA: potassium channel 1                               174   2e-45   
ref|XP_004970003.1|  PREDICTED: potassium channel KAT3-like isofo...    171   2e-45   Setaria italica
ref|XP_010429557.1|  PREDICTED: potassium channel AKT6                  174   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010423759.1|  PREDICTED: potassium channel AKT6                  174   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004136462.1|  PREDICTED: potassium channel KAT3                  172   2e-45   Cucumis sativus [cucumbers]
ref|XP_004970004.1|  PREDICTED: potassium channel KAT3-like isofo...    171   2e-45   
emb|CDM84232.1|  unnamed protein product                                171   2e-45   Triticum aestivum [Canadian hard winter wheat]
gb|AFW83425.1|  potassium channel                                       174   3e-45   
emb|CAI77627.1|  potassium uptake channel                               174   3e-45   Zea mays [maize]
ref|XP_002458234.1|  hypothetical protein SORBIDRAFT_03g029520          174   3e-45   Sorghum bicolor [broomcorn]
gb|AIB06354.1|  potassium channel                                       174   3e-45   Saccharum hybrid cultivar [sugarcane]
ref|XP_010472568.1|  PREDICTED: potassium channel AKT6-like             174   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010047932.1|  PREDICTED: potassium channel AKT1-like isofo...    174   3e-45   Eucalyptus grandis [rose gum]
ref|XP_008675279.1|  PREDICTED: potassium channel AKT1-like             174   4e-45   Zea mays [maize]
gb|AFW83426.1|  hypothetical protein ZEAMMB73_660957                    174   4e-45   
ref|XP_008466351.1|  PREDICTED: potassium channel KAT3                  172   4e-45   Cucumis melo [Oriental melon]
ref|XP_009772048.1|  PREDICTED: potassium channel AKT1                  173   5e-45   Nicotiana sylvestris
ref|XP_004486028.1|  PREDICTED: potassium channel KAT1-like isofo...    172   5e-45   
ref|XP_010047779.1|  PREDICTED: potassium channel AKT1-like isofo...    173   5e-45   Eucalyptus grandis [rose gum]
ref|XP_006412470.1|  hypothetical protein EUTSA_v10024374mg             172   8e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010546590.1|  PREDICTED: potassium channel AKT6                  172   8e-45   Tarenaya hassleriana [spider flower]
ref|XP_003609240.1|  Potassium channel                                  172   9e-45   Medicago truncatula
ref|XP_004969311.1|  PREDICTED: potassium channel AKT1-like             172   2e-44   Setaria italica
gb|KFK32558.1|  hypothetical protein AALP_AA6G258700                    172   2e-44   Arabis alpina [alpine rockcress]
gb|KHG16749.1|  Potassium channel AKT1 -like protein                    171   2e-44   Gossypium arboreum [tree cotton]
ref|NP_001105480.1|  potassium channel5                                 171   3e-44   Zea mays [maize]
emb|CDY11516.1|  BnaA09g40820D                                          171   3e-44   Brassica napus [oilseed rape]
ref|XP_009117222.1|  PREDICTED: potassium channel AKT6                  171   3e-44   Brassica rapa
ref|XP_004149890.1|  PREDICTED: potassium channel AKT1 isoform X1       171   3e-44   Cucumis sativus [cucumbers]
gb|EEC71508.1|  hypothetical protein OsI_03790                          167   4e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_008657217.1|  PREDICTED: potassium channel KAT3-like             168   4e-44   Zea mays [maize]
gb|KJB64818.1|  hypothetical protein B456_010G066400                    171   4e-44   Gossypium raimondii
ref|NP_001044290.1|  Os01g0756700                                       167   4e-44   
ref|XP_009619489.1|  PREDICTED: potassium channel AKT1-like             171   4e-44   Nicotiana tomentosiformis
ref|XP_006644729.1|  PREDICTED: potassium channel KAT3-like             167   4e-44   
emb|CBI28150.3|  unnamed protein product                                171   4e-44   
emb|CDX76746.1|  BnaC08g33320D                                          171   5e-44   
ref|XP_008365179.1|  PREDICTED: potassium channel KAT3-like             166   5e-44   
emb|CAZ64538.1|  inward rectifying shaker-like K+ channel               171   5e-44   
ref|XP_002281787.1|  PREDICTED: potassium channel AKT1-like isofo...    171   5e-44   
ref|XP_008464998.1|  PREDICTED: potassium channel AKT1 isoform X1       170   5e-44   
ref|XP_003569842.1|  PREDICTED: potassium channel KAT3-like             167   5e-44   
ref|XP_006296292.1|  hypothetical protein CARUB_v10025462mg             171   5e-44   
ref|XP_006646148.1|  PREDICTED: potassium channel AKT1-like             170   7e-44   
emb|CAN80462.1|  hypothetical protein VITISV_015412                     170   7e-44   
ref|NP_180131.3|  potassium channel AKT6                                170   7e-44   
gb|EEC71181.1|  hypothetical protein OsI_03064                          170   8e-44   
gb|EEE55080.1|  hypothetical protein OsJ_02815                          170   9e-44   
ref|XP_010925144.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    170   9e-44   
ref|XP_006285898.1|  hypothetical protein CARUB_v10007410mg             170   9e-44   
ref|XP_002514366.1|  Potassium channel AKT6, putative                   170   1e-43   
gb|ABO15470.1|  AKT1-like K+ channel LilKT1                             169   1e-43   
ref|NP_001043713.1|  Os01g0648000                                       170   1e-43   
ref|XP_010436292.1|  PREDICTED: probable potassium channel AKT5         162   1e-43   
sp|P0C550.1|AKT1_ORYSI  RecName: Full=Potassium channel AKT1; Sho...    170   1e-43   
ref|XP_010670702.1|  PREDICTED: potassium channel AKT1-like             169   2e-43   
ref|XP_008242715.1|  PREDICTED: potassium channel AKT1                  169   2e-43   
ref|XP_007204288.1|  hypothetical protein PRUPE_ppa001241mg             169   2e-43   
emb|CDX68851.1|  BnaC01g06020D                                          168   3e-43   
ref|XP_010249975.1|  PREDICTED: potassium channel AKT1-like             168   3e-43   
emb|CDP03402.1|  unnamed protein product                                164   3e-43   
ref|XP_008362916.1|  PREDICTED: potassium channel AKT1-like             166   3e-43   
ref|XP_010533190.1|  PREDICTED: potassium channel AKT1                  168   3e-43   
gb|EMS47074.1|  Potassium channel KAT1                                  168   3e-43   
ref|XP_009125933.1|  PREDICTED: probable potassium channel AKT5         168   3e-43   
emb|CDX75249.1|  BnaA01g04530D                                          168   3e-43   
ref|XP_008393996.1|  PREDICTED: potassium channel KAT3                  166   4e-43   
ref|XP_012078936.1|  PREDICTED: potassium channel AKT1-like             168   4e-43   
ref|XP_009348440.1|  PREDICTED: potassium channel KAT3-like             166   5e-43   
emb|CAG27094.1|  inwardly rectifying potassium channel subunit          168   5e-43   
ref|NP_001234258.1|  potassium channel                                  168   5e-43   
ref|NP_001275347.1|  potassium channel AKT1-like                        168   5e-43   
ref|XP_009348193.1|  PREDICTED: potassium channel AKT1                  167   5e-43   
ref|NP_001105161.1|  potassium channel4                                 166   5e-43   
gb|AAX15943.1|  KZM2                                                    166   6e-43   
ref|XP_010232087.1|  PREDICTED: potassium channel AKT1 isoform X2       166   7e-43   
ref|XP_008809491.1|  PREDICTED: potassium channel AKT1-like isofo...    167   7e-43   
ref|XP_008787403.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    167   7e-43   
ref|XP_008809499.1|  PREDICTED: potassium channel AKT1-like isofo...    167   7e-43   
tpg|DAA52881.1|  TPA: potassium channel4                                166   8e-43   
ref|XP_010447376.1|  PREDICTED: probable potassium channel AKT5         167   8e-43   
dbj|BAJ84904.1|  predicted protein                                      166   8e-43   
ref|XP_007013335.1|  K+ transporter 1                                   167   8e-43   
ref|XP_006408729.1|  hypothetical protein EUTSA_v10001904mg             167   9e-43   
ref|XP_008352270.1|  PREDICTED: potassium channel AKT1-like             167   1e-42   
gb|KJB07163.1|  hypothetical protein B456_001G002700                    167   1e-42   
ref|XP_006392345.1|  hypothetical protein EUTSA_v10023251mg             167   1e-42   
ref|XP_006392335.1|  hypothetical protein EUTSA_v10023250mg             167   1e-42   
ref|XP_010670706.1|  PREDICTED: potassium channel AKT1 isoform X2       166   1e-42   
ref|XP_010670705.1|  PREDICTED: potassium channel AKT1 isoform X1       166   1e-42   
ref|XP_006293431.1|  hypothetical protein CARUB_v10025578mg             166   1e-42   
gb|AAL40894.1|  AKT1-like potassium channel                             166   2e-42   
ref|XP_010665824.1|  PREDICTED: potassium channel KAT3-like isofo...    164   2e-42   
ref|XP_003524528.2|  PREDICTED: potassium channel AKT1-like             166   2e-42   
dbj|BAD81035.1|  potassium channel NtKC1                                164   2e-42   
ref|XP_009377371.1|  PREDICTED: potassium channel KAT3-like             164   2e-42   
gb|AFW85053.1|  putative protein kinase superfamily protein             165   2e-42   
gb|KHN27401.1|  Potassium channel AKT1                                  166   2e-42   
ref|XP_010445001.1|  PREDICTED: probable potassium channel AKT5         166   2e-42   
ref|XP_004287371.1|  PREDICTED: potassium channel AKT1                  166   3e-42   
ref|NP_180233.1|  potassium channel AKT1                                166   3e-42   
ref|XP_003569453.1|  PREDICTED: potassium channel AKT1 isoform X1       166   3e-42   
gb|KDO80355.1|  hypothetical protein CISIN_1g002763mg                   164   3e-42   
ref|XP_010230609.1|  PREDICTED: potassium channel KAT2-like isofo...    164   3e-42   
ref|XP_002529373.1|  Potassium channel AKT1, putative                   165   4e-42   
ref|XP_011008176.1|  PREDICTED: potassium channel AKT1-like             161   4e-42   
sp|Q5QNI1.2|KAT2_ORYSJ  RecName: Full=Potassium channel KAT2            163   4e-42   
ref|XP_004508540.1|  PREDICTED: potassium channel AKT1-like isofo...    165   4e-42   
ref|XP_004508539.1|  PREDICTED: potassium channel AKT1-like isofo...    165   4e-42   
gb|EEC70154.1|  hypothetical protein OsI_00861                          163   4e-42   
gb|AHM23834.1|  putative KAT2                                           163   4e-42   
ref|XP_003638588.1|  Inward rectifying potassium channel                163   5e-42   
ref|XP_006579054.1|  PREDICTED: potassium channel AKT1-like             165   5e-42   
ref|XP_011013838.1|  PREDICTED: potassium channel AKT1-like isofo...    163   5e-42   
ref|XP_011013837.1|  PREDICTED: potassium channel AKT1-like isofo...    163   5e-42   
ref|XP_011077973.1|  PREDICTED: potassium channel AKT1-like             165   5e-42   
ref|XP_010230608.1|  PREDICTED: potassium channel KAT2-like isofo...    163   6e-42   
gb|KFK41169.1|  hypothetical protein AALP_AA2G094700                    164   7e-42   
ref|XP_011093723.1|  PREDICTED: potassium channel AKT1-like             164   7e-42   
ref|NP_194976.1|  putative potassium channel AKT5                       164   7e-42   
gb|KJB83170.1|  hypothetical protein B456_013G232800                    164   7e-42   
ref|XP_006475780.1|  PREDICTED: potassium channel AKT1-like             164   1e-41   
ref|XP_006451007.1|  hypothetical protein CICLE_v10007412mg             164   1e-41   
ref|XP_010274957.1|  PREDICTED: potassium channel KAT3-like isofo...    163   1e-41   
gb|KHG28816.1|  Potassium channel AKT1 -like protein                    163   1e-41   
gb|AIY55349.1|  potassium channel AKT1-like protein                     164   1e-41   
ref|XP_010098980.1|  Potassium channel AKT1                             163   1e-41   
gb|EPS59603.1|  potassium channel                                       161   1e-41   
ref|XP_010432708.1|  PREDICTED: probable potassium channel AKT5         163   2e-41   
ref|XP_011014911.1|  PREDICTED: potassium channel AKT1-like             163   2e-41   
emb|CDY55714.1|  BnaC04g37620D                                          163   2e-41   
gb|ADA79674.1|  shaker-like potassium channel 1                         163   2e-41   
ref|XP_007154951.1|  hypothetical protein PHAVU_003G160800g             163   2e-41   
gb|AHZ30618.1|  potassium channel AKT1                                  163   2e-41   
ref|XP_010925257.1|  PREDICTED: potassium channel AKT1-like isofo...    163   3e-41   
ref|XP_006371939.1|  k transporter family protein                       163   3e-41   
ref|XP_011026492.1|  PREDICTED: potassium channel AKT1-like             163   3e-41   
ref|XP_004968605.1|  PREDICTED: potassium channel KAT2-like             159   3e-41   
ref|XP_003549784.1|  PREDICTED: potassium channel AKT1-like             162   4e-41   
emb|CDM82256.1|  unnamed protein product                                160   4e-41   
gb|KHN15126.1|  Potassium channel AKT1                                  162   4e-41   
ref|XP_008466383.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    162   4e-41   
emb|CBI20997.3|  unnamed protein product                                162   4e-41   
ref|XP_002308313.1|  k transporter family protein                       162   4e-41   
emb|CAB64728.1|  putative potassium channel                             162   5e-41   
ref|XP_007161234.1|  hypothetical protein PHAVU_001G053200g             162   5e-41   
gb|AAF36832.1|AF207745_1  AKT1-like potassium channel                   162   5e-41   
ref|XP_002308628.2|  K+ rectifying channel family protein               160   5e-41   
ref|XP_010417806.1|  PREDICTED: potassium channel AKT1                  162   6e-41   
emb|CDY35373.1|  BnaA04g14740D                                          162   6e-41   
ref|XP_011652491.1|  PREDICTED: potassium channel AKT1-like             162   7e-41   
ref|NP_001291230.1|  potassium channel AKT1-like                        161   8e-41   
gb|ABE99810.1|  inwardly rectifying potassium channel AKT1              161   1e-40   
gb|KHN07100.1|  Potassium channel AKT1                                  161   1e-40   
ref|XP_010474523.1|  PREDICTED: potassium channel AKT1-like             162   1e-40   
ref|XP_003526425.1|  PREDICTED: potassium channel AKT1-like             161   1e-40   
gb|ACX37089.1|  potassium channel                                       161   1e-40   
ref|XP_010510883.1|  PREDICTED: potassium channel AKT1-like             160   1e-40   
gb|EYU27297.1|  hypothetical protein MIMGU_mgv1a022010mg                160   2e-40   
ref|XP_006388294.1|  hypothetical protein POPTR_0242s002302g            152   2e-40   
ref|NP_001268010.1|  inward rectifying shaker-like K+ channel           160   2e-40   
ref|XP_010049960.1|  PREDICTED: potassium channel AKT1                  160   2e-40   
gb|KCW82789.1|  hypothetical protein EUGRSUZ_C04163                     160   2e-40   
emb|CAN78157.1|  hypothetical protein VITISV_032798                     160   3e-40   
gb|KHG06204.1|  Potassium channel KAT1 -like protein                    152   4e-40   
emb|CDP04802.1|  unnamed protein product                                159   4e-40   
ref|XP_009140622.1|  PREDICTED: potassium channel AKT1                  159   4e-40   
gb|EYU28414.1|  hypothetical protein MIMGU_mgv1a001164mg                159   4e-40   
gb|EMT02357.1|  Potassium channel AKT1                                  159   6e-40   
ref|XP_011459217.1|  PREDICTED: potassium channel AKT1                  159   7e-40   
gb|KEH35946.1|  potassium channel KAT3 protein                          156   7e-40   
gb|KEH35945.1|  potassium channel KAT3 protein                          156   8e-40   
ref|XP_003603500.1|  Potassium channel                                  157   8e-40   
gb|KDO50100.1|  hypothetical protein CISIN_1g0360742mg                  149   9e-40   
ref|XP_002516596.1|  Potassium channel KAT3, putative                   156   9e-40   
emb|CEK43097.1|  inward rectifying Shaker K+ channel                    158   1e-39   
ref|XP_011081850.1|  PREDICTED: potassium channel KAT3                  156   1e-39   
ref|XP_004291407.1|  PREDICTED: potassium channel KAT3                  156   1e-39   
ref|XP_003603438.1|  Potassium channel                                  157   2e-39   
gb|ADK93728.1|  inward-rectifying potassium channel                     157   2e-39   
ref|XP_010249790.1|  PREDICTED: potassium channel KAT3                  155   2e-39   
ref|XP_010670704.1|  PREDICTED: potassium channel AKT1-like             157   2e-39   
ref|XP_010095492.1|  Potassium channel KAT3                             155   2e-39   
ref|XP_004498651.1|  PREDICTED: potassium channel AKT1-like isofo...    157   2e-39   
ref|XP_004498652.1|  PREDICTED: potassium channel AKT1-like isofo...    157   3e-39   
ref|XP_011019759.1|  PREDICTED: potassium channel AKT1 isoform X2       157   3e-39   
ref|XP_011019758.1|  PREDICTED: potassium channel AKT1 isoform X1       157   3e-39   
ref|XP_010254477.1|  PREDICTED: potassium channel AKT1-like             154   4e-39   
gb|EMT29322.1|  Potassium channel KAT1                                  153   5e-39   
gb|KHG29670.1|  Potassium channel AKT1 -like protein                    156   7e-39   
ref|XP_003545498.1|  PREDICTED: potassium channel AKT1-like             155   8e-39   
emb|CDY33464.1|  BnaA06g36090D                                          154   1e-38   
gb|AAL25649.1|AF197333_1  inward-rectifying K+ channel                  155   1e-38   
gb|EMT23215.1|  Potassium channel KAT1                                  154   1e-38   
ref|XP_011085715.1|  PREDICTED: potassium channel AKT1-like isofo...    155   2e-38   
gb|KHN06658.1|  Potassium channel AKT1                                  155   2e-38   
gb|AAL25648.1|AF197332_1  inward-rectifying K+ channel                  154   2e-38   
gb|KDO79684.1|  hypothetical protein CISIN_1g006769mg                   150   2e-38   
gb|KJB27110.1|  hypothetical protein B456_004G278500                    154   3e-38   
gb|KDO79683.1|  hypothetical protein CISIN_1g006769mg                   150   7e-38   
ref|XP_006356660.1|  PREDICTED: potassium channel KAT3-like             151   8e-38   
gb|KHN32491.1|  Potassium channel AKT1                                  152   1e-37   
emb|CDY62359.1|  BnaCnng40090D                                          151   1e-37   
emb|CAM88966.1|  AKT1 inward rectifier channel                          153   1e-37   
ref|XP_006476168.1|  PREDICTED: potassium channel KAT3-like             150   1e-37   
ref|XP_010230035.1|  PREDICTED: potassium channel AKT3-like             152   2e-37   
gb|KDO79682.1|  hypothetical protein CISIN_1g006769mg                   150   2e-37   
ref|XP_010325274.1|  PREDICTED: potassium channel KAT3                  150   2e-37   
ref|XP_008394036.1|  PREDICTED: potassium channel AKT1-like isofo...    152   2e-37   
gb|ACI45550.2|  potassium channel                                       150   2e-37   
ref|XP_010049062.1|  PREDICTED: potassium channel KAT3                  150   2e-37   
ref|XP_003523709.1|  PREDICTED: potassium channel KAT3-like             150   2e-37   
ref|XP_008394035.1|  PREDICTED: potassium channel AKT1-like isofo...    152   2e-37   
ref|XP_009801136.1|  PREDICTED: potassium channel KAT3-like isofo...    150   2e-37   
emb|CDP18439.1|  unnamed protein product                                150   2e-37   
ref|XP_009801143.1|  PREDICTED: potassium channel KAT3-like isofo...    149   2e-37   
ref|XP_011081924.1|  PREDICTED: potassium channel AKT1-like             151   3e-37   
ref|XP_009801142.1|  PREDICTED: potassium channel KAT3-like isofo...    149   3e-37   
ref|XP_012077471.1|  PREDICTED: potassium channel KAT3                  149   3e-37   
ref|XP_009801140.1|  PREDICTED: potassium channel KAT3-like isofo...    149   3e-37   
ref|XP_010254155.1|  PREDICTED: potassium channel KAT3-like isofo...    149   3e-37   
gb|ACJ05642.2|  potassium channel protein NKT5                          149   3e-37   
ref|XP_009589990.1|  PREDICTED: LOW QUALITY PROTEIN: potassium ch...    149   3e-37   
ref|XP_009801141.1|  PREDICTED: potassium channel KAT3-like isofo...    149   3e-37   
ref|XP_009400519.1|  PREDICTED: potassium channel KAT4-like             149   3e-37   
ref|XP_010254156.1|  PREDICTED: potassium channel KAT3-like isofo...    149   4e-37   
ref|XP_010656397.1|  PREDICTED: potassium channel AKT1-like isofo...    151   4e-37   
ref|XP_007225029.1|  hypothetical protein PRUPE_ppa019987mg             151   4e-37   
ref|XP_009609168.1|  PREDICTED: potassium channel KAT3-like isofo...    149   4e-37   
ref|XP_004501265.1|  PREDICTED: potassium channel KAT3-like isofo...    149   4e-37   
ref|XP_009609170.1|  PREDICTED: potassium channel KAT3-like isofo...    149   5e-37   
gb|KHN10286.1|  Potassium channel KAT3                                  147   5e-37   
ref|XP_004501264.1|  PREDICTED: potassium channel KAT3-like isofo...    149   5e-37   
ref|XP_009601875.1|  PREDICTED: potassium channel AKT1-like isofo...    150   5e-37   
ref|XP_009601876.1|  PREDICTED: potassium channel AKT1-like isofo...    150   6e-37   
ref|XP_009601874.1|  PREDICTED: potassium channel AKT1-like isofo...    150   6e-37   
ref|XP_009601872.1|  PREDICTED: potassium channel AKT1-like isofo...    150   7e-37   
gb|KJB82866.1|  hypothetical protein B456_013G218200                    148   7e-37   
ref|XP_002456254.1|  hypothetical protein SORBIDRAFT_03g033010          148   8e-37   
ref|XP_009770131.1|  PREDICTED: potassium channel AKT1-like             147   1e-36   
ref|XP_008392136.1|  PREDICTED: potassium channel AKT1                  150   1e-36   
ref|XP_007012019.1|  Potassium channel in 3                             147   1e-36   
ref|XP_008219894.1|  PREDICTED: potassium channel AKT1-like             149   2e-36   
ref|XP_008219833.1|  PREDICTED: potassium channel KAT3                  147   2e-36   
sp|Q8H569.1|AKT3_ORYSJ  RecName: Full=Potassium channel AKT3            149   2e-36   
ref|XP_007221853.1|  hypothetical protein PRUPE_ppa021985mg             147   2e-36   
ref|NP_001175074.1|  Os07g0175400                                       149   2e-36   
gb|KEH39823.1|  inwardly rectifying potassium channel subunit           149   2e-36   
ref|XP_006658326.1|  PREDICTED: potassium channel AKT3-like             146   3e-36   
ref|XP_006483310.1|  PREDICTED: potassium channel AKT6-like             147   1e-35   
ref|XP_006450501.1|  hypothetical protein CICLE_v10007406mg             147   1e-35   
ref|XP_010526124.1|  PREDICTED: potassium channel KAT3 isoform X2       144   2e-35   
ref|XP_010526123.1|  PREDICTED: potassium channel KAT3 isoform X1       144   2e-35   
ref|XP_010688091.1|  PREDICTED: potassium channel AKT1-like             145   3e-35   
ref|XP_004228423.1|  PREDICTED: potassium channel KAT3-like             143   4e-35   



>ref|XP_006349369.1| PREDICTED: potassium channel AKT2/3-like [Solanum tuberosum]
Length=837

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 157/207 (76%), Gaps = 10/207 (5%)
 Frame = +3

Query  270  YVAQAPNSMMNKDTAAsssssssQEDEDFSLGKLSKFILPPLGS--SQPTHTSSQGLVIS  443
            +V Q  NS  + ++A S         +D S   LSK ILPPLGS  S    T  +G +I+
Sbjct  24   HVVQDDNSHESSNSATSI--------DDLSFRNLSKLILPPLGSNGSNTNQTHEKGFIIT  75

Query  444  PMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFV  623
            PMDSRYRCWE+ MV++VAYSAWVCPFEI+F+ S  +T LY+ DN+VD+FFA DI LTFFV
Sbjct  76   PMDSRYRCWESLMVIMVAYSAWVCPFEIAFMRSNPNTTLYITDNVVDIFFAADIFLTFFV  135

Query  624  AYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLR  803
            AYID TTQLL+  R+KIA RYLSTWF+MDVASTIPF+ +A L TGKH +GV YSVLGMLR
Sbjct  136  AYIDATTQLLVRDRRKIAIRYLSTWFIMDVASTIPFDLLALLLTGKHQVGVSYSVLGMLR  195

Query  804  FWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FWRLRRV  FFTRL +D+RFSYFWVRC
Sbjct  196  FWRLRRVKQFFTRLEKDMRFSYFWVRC  222



>dbj|BAA84085.1| potassium channel [Nicotiana paniculata]
Length=824

 Score =   277 bits (709),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 157/196 (80%), Gaps = 2/196 (1%)
 Frame = +3

Query  303  KDTAAsssssssQEDEDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWET  476
            +D +  SS++S    E+ S   LSK ILPPLGS+      T  +G +I+PMDSRYRCWET
Sbjct  14   QDNSHGSSNNSGTNSEELSFRNLSKLILPPLGSNGYNQNQTQQKGKIITPMDSRYRCWET  73

Query  477  WMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLI  656
             MV++VAYS WVCPFEI+F+ S  +  LY+ DN+VDLFFAVDI+LTFFVAYID TTQLL+
Sbjct  74   LMVVMVAYSVWVCPFEIAFMHSNPNRALYLADNVVDLFFAVDIILTFFVAYIDTTTQLLV  133

Query  657  HHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFF  836
              R++IATRY+STWF+MDVASTIPF+ +A +FTGKH +GV YSVLGMLRFWRLRRV  FF
Sbjct  134  RDRRRIATRYISTWFMMDVASTIPFDLLALIFTGKHQIGVSYSVLGMLRFWRLRRVKQFF  193

Query  837  TRLXEDIRFSYFWVRC  884
            TRL +D+RFSYFWVRC
Sbjct  194  TRLEKDMRFSYFWVRC  209



>ref|XP_004230485.1| PREDICTED: potassium channel AKT2/3-like [Solanum lycopersicum]
Length=837

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 156/207 (75%), Gaps = 10/207 (5%)
 Frame = +3

Query  270  YVAQAPNSMMNKDTAAsssssssQEDEDFSLGKLSKFILPPLGS--SQPTHTSSQGLVIS  443
            +V Q  NS  + ++A           +D S   LSK ILPPLGS  S    T  +G +I+
Sbjct  24   HVVQDDNSHGSSNSAT--------PSDDLSFRNLSKLILPPLGSNDSNTNQTHEKGFIIT  75

Query  444  PMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFV  623
            PMDSRYRCWE+ MV++VAYSAWVCPFEI+F+ S  +T LY+ DN+VD+FFA DI LTFFV
Sbjct  76   PMDSRYRCWESLMVIMVAYSAWVCPFEIAFMHSNPNTALYITDNVVDIFFAADIFLTFFV  135

Query  624  AYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLR  803
            AYID TTQLL+  R+KIA RYLSTWF+MDVASTIPF+ +A L TGKH +GV YSVLGMLR
Sbjct  136  AYIDATTQLLVRDRRKIAIRYLSTWFIMDVASTIPFDLLALLLTGKHQVGVSYSVLGMLR  195

Query  804  FWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FWRLRRV  FFTRL +D+RFSYFWVRC
Sbjct  196  FWRLRRVKQFFTRLEKDMRFSYFWVRC  222



>ref|XP_009791067.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana sylvestris]
Length=837

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            ++ S   LSK ILPPLGS+      T  +G  I+PMDSRYRCWET MV++VAYSAWVCPF
Sbjct  42   DELSFRNLSKLILPPLGSNGYNQNQTQQKGKTITPMDSRYRCWETLMVIMVAYSAWVCPF  101

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            EI+F+ S  +  LY+ DN+VDLFFA+DI+LTFFVAYID TTQLL+  RK+IATRY+STWF
Sbjct  102  EIAFMHSNPNRVLYIADNVVDLFFAIDIILTFFVAYIDTTTQLLVGDRKRIATRYISTWF  161

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVASTIPF+ +A +FTGKH +GV YSVLGMLRFWRLRRV  FFTRL +D+RFSYFWVR
Sbjct  162  MMDVASTIPFDLLALIFTGKHQIGVSYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  221

Query  882  C  884
            C
Sbjct  222  C  222



>ref|XP_009614130.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana tomentosiformis]
Length=824

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            ++ S   LSK ILPPLGS+      T  +G +I+PMDSRYRCWET MV++VAYSAWVCPF
Sbjct  29   DELSFRNLSKLILPPLGSNDYNQNQTQQKGKIITPMDSRYRCWETLMVVMVAYSAWVCPF  88

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            EI+F+ S  +  LY  DN+VDLFFAVDI+LTFFVAYID TTQLL+  R++IATRY+STWF
Sbjct  89   EIAFMHSNPNRALYFADNVVDLFFAVDIILTFFVAYIDTTTQLLVRDRRRIATRYISTWF  148

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVASTIPF+ +A +FTGKH +G+ YSVLGMLRFWRLRRV  FFTRL +D+RFSYFWVR
Sbjct  149  MMDVASTIPFDLLALIFTGKHQIGISYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  208

Query  882  C  884
            C
Sbjct  209  C  209



>gb|ABF85695.1| potassium channel [Nicotiana rustica]
Length=826

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = +3

Query  303  KDTAAsssssssQEDEDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWET  476
            +D +  SS++S    ++ S   LSK ILPPLGS+      T  +G +I+PMDSRYRCWET
Sbjct  14   EDNSHGSSNNSGTNSDELSFRNLSKLILPPLGSNGYNQNQTQQKGKIITPMDSRYRCWET  73

Query  477  WMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLI  656
             MV++VAYS WVCPFEI+F+ S  +  LY  DN+VDLFFAVDI+LTFFVAYID TTQLL+
Sbjct  74   LMVVMVAYSVWVCPFEIAFMHSNPNRALYFADNVVDLFFAVDIILTFFVAYIDTTTQLLV  133

Query  657  HHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFF  836
              R++IATRY+STWF+MDVASTIPF+ +A +FTGKH +GV YSVLGMLRFWRLRRV  FF
Sbjct  134  RDRRRIATRYISTWFMMDVASTIPFDLLALIFTGKHQIGVSYSVLGMLRFWRLRRVKQFF  193

Query  837  TRLXEDIRFSYFWVRC  884
            TRL +D+RFSYFWVRC
Sbjct  194  TRLEKDMRFSYFWVRC  209



>ref|XP_011087731.1| PREDICTED: potassium channel AKT2/3 [Sesamum indicum]
Length=847

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 147/184 (80%), Gaps = 5/184 (3%)
 Frame = +3

Query  342  EDEDFSLGKLSKFILPPLGSSQ---PTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  512
            + ED S   LSK I+PPLG+S    P H  S+G +ISPMDS YRCWET MV+LVAYSAWV
Sbjct  50   DHEDLSFRNLSKLIVPPLGASAYTTPNH--SKGRIISPMDSTYRCWETVMVVLVAYSAWV  107

Query  513  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  692
            CP+EI+FL S   T LY  D IVD+FFAVDIVLTFFVAYID TTQLL+H   KIA RYLS
Sbjct  108  CPYEIAFLGSNPTTPLYTADIIVDVFFAVDIVLTFFVAYIDSTTQLLVHDPSKIAKRYLS  167

Query  693  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYF  872
            TWFLMDVASTIPFE +AFL +GKH  GV YSVLGMLRFWRLRRV  FFTR+ +DIRFSYF
Sbjct  168  TWFLMDVASTIPFELIAFLISGKHQAGVSYSVLGMLRFWRLRRVKTFFTRIEKDIRFSYF  227

Query  873  WVRC  884
            WVRC
Sbjct  228  WVRC  231



>dbj|BAD81033.1| potassium channel NKT2 [Nicotiana tabacum]
Length=824

 Score =   273 bits (697),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            ++     LSK ILPPLGS+      T  +G +I+PMDSRYRCWET MV++VAYSAWVCPF
Sbjct  29   DELGFRNLSKLILPPLGSNDYNQNQTQQKGKIITPMDSRYRCWETLMVVMVAYSAWVCPF  88

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            EI+F+ S  +  LY  DN+VDLFFAVDI+LTFFVAYID TTQLL+  R++IATRY STWF
Sbjct  89   EIAFMRSNPNRALYFADNVVDLFFAVDIILTFFVAYIDTTTQLLVRGRRRIATRYTSTWF  148

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVAST+PF+ +A +FTGKH +G+ YSVLGMLRFWRLRRV  FFTRL +D+RFSYFWVR
Sbjct  149  MMDVASTVPFDLLALIFTGKHQIGISYSVLGMLRFWRLRRVKQFFTRLEKDMRFSYFWVR  208

Query  882  C  884
            C
Sbjct  209  C  209



>emb|CDO97567.1| unnamed protein product [Coffea canephora]
Length=848

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            +D SL  LSK ILPPLG+S      T  +G +I PMDSRYRCWE+ MVLLVAYSAWVCPF
Sbjct  46   KDLSLRNLSKLILPPLGASSYDQNQTRFKGRIIFPMDSRYRCWESLMVLLVAYSAWVCPF  105

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            EI+FL S     LYV DNIVD FFAVDIVLTFFVAYIDP TQLL+   KKIA RYLSTWF
Sbjct  106  EIAFLSSHPKKLLYVADNIVDFFFAVDIVLTFFVAYIDPRTQLLVLDSKKIAKRYLSTWF  165

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            LMDVASTIPFE + FLFTGKH  G+ YSVLGMLRFWR+RRV  FF RL +DIRF+YFWVR
Sbjct  166  LMDVASTIPFEMIGFLFTGKHQSGLSYSVLGMLRFWRIRRVKKFFKRLEKDIRFNYFWVR  225

Query  882  C  884
            C
Sbjct  226  C  226



>ref|XP_009616703.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana tomentosiformis]
Length=847

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            + S   LSK ILPPLGSS      T  +G  ISPM SRYR WET MVLLVAY AWVCPFE
Sbjct  52   NLSFYNLSKLILPPLGSSGYNQNQTLQKGNTISPMTSRYRWWETLMVLLVAYCAWVCPFE  111

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++F++S  + +LY+ DNIV+LFFA DI+LTFFVAYIDPTTQLL+   +KIATRYLSTWFL
Sbjct  112  VAFMKSNTNKELYIADNIVNLFFAADIILTFFVAYIDPTTQLLVRDPRKIATRYLSTWFL  171

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MDVASTIPFE ++ LF+GKH +GV YSVLGMLRFWRLR+V  FFTRL +D+RFSYFWVRC
Sbjct  172  MDVASTIPFETLSLLFSGKHQIGVSYSVLGMLRFWRLRKVKQFFTRLEKDMRFSYFWVRC  231



>ref|XP_003593018.1| Potassium channel [Medicago truncatula]
 gb|AES63269.1| potassium outward rectifying channel protein [Medicago truncatula]
Length=830

 Score =   265 bits (676),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S+    SS+G +ISPMDSRYRCWE++MV+LVAYSAWV PFE++F
Sbjct  38   FNLRNVSKLILPPLGVSKQNSVSSKGWIISPMDSRYRCWESFMVILVAYSAWVYPFEVAF  97

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            + S  + KLY+VDNIVDLFFAVDIVLTFFVAY+D TT LL+   KKI  RYLSTWF+MDV
Sbjct  98   MHSSTNRKLYIVDNIVDLFFAVDIVLTFFVAYVDGTTHLLVRDSKKIVVRYLSTWFIMDV  157

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            ASTIP+E + +  TGKH L + Y +LGMLRFWR+RRV  FFTRL +DIRF+YFWVRC
Sbjct  158  ASTIPYEAIGYFLTGKHKLSLPYYLLGMLRFWRIRRVKQFFTRLEKDIRFNYFWVRC  214



>ref|XP_009795716.1| PREDICTED: potassium channel AKT2/3-like [Nicotiana sylvestris]
Length=864

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            + S   LSK ILPPLGSS      T  +G  ISPM SRYR WET MVLLVAY AWVCPFE
Sbjct  69   NLSFYNLSKLILPPLGSSGYNQNQTLQKGNTISPMTSRYRWWETVMVLLVAYCAWVCPFE  128

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            I+F++S  +  LY+ DNIV+LFFA DI+LTFFVAYIDPTTQLL+   +KIA RYLSTWFL
Sbjct  129  IAFMKSNTNKILYIADNIVNLFFAADIILTFFVAYIDPTTQLLVRDPRKIAIRYLSTWFL  188

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MDVASTIPFE ++ LFTGKH +GV YSVLGMLRFWRLR+V  FFTRL +D+RFSYFWVRC
Sbjct  189  MDVASTIPFEALSLLFTGKHQIGVSYSVLGMLRFWRLRKVKQFFTRLEKDMRFSYFWVRC  248



>ref|XP_010277671.1| PREDICTED: potassium channel AKT2/3-like [Nelumbo nucifera]
Length=838

 Score =   259 bits (661),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 147/185 (79%), Gaps = 4/185 (2%)
 Frame = +3

Query  342  EDED--FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAW  509
            ED+D    L  LSK ILPPLG  SS      S+G +ISPMDSRYRCWET+MVLLVAYSAW
Sbjct  38   EDDDAPLDLRYLSKIILPPLGDSSSNLNQIKSKGWIISPMDSRYRCWETFMVLLVAYSAW  97

Query  510  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  689
            V PFE++FL++     LY+ D IVDLFFA+DIVLTFF+AYIDP TQLL+   +KIA RYL
Sbjct  98   VYPFEVAFLKATPTRGLYIADTIVDLFFAIDIVLTFFLAYIDPRTQLLVRDSRKIAVRYL  157

Query  690  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSY  869
            STWF+MDVASTIPFE +AFLFTGK  +G+ Y +LG+LRFWRLRRV  FFTRL +DIRFSY
Sbjct  158  STWFIMDVASTIPFEALAFLFTGKSKVGLSYCILGLLRFWRLRRVKQFFTRLEKDIRFSY  217

Query  870  FWVRC  884
            F +RC
Sbjct  218  FLIRC  222



>ref|XP_004485488.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2/3-like 
[Cicer arietinum]
Length=840

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S+     S+G +ISPMDS+YR WE+ MV+LVAYSAWV PFE++F
Sbjct  44   FNLRNVSKLILPPLGVSKQNLVYSKGWIISPMDSKYRSWESLMVVLVAYSAWVYPFEVAF  103

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            + S  + KLY+VDN+VDLFFAVDI+LTFF+AYID TT LL+   KKI  RYLSTWFLMDV
Sbjct  104  MHSSPNRKLYIVDNVVDLFFAVDIILTFFLAYIDRTTHLLVRDSKKIVLRYLSTWFLMDV  163

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            AS+IP+E + ++ TGKH LG+ Y +LGMLRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  164  ASSIPYEAIGYILTGKHKLGLPYLLLGMLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  220



>ref|XP_007148520.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris]
 gb|ESW20514.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris]
Length=832

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S     +S+G +ISPMDS+YRCWE++MVLLVAYSAWV PFE++F
Sbjct  45   FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSKYRCWESFMVLLVAYSAWVYPFEVAF  104

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            +    + K+YVVD +VD FF +DI+LTFF+AYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  105  MHRSSNMKIYVVDTVVDFFFGIDIILTFFLAYIDQTTHLLVRDKKKIVVRYLSTWFVMDL  164

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            ASTIP+E + +LFTGKH +G+ Y +LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  165  ASTIPYEALGYLFTGKHKVGLPYFLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  221



>ref|NP_001275259.1| potassium channel AKT2/3-like [Solanum tuberosum]
 emb|CAA70870.1| putative inward rectifying potassium channel [Solanum tuberosum]
Length=845

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 142/181 (78%), Gaps = 3/181 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSS---QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            + S   LSK ILPPLGSS      +   +G  ISP+ S YRCWET MVLLVAY AWVCPF
Sbjct  49   NMSFHNLSKLILPPLGSSGYNQNQTDLHKGNTISPITSTYRCWETLMVLLVAYCAWVCPF  108

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            EI+F+    + KLY+ DNIV+L FA DI+LTF VAYID T+QLL+  R+KIATRY+STWF
Sbjct  109  EIAFMNLNPNKKLYIADNIVNLVFAADIILTFSVAYIDSTSQLLVRDRRKIATRYVSTWF  168

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            LMDVASTIPF+ +A LFTGKH +G+ YSVLG+LRFWRLR+V  FFTRL +D+RFSYFW+R
Sbjct  169  LMDVASTIPFDLLAMLFTGKHQVGISYSVLGILRFWRLRKVKQFFTRLEKDMRFSYFWIR  228

Query  882  C  884
            C
Sbjct  229  C  229



>ref|XP_003540163.1| PREDICTED: potassium channel AKT2/3-like isoform X1 [Glycine 
max]
 gb|KHN45473.1| Potassium channel AKT2/3 [Glycine soja]
Length=831

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  46   FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  105

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            +    + K+Y+ D++VDLFF +DIVLTFFVAYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  106  MHKSSNMKIYIADSVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVRYLSTWFVMDL  165

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            ASTIP+E + +LFTGK  LG+ Y +LG+ RFWR+RRV  +FTRL +DIRFSYFWVRC
Sbjct  166  ASTIPYEAIGYLFTGKRKLGLPYFLLGLFRFWRIRRVKQYFTRLEKDIRFSYFWVRC  222



>emb|CAA71598.1| potassium channel [Vicia faba]
Length=807

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S+     S+  +ISPMDSRYRCWE++MV+L+AYSAW  PFE++F
Sbjct  21   FNLRNVSKLILPPLGVSRENQVYSR-WIISPMDSRYRCWESFMVVLIAYSAWAYPFEVAF  79

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            + S  + KLY+VDNI+DLFFA+DIV+TFF+A+ID TT LL+   KKI  RYLSTWF+MDV
Sbjct  80   MHSSPNRKLYIVDNIIDLFFAIDIVMTFFLAFIDGTTHLLVRDSKKIVVRYLSTWFIMDV  139

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            ASTIP+E + F+ TGKH LG+ Y +LGMLRFWR+RRV  FFTRL +DIRFSYFWVRC
Sbjct  140  ASTIPYEAIGFILTGKHKLGLPYFLLGMLRFWRIRRVKQFFTRLEKDIRFSYFWVRC  196



>gb|KHN11238.1| Potassium channel AKT2/3 [Glycine soja]
Length=831

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  42   FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  101

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            +    + ++Y+VD +VDLFF +DIVLTFFVAYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  102  MHKSSNKEIYIVDTVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVRYLSTWFVMDL  161

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            ASTIP+E + +LFTG+  +G+ Y +LG+LRFWR+RRV  +FTRL +DIRFSYFWVRC
Sbjct  162  ASTIPYEAIGYLFTGRQKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRC  218



>ref|XP_003532990.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Glycine max]
Length=834

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  45   FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  104

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            +    + ++Y+VD +VDLFF +DIVLTFFVAYID TT LL+  +KKI  RYLSTWF+MD+
Sbjct  105  MHKSSNKEIYIVDTVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVRYLSTWFVMDL  164

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            ASTIP+E + +LFTG+  +G+ Y +LG+LRFWR+RRV  +FTRL +DIRFSYFWVRC
Sbjct  165  ASTIPYEAIGYLFTGRQKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRC  221



>ref|XP_010327298.1| PREDICTED: potassium channel AKT2/3-like [Solanum lycopersicum]
Length=841

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 142/181 (78%), Gaps = 3/181 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSS---QGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            + S   LSK I+PPLGSS      +   +G  ISP++S YRCWET MV+LVAY AWVCPF
Sbjct  51   NMSFHNLSKLIVPPLGSSGYNQNQTDLHKGNTISPINSTYRCWETLMVVLVAYCAWVCPF  110

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+    + KLY+ DNIV+LFFA DI+LTF VAYID T+QLL+  RKKIATRY+STWF
Sbjct  111  EMAFMNLNPNKKLYIADNIVNLFFAADIILTFSVAYIDSTSQLLVRDRKKIATRYVSTWF  170

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            LMDV STIPF+ VA  FTGKH +G+ YSVLG+LRFWRLR+V  FFTRL +D+RFSYFW+R
Sbjct  171  LMDVGSTIPFDLVAMFFTGKHQVGISYSVLGVLRFWRLRKVKQFFTRLEKDMRFSYFWIR  230

Query  882  C  884
            C
Sbjct  231  C  231



>ref|XP_012071314.1| PREDICTED: potassium channel AKT2/3 [Jatropha curcas]
 gb|KDP38842.1| hypothetical protein JCGZ_04999 [Jatropha curcas]
Length=830

 Score =   253 bits (647),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +3

Query  375  KFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            K ILPPLG S      T S+G +ISPMDSRYR WE++MV+LVAYSAWV PFE++FL +  
Sbjct  48   KIILPPLGVSSYNQNPTESKGWIISPMDSRYRSWESFMVVLVAYSAWVFPFEVAFLNASS  107

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
             T LY+ DNIVDLFFAVDIVLTF VAYID  TQLL+  R+KIA RYLSTWFLMDVAST+P
Sbjct  108  ITGLYIADNIVDLFFAVDIVLTFLVAYIDSRTQLLVRDRRKIAVRYLSTWFLMDVASTVP  167

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FE + +LFTGK  LG+ YS+LG+LRFWRLRRV   FTRL +DIRFSYFW+RC
Sbjct  168  FELLGYLFTGKEKLGLSYSLLGILRFWRLRRVKQLFTRLEKDIRFSYFWIRC  219



>ref|XP_010245053.1| PREDICTED: potassium channel AKT2/3-like isoform X2 [Nelumbo 
nucifera]
Length=841

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +3

Query  369  LSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            LSK ILPPLG   S P    S+G +ISP+DSRYRCWET+MV LVAYSAWV PFE++F ++
Sbjct  48   LSKIILPPLGDSGSNPNQIHSRGWIISPIDSRYRCWETFMVFLVAYSAWVYPFEVAFFKA  107

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
                 LY+ DNIVDLFFA DI+LTFFVAYIDP +QLL+   KKIA RYLSTWF+MD+AST
Sbjct  108  SPTRGLYIADNIVDLFFATDIILTFFVAYIDPRSQLLVRDSKKIAMRYLSTWFVMDIAST  167

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            IPFE +  LFTGK  +G+ Y +LG+LRFWRLRRV   FTRL +DIRFSYFW+RC
Sbjct  168  IPFEALGHLFTGKSKVGLTYCLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  221



>ref|XP_007225285.1| hypothetical protein PRUPE_ppa001379mg [Prunus persica]
 gb|EMJ26484.1| hypothetical protein PRUPE_ppa001379mg [Prunus persica]
Length=842

 Score =   251 bits (640),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 7/180 (4%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            D +L  +SK ILPPLG+S    T   S G +ISPMDSRYRCWET+MVLLVAYSAWV PFE
Sbjct  42   DLNLRNISKLILPPLGASSYNQTPIHSNGWIISPMDSRYRCWETFMVLLVAYSAWVYPFE  101

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
             +FL S     LY+ DN+VDLFFA+DI+LTFFVAYIDP TQLL+H  K+IA RYLSTWFL
Sbjct  102  EAFLNSSSHRPLYLADNVVDLFFAIDIILTFFVAYIDPRTQLLVHDSKRIAMRYLSTWFL  161

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MD+AST+PFE +     GK+ LGV YS+LG+LRFWR+RR    FTRL +DIRFSYFWVRC
Sbjct  162  MDLASTLPFEAL-----GKNKLGVSYSLLGLLRFWRIRRAKQLFTRLEKDIRFSYFWVRC  216



>ref|XP_010065457.1| PREDICTED: potassium channel AKT2/3 [Eucalyptus grandis]
 gb|KCW62963.1| hypothetical protein EUGRSUZ_G00560 [Eucalyptus grandis]
Length=832

 Score =   250 bits (639),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG+S  +     S+G V+SPMDSRYRCWET+MV+LV YSAWV PFE+
Sbjct  42   LSLKNLSKLILPPLGASTDSQNQIESRGRVLSPMDSRYRCWETFMVVLVFYSAWVFPFEV  101

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL+S  +  LY+ DN+VD FFAVDI+LTFFVAYIDP TQLL+   ++IATRYLSTWFLM
Sbjct  102  AFLDSSPNRGLYIADNVVDSFFAVDIILTFFVAYIDPRTQLLVRDSRRIATRYLSTWFLM  161

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVAST+PFE + +LF+GK  + +  S+LG+LRFWRLRRV   FTRL +DIRF+YFWVRC
Sbjct  162  DVASTLPFEALGYLFSGKPKVVLSCSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWVRC  220



>gb|KFK28793.1| hypothetical protein AALP_AA7G048900 [Arabis alpina]
Length=789

 Score =   249 bits (637),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 143/189 (76%), Gaps = 7/189 (4%)
 Frame = +3

Query  339  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  497
            +E+E++     SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE++MVLLVA
Sbjct  29   REEEEYDASSLSLNNLSKLILPPLGVASYNQNHICSSGWIISPMDSRYRCWESFMVLLVA  88

Query  498  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  677
            YSAWV PFE++FL S     L + DNIVDLFF VDIVLTFFVAYID  TQLL+   K+IA
Sbjct  89   YSAWVYPFEVAFLNSSPKRNLCIADNIVDLFFTVDIVLTFFVAYIDQRTQLLVREPKQIA  148

Query  678  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDI  857
             RYLSTWFLMDVASTIPF+ + +L TG   L +  S+LG+LRFWRLRRV N FTRL +DI
Sbjct  149  VRYLSTWFLMDVASTIPFDAIGYLVTGTSKLKLTCSLLGLLRFWRLRRVKNLFTRLEKDI  208

Query  858  RFSYFWVRC  884
            R+SYFWVRC
Sbjct  209  RYSYFWVRC  217



>ref|XP_008218775.1| PREDICTED: potassium channel AKT2/3 [Prunus mume]
Length=843

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 7/180 (4%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            D +L  +SK ILPPLG+S    T   S G +ISPMDSRYRCWET+MVLLVAYSAWV PFE
Sbjct  43   DLNLRNISKLILPPLGASSYNQTPIHSNGWIISPMDSRYRCWETFMVLLVAYSAWVYPFE  102

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
             +FL S     LY+ DN+VDLFFA+DI+LTFFVAYIDP +QLL+H  KKIA RYLSTWF+
Sbjct  103  EAFLNSSSYNPLYLADNVVDLFFAIDIILTFFVAYIDPRSQLLVHDSKKIAMRYLSTWFV  162

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MDVAST+PFE +     GK+ LGV YS+LG+LRFWR+RR    FTRL +DIRFSYFWVRC
Sbjct  163  MDVASTLPFEAL-----GKNKLGVSYSLLGLLRFWRIRRAKQLFTRLEKDIRFSYFWVRC  217



>ref|XP_006431832.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
 gb|ESR45072.1| hypothetical protein CICLE_v10000273mg [Citrus clementina]
Length=833

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  342  EDEDFSLGKLSKFILPPLG-SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            +D   SL  LSK ILPPLG SS   + +    +ISPMDSRYRCWET+MVLLVAYSAWVCP
Sbjct  33   DDASLSLRNLSKLILPPLGVSSYNQNQTKSKWIISPMDSRYRCWETFMVLLVAYSAWVCP  92

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL S  D KLY+ D+IVDLFFA+DI LTFFVAYI   +QLL+   KKIA RY+ TW
Sbjct  93   FEFAFLHSSPDKKLYIGDSIVDLFFAIDIFLTFFVAYIHRRSQLLVREPKKIALRYIKTW  152

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
            FLMDVASTIPFE + +L TG     + YS+LG+LRFWRLRRV   FTRL +DIRF+YFW+
Sbjct  153  FLMDVASTIPFEAIGYLITGNKKAALSYSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWI  212

Query  879  RC  884
            RC
Sbjct  213  RC  214



>ref|XP_009355246.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Pyrus x bretschneideri]
Length=870

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 3/180 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  69   ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  128

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++FL +     LY+ DN+VDLFFA DI+LTFFVAY+DP TQLL+H  KKIA RYLSTWFL
Sbjct  129  VAFLNTSKSRPLYIADNVVDLFFAADIILTFFVAYVDPRTQLLVHESKKIAMRYLSTWFL  188

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MD+AST+PFE + FL  GK+ L   YS+LG+LRFWRLRR    FTRL +DIRFSYFWVRC
Sbjct  189  MDLASTLPFEAL-FLALGKNKLSASYSLLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  247



>gb|AEY75251.1| potassium channel [Malus hupehensis]
Length=869

 Score =   249 bits (636),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65   ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++FL +     LY+ DN+VDLFFA DI+LTFFVAY+DP TQLL+H  KKIA RYLSTWFL
Sbjct  125  VAFLNTSKSRPLYIADNVVDLFFAADIILTFFVAYVDPRTQLLVHESKKIAMRYLSTWFL  184

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MD+AST+PFE + FL  GK+ L   YS LG+LRFWRLRR    FTRL +DIRFSYFWVRC
Sbjct  185  MDLASTLPFEAL-FLALGKNKLSASYSFLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  243



>ref|XP_010529461.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2/3-like 
[Tarenaya hassleriana]
Length=786

 Score =   248 bits (632),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +3

Query  375  KFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            K ILPPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++FL S  
Sbjct  44   KLILPPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAFLHSSP  103

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            +  LY+ DN+VDLFFA+DIVLTFFVAYID  TQLL+   +KIATRYLSTWFLMD+AST+P
Sbjct  104  NRDLYIADNVVDLFFAIDIVLTFFVAYIDQRTQLLVREPRKIATRYLSTWFLMDMASTLP  163

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +E + +L TGK  + +  S+LG+LRFWR+RRV + FTRL +DIR+SYFWVRC
Sbjct  164  YEAIGYLVTGKSKVSISCSLLGLLRFWRIRRVKHLFTRLEKDIRYSYFWVRC  215



>gb|KJB32473.1| hypothetical protein B456_005G242200 [Gossypium raimondii]
Length=832

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = +3

Query  279  QAPNSMMNKDTAAsssssssQEDEDFSLGKLSKFILPPLGSSQ--PTHTSSQGLVISPMD  452
            + PN          +S+  S+ ++  SL  LSKFI+PPLG S        S+G VI+PMD
Sbjct  17   KQPNEGKGAKVDEGTSTPQSELEDPLSLRNLSKFIIPPLGVSSYSQNQIDSKGWVITPMD  76

Query  453  SRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYI  632
            S YRCWET+MV+LV YS+WV PFE++FL S    KLY+ DNIVDLFFA+DIVLTFFVAYI
Sbjct  77   STYRCWETFMVMLVFYSSWVYPFEVAFLSSSAPRKLYMADNIVDLFFAIDIVLTFFVAYI  136

Query  633  DPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWR  812
            D  TQLL+   KKIA RYLSTWFL+DV STIPFE + +LFTG   +G+ YS+LG+LRF R
Sbjct  137  DTRTQLLVRDSKKIAIRYLSTWFLIDVISTIPFEALGYLFTGNSRVGISYSLLGLLRFCR  196

Query  813  LRRVSNFFTRLXEDIRFSYFWVRC  884
            LRRV   FTRL +DIRFSYFW+RC
Sbjct  197  LRRVKQLFTRLEKDIRFSYFWIRC  220



>gb|AAA96153.1| AKT3 [Arabidopsis thaliana]
 gb|AAA96154.1| AKT3 [Arabidopsis thaliana]
 emb|CAA16770.1| potassium channel protein AKT3 [Arabidopsis thaliana]
 emb|CAB79175.1| potassium channel protein AKT3 [Arabidopsis thaliana]
Length=787

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  23   LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFYMVLLVAYSAWVYPFEV  82

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  83   AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDERTQLLVREPKQIAVRYLSTWFLM  142

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DIR+SYFW+RC
Sbjct  143  DVASTIPFDAIGYLITGTSTLNITCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRC  201



>ref|XP_002867783.1| hypothetical protein ARALYDRAFT_492645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44042.1| hypothetical protein ARALYDRAFT_492645 [Arabidopsis lyrata subsp. 
lyrata]
Length=801

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  38   LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFYMVLLVAYSAWVYPFEV  97

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  98   AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  157

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DIR+SYFW+RC
Sbjct  158  DVASTIPFDAIGYLITGTSKLNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRC  216



>ref|XP_009405920.1| PREDICTED: potassium channel AKT2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  512
            +  E F+L  LSK +LPPLG S        S+G VI PMDSRYRCWET+MV+LVAYSAWV
Sbjct  14   ERSESFNLRNLSKLVLPPLGVSTYNQNQNDSRGKVILPMDSRYRCWETFMVVLVAYSAWV  73

Query  513  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  692
             PFEI+F+ +     L++ DN++D FFAVDIVLTFFVAYID  TQ+L+   +KIA RYLS
Sbjct  74   YPFEIAFMGAAPKGGLFIADNVIDAFFAVDIVLTFFVAYIDSRTQVLVRDPRKIAVRYLS  133

Query  693  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYF  872
            TWF+MD+AST+PFE + +L TG+   GV YS+LGMLR WRLR+V  FFTRL +DIRFSYF
Sbjct  134  TWFIMDLASTLPFEGLGYLITGRVKSGVSYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYF  193

Query  873  WVRC  884
            W+RC
Sbjct  194  WIRC  197



>ref|NP_567651.1| potassium channel AKT2/3 [Arabidopsis thaliana]
 sp|Q38898.1|AKT2_ARATH RecName: Full=Potassium channel AKT2/3 [Arabidopsis thaliana]
 gb|AAA97865.1| potassium channel [Arabidopsis thaliana]
 dbj|BAF01572.1| potassium channel [Arabidopsis thaliana]
 gb|AEE84571.1| potassium channel AKT2/3 [Arabidopsis thaliana]
Length=802

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  38   LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFYMVLLVAYSAWVYPFEV  97

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  98   AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDERTQLLVREPKQIAVRYLSTWFLM  157

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DIR+SYFW+RC
Sbjct  158  DVASTIPFDAIGYLITGTSTLNITCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRC  216



>ref|XP_008378875.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Malus domestica]
Length=821

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65   ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++FL +     LY+ DN+VDLFF  DI+LTFFVAY+DP TQLL+H  KKIA RYL+TWFL
Sbjct  125  VAFLNTSKSRPLYIADNVVDLFFXADIILTFFVAYVDPRTQLLVHDSKKIAMRYLTTWFL  184

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MD+AST+PFE + FL  GK+ L   YS+LG+LRFWRLRR    FTRL +DIRFSYFWVRC
Sbjct  185  MDLASTLPFEAL-FLALGKNKLSASYSLLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  243



>ref|XP_007042250.1| Potassium transport 2/3 isoform 1 [Theobroma cacao]
 gb|EOX98081.1| Potassium transport 2/3 isoform 1 [Theobroma cacao]
Length=839

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +3

Query  387  PPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            PPLG S        S+G +ISPMDSRYRCWET+MVLLV YSAWV PFE+SF  S    +L
Sbjct  56   PPLGVSSYNQNQIKSKGWIISPMDSRYRCWETFMVLLVFYSAWVYPFEVSFFSSSPPRRL  115

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            Y+ DNIVDLFFAVDIVLTFFVAYID  T LL+   KKIA RYLSTWFLMD+ASTIPFE +
Sbjct  116  YIADNIVDLFFAVDIVLTFFVAYIDRRTHLLVQDSKKIAVRYLSTWFLMDLASTIPFEAL  175

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +LFTGK  +G+ YS+LG+LRFWRLRRV   FTRL +DIRFSYFW+RC
Sbjct  176  GYLFTGKSKVGISYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  223



>ref|XP_010245052.1| PREDICTED: potassium channel AKT2/3-like isoform X1 [Nelumbo 
nucifera]
Length=844

 Score =   246 bits (628),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = +3

Query  378  FILPPLG-SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDT  554
            F++PPLG S+   + +S G +ISPMDSRYRCWET+MV LVAYSAWV PFE++F ++    
Sbjct  55   FLIPPLGVSTYDENQNSGGGIISPMDSRYRCWETFMVFLVAYSAWVYPFEVAFFKASPTR  114

Query  555  KLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFE  734
             LY+ DNIVDLFFA DI+LTFFVAYIDP +QLL+   KKIA RYLSTWF+MD+ASTIPFE
Sbjct  115  GLYIADNIVDLFFATDIILTFFVAYIDPRSQLLVRDSKKIAMRYLSTWFVMDIASTIPFE  174

Query  735  FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +  LFTGK  +G+ Y +LG+LRFWRLRRV   FTRL +DIRFSYFW+RC
Sbjct  175  ALGHLFTGKSKVGLTYCLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  224



>ref|XP_002529533.1| Potassium channel AKT2/3, putative [Ricinus communis]
 gb|EEF32836.1| Potassium channel AKT2/3, putative [Ricinus communis]
Length=845

 Score =   246 bits (628),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 156/197 (79%), Gaps = 4/197 (2%)
 Frame = +3

Query  306  DTAAsssssssQEDED--FSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWE  473
            +T ++++++  +ED+D   SL  LSK ILPPLG S   +    ++G +ISPMDSRYR W 
Sbjct  29   ETESNTTATHQEEDDDTSLSLSSLSKIILPPLGVSSYNNNPIETRGWIISPMDSRYRWWG  88

Query  474  TWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLL  653
            ++MVLLVAYSAWV PFE++FL S  + +LY+ DNIVDLFFA+DIVLTFFVAYID  TQL+
Sbjct  89   SFMVLLVAYSAWVYPFEVAFLNSSPNKRLYIADNIVDLFFAIDIVLTFFVAYIDSRTQLM  148

Query  654  IHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNF  833
            +  RKKIATRYLSTWFLMDVASTIPFE +A+LFTG   L + YS+LG+LRFWRLRRV   
Sbjct  149  VRDRKKIATRYLSTWFLMDVASTIPFEALAYLFTGTQKLALSYSLLGILRFWRLRRVKQL  208

Query  834  FTRLXEDIRFSYFWVRC  884
            FTRL +DIRFSYF +RC
Sbjct  209  FTRLEKDIRFSYFRIRC  225



>ref|XP_008378877.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Malus domestica]
Length=869

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 3/180 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65   ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++FL +     LY+ DN+VDLFF  DI+LTFFVAY+DP TQLL+H  KKIA RYL+TWFL
Sbjct  125  VAFLNTSKSRPLYIADNVVDLFFXADIILTFFVAYVDPRTQLLVHDSKKIAMRYLTTWFL  184

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MD+AST+PFE + FL  GK+ L   YS+LG+LRFWRLRR    FTRL +DIRFSYFWVRC
Sbjct  185  MDLASTLPFEAL-FLALGKNKLSASYSLLGLLRFWRLRRAKQLFTRLEKDIRFSYFWVRC  243



>ref|XP_004961989.1| PREDICTED: potassium channel AKT2-like isoform X1 [Setaria italica]
Length=855

 Score =   246 bits (628),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            F+L  LSK ILPPLG     H  S G     VISP+DSRYRCWET+MV+LVAYSAWV PF
Sbjct  35   FNLRNLSKVILPPLGGPSSGHGQSHGGSDKRVISPLDSRYRCWETFMVVLVAYSAWVYPF  94

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLL+  RKKI  RYLST+F
Sbjct  95   EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKITFRYLSTFF  154

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVASTIPF+ +A+L TG+   G  YS+LG+LR WRLR+V  FFTRL +DIRFSYFW+R
Sbjct  155  IMDVASTIPFQGLAYLVTGEVREGAAYSLLGILRLWRLRKVKQFFTRLEKDIRFSYFWIR  214

Query  882  C  884
            C
Sbjct  215  C  215



>ref|XP_004961990.1| PREDICTED: potassium channel AKT2-like isoform X2 [Setaria italica]
Length=857

 Score =   246 bits (628),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            F+L  LSK ILPPLG     H  S G     VISP+DSRYRCWET+MV+LVAYSAWV PF
Sbjct  35   FNLRNLSKVILPPLGGPSSGHGQSHGGSDKRVISPLDSRYRCWETFMVVLVAYSAWVYPF  94

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLL+  RKKI  RYLST+F
Sbjct  95   EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKITFRYLSTFF  154

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVASTIPF+ +A+L TG+   G  YS+LG+LR WRLR+V  FFTRL +DIRFSYFW+R
Sbjct  155  IMDVASTIPFQGLAYLVTGEVREGAAYSLLGILRLWRLRKVKQFFTRLEKDIRFSYFWIR  214

Query  882  C  884
            C
Sbjct  215  C  215



>ref|XP_010539338.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Tarenaya hassleriana]
Length=807

 Score =   245 bits (626),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  387  PPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            PPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYS+WV PFE++FL S  +  L
Sbjct  48   PPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSSWVYPFEVAFLNSSPNRDL  107

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            Y+ DNIVDLFFAVDIVLTFFVA+ID  TQLL+   +KIATRYLSTWFLMDVAST+P+E +
Sbjct  108  YIADNIVDLFFAVDIVLTFFVAFIDQRTQLLVREPRKIATRYLSTWFLMDVASTLPYEAI  167

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +L TGK +L +  S+LG+LRFWR+RRV + FTRL +DIRFSYFWVRC
Sbjct  168  GYLVTGKPNLSISCSLLGLLRFWRIRRVKHLFTRLEKDIRFSYFWVRC  215



>ref|XP_010539356.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Tarenaya hassleriana]
Length=794

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  387  PPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            PPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYS+WV PFE++FL S  +  L
Sbjct  48   PPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSSWVYPFEVAFLNSSPNRDL  107

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            Y+ DNIVDLFFAVDIVLTFFVA+ID  TQLL+   +KIATRYLSTWFLMDVAST+P+E +
Sbjct  108  YIADNIVDLFFAVDIVLTFFVAFIDQRTQLLVREPRKIATRYLSTWFLMDVASTLPYEAI  167

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +L TGK +L +  S+LG+LRFWR+RRV + FTRL +DIRFSYFWVRC
Sbjct  168  GYLVTGKPNLSISCSLLGLLRFWRIRRVKHLFTRLEKDIRFSYFWVRC  215



>ref|XP_010539347.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Tarenaya hassleriana]
Length=801

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  387  PPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            PPLG  S    H SS G +ISPMDSRYRCWE++MVLLVAYS+WV PFE++FL S  +  L
Sbjct  42   PPLGVASYNQNHISSSGWIISPMDSRYRCWESFMVLLVAYSSWVYPFEVAFLNSSPNRDL  101

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            Y+ DNIVDLFFAVDIVLTFFVA+ID  TQLL+   +KIATRYLSTWFLMDVAST+P+E +
Sbjct  102  YIADNIVDLFFAVDIVLTFFVAFIDQRTQLLVREPRKIATRYLSTWFLMDVASTLPYEAI  161

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +L TGK +L +  S+LG+LRFWR+RRV + FTRL +DIRFSYFWVRC
Sbjct  162  GYLVTGKPNLSISCSLLGLLRFWRIRRVKHLFTRLEKDIRFSYFWVRC  209



>ref|XP_006283121.1| hypothetical protein CARUB_v10004143mg, partial [Capsella rubella]
 gb|EOA16019.1| hypothetical protein CARUB_v10004143mg, partial [Capsella rubella]
Length=820

 Score =   245 bits (626),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  57   LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWELFMVLLVAYSAWVYPFEV  116

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  117  AFLNFSPKRNLSIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  176

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPF+ + +L TG   L + +++LG+LRFWRLRRV + FTRL +DIR+SYFW+RC
Sbjct  177  DVASTIPFDAIGYLITGTAKLNLTFNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRC  235



>ref|XP_006471022.1| PREDICTED: potassium channel AKT2/3-like [Citrus sinensis]
Length=833

 Score =   245 bits (626),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  342  EDEDFSLGKLSKFILPPLG-SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            +D   SL  LSK ILPPLG SS   + +    +ISPMDSRYRCWET+MVLLVAYSAWV P
Sbjct  33   DDASLSLRNLSKLILPPLGVSSYNQNQTKSKWIISPMDSRYRCWETFMVLLVAYSAWVYP  92

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL S  D KLY+ D+IVDLFFA+DI LTFFVAYI   +QLL+   KKIA RY+ TW
Sbjct  93   FEFAFLHSSPDKKLYIADSIVDLFFAIDIFLTFFVAYIHRRSQLLVREPKKIALRYIKTW  152

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
            FLMDVASTIPFE + +L TG     + YS+LG+LRFWRLRRV   FTRL +DIRF+YFW+
Sbjct  153  FLMDVASTIPFEAIGYLITGNKKTALSYSLLGILRFWRLRRVKKLFTRLEKDIRFNYFWI  212

Query  879  RC  884
            RC
Sbjct  213  RC  214



>ref|XP_010101161.1| Potassium channel [Morus notabilis]
 gb|EXB87379.1| Potassium channel [Morus notabilis]
Length=851

 Score =   245 bits (626),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 139/179 (78%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             +L  LSK ILPPLG  SS  T   S+G +ISPM SRYRCWET+MVLLVAYSAW+ P E+
Sbjct  62   LNLKNLSKLILPPLGDSSSNQTQIQSKGWIISPMVSRYRCWETFMVLLVAYSAWMYPIEV  121

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            SFL S     LY+ D++VDLFFA+DIVLTFFVAYID TTQLL+   KKIA RYLSTWFLM
Sbjct  122  SFLNSYPKKPLYIADSVVDLFFAIDIVLTFFVAYIDSTTQLLVRDFKKIALRYLSTWFLM  181

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPFE + +LFTG   + +   +LGMLRFWRLRRV  FFTRL +DIRF+YFW RC
Sbjct  182  DVASTIPFETLYYLFTGNRKIPLSCYLLGMLRFWRLRRVKQFFTRLEKDIRFNYFWTRC  240



>ref|XP_008783360.1| PREDICTED: potassium channel AKT2 [Phoenix dactylifera]
Length=844

 Score =   244 bits (624),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGS--SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWV  512
            + +  F+L  LSK +LPPLG+     T   S+G +ISPMDSRYRCWE +MV+LVAYSAWV
Sbjct  35   KHEASFNLRTLSKLVLPPLGALGYNQTQVESRGRIISPMDSRYRCWEAFMVILVAYSAWV  94

Query  513  CPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  692
             PFE++F+ S     L + D+I D+FFA+DIVLTFF+AYID  TQLL+   K+IA RYLS
Sbjct  95   YPFEVAFMNSSPKGVLCITDSITDIFFAIDIVLTFFLAYIDSKTQLLVQDPKRIAIRYLS  154

Query  693  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYF  872
            TWF+MDVASTIPFE + +L TG+   G+ YS+LGMLR WRLR+V  FFTRL +DIRFSYF
Sbjct  155  TWFIMDVASTIPFEGLGYLITGEIKEGISYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYF  214

Query  873  WVRC  884
            W+RC
Sbjct  215  WIRC  218



>ref|XP_006413681.1| hypothetical protein EUTSA_v10024449mg [Eutrema salsugineum]
 gb|ESQ55134.1| hypothetical protein EUTSA_v10024449mg [Eutrema salsugineum]
Length=796

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 136/179 (76%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG  S    H  S G +ISPMDSRYR WE++MVLLVAYSAWV PFE+
Sbjct  41   LSLNNLSKLILPPLGVASYNQNHIISSGWIISPMDSRYRWWESFMVLLVAYSAWVYPFEV  100

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL S     L + DNIVDLFFAVDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  101  AFLNSSPKRNLCIADNIVDLFFAVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  160

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DIRF YFW+RC
Sbjct  161  DVASTIPFDAIGYLITGTGKLNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRFCYFWIRC  219



>ref|XP_010681787.1| PREDICTED: potassium channel AKT2/3 isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=704

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            +L  LSK +LPPLG S     H +S G +ISP+ S+YRCWET MV+LVAYSAWV PFE++
Sbjct  40   TLRNLSKMVLPPLGVSAYNYNHLNSNGWIISPIHSKYRCWETLMVVLVAYSAWVYPFEVA  99

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F++S L  +L++ DNIV++FFA+DI++TFF+AY D  TQLL+   +KIA RYLSTWF+MD
Sbjct  100  FMKSYLKRELFIADNIVNVFFAIDIIITFFLAYFDSRTQLLVSDFRKIAIRYLSTWFIMD  159

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  160  LASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  217



>ref|XP_010439358.1| PREDICTED: potassium channel AKT2/3 [Camelina sativa]
Length=803

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 139/187 (74%), Gaps = 5/187 (3%)
 Frame = +3

Query  339  QEDED---FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  503
            +ED D    SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYS
Sbjct  30   EEDYDASSLSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFFMVLLVAYS  89

Query  504  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  683
            AWV PFE++FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA R
Sbjct  90   AWVYPFEVAFLNFSPKRNLCIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVR  149

Query  684  YLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRF  863
            YLSTWFLMDVASTIPF+ + +L TG     +  ++LG+LRFWRLRRV + FTRL +DIR+
Sbjct  150  YLSTWFLMDVASTIPFDAIGYLITGTAKWNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRY  209

Query  864  SYFWVRC  884
            SYFW+RC
Sbjct  210  SYFWIRC  216



>ref|XP_010930758.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT2-like [Elaeis 
guineensis]
Length=834

 Score =   240 bits (613),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 138/187 (74%), Gaps = 5/187 (3%)
 Frame = +3

Query  339  QEDED---FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  503
             EDE    F LG L++ ILPPLG  SS  T    +G VI+PMDSRYR WET+MV+LVAYS
Sbjct  29   HEDESSTSFILGNLAELILPPLGVSSSNQTQVDPKGRVIAPMDSRYRYWETFMVMLVAYS  88

Query  504  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  683
            AWV P EI F+ +     L++ DNI+  FFAVDI+LTFFVAYI+P TQLL+   KKIA R
Sbjct  89   AWVFPLEIGFMNAAPKGGLFIADNIIHAFFAVDIILTFFVAYIEPRTQLLVQDSKKIAIR  148

Query  684  YLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRF  863
            YLSTWF+MDV STIP+E + +  TG+   GV YS+LGMLR WRL ++  FFTRL +DIRF
Sbjct  149  YLSTWFIMDVVSTIPYEALGYFITGRVKAGVSYSLLGMLRLWRLSKIKQFFTRLEKDIRF  208

Query  864  SYFWVRC  884
            SYFW+RC
Sbjct  209  SYFWIRC  215



>ref|XP_010448923.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
Length=802

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 139/187 (74%), Gaps = 5/187 (3%)
 Frame = +3

Query  339  QEDED---FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  503
            +ED D    SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYS
Sbjct  30   EEDYDASSLSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFFMVLLVAYS  89

Query  504  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  683
            AWV PFE++FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA R
Sbjct  90   AWVYPFEVAFLNFSPKRNLCIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVR  149

Query  684  YLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRF  863
            YLSTWFLMDVASTIPF+ + +L TG     +  ++LG+LRFWRLRRV + FTRL +DIR+
Sbjct  150  YLSTWFLMDVASTIPFDAIGYLITGTAKWNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRY  209

Query  864  SYFWVRC  884
            SYFW+RC
Sbjct  210  SYFWIRC  216



>ref|XP_010681786.1| PREDICTED: potassium channel AKT2/3 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=730

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            +L  LSK +LPPLG S     H +S G +ISP+ S+YRCWET MV+LVAYSAWV PFE++
Sbjct  40   TLRNLSKMVLPPLGVSAYNYNHLNSNGWIISPIHSKYRCWETLMVVLVAYSAWVYPFEVA  99

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F++S L  +L++ DNIV++FFA+DI++TFF+AY D  TQLL+   +KIA RYLSTWF+MD
Sbjct  100  FMKSYLKRELFIADNIVNVFFAIDIIITFFLAYFDSRTQLLVSDFRKIAIRYLSTWFIMD  159

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  160  LASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  217



>ref|XP_010681788.1| PREDICTED: potassium channel AKT2/3 isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=701

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            +L  LSK +LPPLG S     H +S G +ISP+ S+YRCWET MV+LVAYSAWV PFE++
Sbjct  40   TLRNLSKMVLPPLGVSAYNYNHLNSNGWIISPIHSKYRCWETLMVVLVAYSAWVYPFEVA  99

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F++S L  +L++ DNIV++FFA+DI++TFF+AY D  TQLL+   +KIA RYLSTWF+MD
Sbjct  100  FMKSYLKRELFIADNIVNVFFAIDIIITFFLAYFDSRTQLLVSDFRKIAIRYLSTWFIMD  159

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  160  LASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  217



>gb|ERN20685.1| hypothetical protein AMTR_s00070p00197870 [Amborella trichopoda]
Length=814

 Score =   239 bits (611),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  360  LGKLSKFILPPLGSSQP----THTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
            L  LSKF+LPPLG+S      T  +S+G +ISP+DS YRCWET+MVLLVAYSAW  PFEI
Sbjct  17   LRNLSKFLLPPLGASSSDCGQTPINSKGSMISPLDSGYRCWETFMVLLVAYSAWTYPFEI  76

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +F+ S    +L++ DNIV+LFFA+DI LTFF+AYIDP TQ+L+H+R+KIA RY+STWF+M
Sbjct  77   AFINSTPKGELFIADNIVNLFFAMDIALTFFLAYIDPKTQILVHNRRKIAVRYISTWFIM  136

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            D+ STIPF  +  LFTG++  G+  S LGMLR WRL RV  FFTR+ +DIRFSYFW+RC
Sbjct  137  DLVSTIPFGALTKLFTGEYRCGLSCSFLGMLRLWRLLRVKQFFTRIEKDIRFSYFWIRC  195



>gb|AAD39492.1|AF145272_1 pulvinus inward-rectifying channel SPICK2 [Samanea saman]
Length=810

 Score =   239 bits (610),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  342  EDEDFSLGKLSKFILPPLGSS-------QPTHTSSQGLVISPMDSRYRCWETWMVLLVAY  500
            E   F+L  +SK ILPPLG+S        P H  +   +ISP+D+RYRCWE+ MV+LV Y
Sbjct  33   ESPTFNLQNVSKVILPPLGASTYNDRNSSPHHPKT--WIISPLDTRYRCWESLMVVLVGY  90

Query  501  SAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIAT  680
            SAWV PFEI FL S    KLY+VDNI+D+FF VDIVLTFF+AYID +TQLL+   K+IA 
Sbjct  91   SAWVYPFEIGFLMSSPTHKLYIVDNIIDIFFGVDIVLTFFLAYIDSSTQLLVQDSKQIAL  150

Query  681  RYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIR  860
            RYLSTWF+MDVAS+IP+E + +LFTGKH +G+ + +LGMLR WRLRRV  +FTRL +DIR
Sbjct  151  RYLSTWFVMDVASSIPYEALGYLFTGKHKVGLTFFLLGMLRLWRLRRVKQYFTRLEKDIR  210

Query  861  FSYFWVRC  884
            FSYF +RC
Sbjct  211  FSYFLIRC  218



>ref|XP_006859218.2| PREDICTED: potassium channel AKT2/3 [Amborella trichopoda]
Length=852

 Score =   239 bits (611),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 4/179 (2%)
 Frame = +3

Query  360  LGKLSKFILPPLGSSQP----THTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
            L  LSKF+LPPLG+S      T  +S+G +ISP+DS YRCWET+MVLLVAYSAW  PFEI
Sbjct  55   LRNLSKFLLPPLGASSSDCGQTPINSKGSMISPLDSGYRCWETFMVLLVAYSAWTYPFEI  114

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +F+ S    +L++ DNIV+LFFA+DI LTFF+AYIDP TQ+L+H+R+KIA RY+STWF+M
Sbjct  115  AFINSTPKGELFIADNIVNLFFAMDIALTFFLAYIDPKTQILVHNRRKIAVRYISTWFIM  174

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            D+ STIPF  +  LFTG++  G+  S LGMLR WRL RV  FFTR+ +DIRFSYFW+RC
Sbjct  175  DLVSTIPFGALTKLFTGEYRCGLSCSFLGMLRLWRLLRVKQFFTRIEKDIRFSYFWIRC  233



>gb|AAD16278.1| pulvinus inward-rectifying channel for potassium SPICK1 [Samanea 
saman]
Length=832

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 149/188 (79%), Gaps = 7/188 (4%)
 Frame = +3

Query  339  QEDE---DFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  503
            +ED+    F+L  +SK ILPPLG S        ++G +ISPMD+RYR W+  MVLLVAYS
Sbjct  35   EEDDMSPSFNLQNVSKLILPPLGVSSYNLNPVENKGWIISPMDTRYRYWQGVMVLLVAYS  94

Query  504  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  683
            AWV PFE++FL S  + ++++VDN+VD+FFAVDIVLTFFVA+ID  TQLL+   KKIA R
Sbjct  95   AWVYPFEVAFLHSSPNKEVFIVDNVVDIFFAVDIVLTFFVAFIDRRTQLLVRDAKKIAVR  154

Query  684  YLSTWFLMDVASTIPFEFVAFLFTGKHHLG-VCYSVLGMLRFWRLRRVSNFFTRLXEDIR  860
            YLS+WF++DVASTIP+E ++++ TGKH +G VCY +LGMLRFWRLRR+  FFTRL +DIR
Sbjct  155  YLSSWFVLDVASTIPYEALSYVITGKHKVGLVCY-LLGMLRFWRLRRMKQFFTRLEKDIR  213

Query  861  FSYFWVRC  884
            FSYFWVRC
Sbjct  214  FSYFWVRC  221



>ref|XP_010681784.1| PREDICTED: potassium channel AKT2/3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=810

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            +L  LSK +LPPLG S     H +S G +ISP+ S+YRCWET MV+LVAYSAWV PFE++
Sbjct  40   TLRNLSKMVLPPLGVSAYNYNHLNSNGWIISPIHSKYRCWETLMVVLVAYSAWVYPFEVA  99

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F++S L  +L++ DNIV++FFA+DI++TFF+AY D  TQLL+   +KIA RYLSTWF+MD
Sbjct  100  FMKSYLKRELFIADNIVNVFFAIDIIITFFLAYFDSRTQLLVSDFRKIAIRYLSTWFIMD  159

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +ASTIP+E +A +FTGK+   + Y +LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  160  LASTIPYEALALMFTGKYKESISYYLLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  217



>ref|XP_010434070.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
 ref|XP_010434071.1| PREDICTED: potassium channel AKT2/3-like [Camelina sativa]
Length=801

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 135/179 (75%), Gaps = 2/179 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             SL  LSK ILPPLG  S    H  S G +ISPMDSRYRCWE +MVLLVAYSAWV PFE+
Sbjct  38   LSLNNLSKLILPPLGVASYNQNHIRSSGWIISPMDSRYRCWEFFMVLLVAYSAWVYPFEV  97

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL       L + DNIVDLFF+VDIVLTFFVAYID  TQLL+   K+IA RYLSTWFLM
Sbjct  98   AFLNFSPKRNLCIADNIVDLFFSVDIVLTFFVAYIDQRTQLLVREPKQIAVRYLSTWFLM  157

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DVASTIPF+ + +L TG     +  ++LG+LRFWRLRRV + FTRL +DIR+SYFW+RC
Sbjct  158  DVASTIPFDAIGYLITGTAKWNLTCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRC  216



>emb|CDX79135.1| BnaA01g12020D [Brassica napus]
Length=788

 Score =   237 bits (604),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 140/189 (74%), Gaps = 7/189 (4%)
 Frame = +3

Query  339  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  497
            + DE++     SL  LSK ILPPLG  S       S G VISPMDSRYR WE++MVLLVA
Sbjct  24   ERDEEYDASSLSLNNLSKLILPPLGVASYNQNQIISNGWVISPMDSRYRWWESFMVLLVA  83

Query  498  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  677
            YSAWV PFE++FL S     L + DNIVD+FFAVDIVLTFFVAYID  TQLL+   K+IA
Sbjct  84   YSAWVYPFEVAFLNSSPKRNLCIADNIVDMFFAVDIVLTFFVAYIDRRTQLLVREPKQIA  143

Query  678  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDI  857
             RYLSTWFLMDVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DI
Sbjct  144  VRYLSTWFLMDVASTIPFDAIGYLVTGTGKLNLTCNILGLLRFWRLRRVKHLFTRLEKDI  203

Query  858  RFSYFWVRC  884
            RFSYF +RC
Sbjct  204  RFSYFCIRC  212



>gb|EYU26523.1| hypothetical protein MIMGU_mgv1a001765mg [Erythranthe guttata]
Length=762

 Score =   236 bits (602),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  447  MDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVA  626
            MDSRYRCWET MV+LVAYSAWVCP+EI+FL+S  +T L++ DNIVD FFAVDIVLTFFVA
Sbjct  1    MDSRYRCWETLMVILVAYSAWVCPYEIAFLKSNPNTPLFIADNIVDFFFAVDIVLTFFVA  60

Query  627  YIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRF  806
            YID TTQLLIH  +KIA RYLSTWF+MDVASTIPFE +AF  + + H  + YS+LG+LRF
Sbjct  61   YIDSTTQLLIHDSRKIAKRYLSTWFIMDVASTIPFETIAFFISSERHSPLTYSLLGLLRF  120

Query  807  WRLRRVSNFFTRLXEDIRFSYFWVRC  884
            WRLRRV +FFTR+ +DIRFSYFWVRC
Sbjct  121  WRLRRVKSFFTRIEKDIRFSYFWVRC  146



>ref|XP_009135705.1| PREDICTED: potassium channel AKT2/3 [Brassica rapa]
Length=788

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 140/189 (74%), Gaps = 7/189 (4%)
 Frame = +3

Query  339  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  497
            + DE++     SL  LSK ILPPLG  S       S G VISPMDSRYR WE++MVLLVA
Sbjct  24   ERDEEYDASSLSLNNLSKLILPPLGVASYNQNQIISSGWVISPMDSRYRWWESFMVLLVA  83

Query  498  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  677
            YSAWV PFE++FL S     L + DNIVD+FFAVDIVLTFFVAYID  TQLL+   K+IA
Sbjct  84   YSAWVYPFEVAFLNSSPKRNLCIADNIVDMFFAVDIVLTFFVAYIDRRTQLLVREPKQIA  143

Query  678  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDI  857
             RYLSTWFLMDVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DI
Sbjct  144  VRYLSTWFLMDVASTIPFDAIGYLVTGTGKLNLTCNILGLLRFWRLRRVKHLFTRLEKDI  203

Query  858  RFSYFWVRC  884
            RFSYF +RC
Sbjct  204  RFSYFCIRC  212



>ref|XP_003568398.1| PREDICTED: potassium channel AKT2 [Brachypodium distachyon]
 ref|XP_010231341.1| PREDICTED: potassium channel AKT2 [Brachypodium distachyon]
Length=858

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 139/181 (77%), Gaps = 4/181 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQG----LVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            F+L  LSK ILPPLG  Q  ++ S       V+SP+DSRYRCWET+MV+LVAYSAWV PF
Sbjct  23   FNLRNLSKLILPPLGGLQAGYSQSPAGSYKRVVSPLDSRYRCWETFMVVLVAYSAWVYPF  82

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  RK+I  RYLST+F
Sbjct  83   EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRKRITFRYLSTFF  142

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            ++DVASTIPF+ +A+L TG+   GV YSVLG+ R WRLR+V  FFTRL +DIRFSYFWVR
Sbjct  143  ILDVASTIPFQGLAYLATGEVKEGVAYSVLGIFRLWRLRKVKQFFTRLEKDIRFSYFWVR  202

Query  882  C  884
            C
Sbjct  203  C  203



>emb|CDX82921.1| BnaC01g13710D [Brassica napus]
Length=862

 Score =   234 bits (598),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 139/189 (74%), Gaps = 7/189 (4%)
 Frame = +3

Query  339  QEDEDF-----SLGKLSKFILPPLG--SSQPTHTSSQGLVISPMDSRYRCWETWMVLLVA  497
            + DE++     SL  LSK ILPPLG  S       S G VISPMDSRYR WE++MVLLVA
Sbjct  98   ERDEEYGASSLSLNNLSKLILPPLGVASYNQNQIISSGWVISPMDSRYRWWESFMVLLVA  157

Query  498  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  677
            YSAWV PFE++FL S     L + DNIVD+FFAVDIVLTFFVAYID  TQLL+   K+IA
Sbjct  158  YSAWVYPFEVAFLNSSPKRNLCIADNIVDMFFAVDIVLTFFVAYIDRRTQLLVREPKQIA  217

Query  678  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDI  857
             RYLSTWFLMDVASTIPF+ + +L TG   L +  ++LG+LRFWRLRRV + FTRL +DI
Sbjct  218  IRYLSTWFLMDVASTIPFDAIGYLVTGTGKLNLTCNILGLLRFWRLRRVKHLFTRLEKDI  277

Query  858  RFSYFWVRC  884
            RFSY  +RC
Sbjct  278  RFSYLCIRC  286



>ref|XP_006654434.1| PREDICTED: potassium channel AKT2-like [Oryza brachyantha]
Length=847

 Score =   233 bits (593),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 137/182 (75%), Gaps = 5/182 (3%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQG-----LVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            F+L  LSK ILPPLG     H    G      VISP+DSRYRCW+T+MV+LVAYSAWV P
Sbjct  21   FNLRNLSKLILPPLGVPAGGHAQHHGGSNDKRVISPLDSRYRCWDTFMVVLVAYSAWVYP  80

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE++F+ +     L V D +VDLFFAVDIVLTFFVAYID TTQLL+  R++I  RYLST+
Sbjct  81   FEVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSTTQLLVRDRRRITMRYLSTF  140

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
            F+MDVASTIPFE +A+L TG+      +S+LG+LR WRLR+V  FFTRL +DIRF+YFW+
Sbjct  141  FIMDVASTIPFEGLAYLVTGEVRESPVFSLLGILRLWRLRKVKQFFTRLEKDIRFNYFWI  200

Query  879  RC  884
            RC
Sbjct  201  RC  202



>ref|XP_002441141.1| hypothetical protein SORBIDRAFT_09g021160 [Sorghum bicolor]
 gb|EES19571.1| hypothetical protein SORBIDRAFT_09g021160 [Sorghum bicolor]
Length=838

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGS---SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            F+L  LSK ILPPLG       +H  S   VISP+DSRYR W+T MV+LVAYSAWV PFE
Sbjct  24   FNLRNLSKVILPPLGGPSGQSQSHGGSDKWVISPLDSRYRWWDTLMVVLVAYSAWVYPFE  83

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  R+KI  RYLST+F+
Sbjct  84   VAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDHRTQLLVRDRRKITLRYLSTFFI  143

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRL +DIRFSYFW+RC
Sbjct  144  MDVASTIPFQGLAYLVTGEVRENAAYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIRC  203



>ref|XP_008456068.1| PREDICTED: potassium channel AKT2/3 [Cucumis melo]
Length=634

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 140/178 (79%), Gaps = 3/178 (2%)
 Frame = +3

Query  360  LGKLSKFILPPLGSSQPTHTS---SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            L +LSK ILPPLG S  T  S   S   +ISPM SRYR W+++MV+LVAYS WV P E++
Sbjct  47   LRELSKVILPPLGVSSFTDGSKVKSNRWIISPMSSRYRWWQSFMVVLVAYSVWVYPLEVA  106

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            FL++    KL +VD+IVD+FFA+DIV TFFVAYID  TQLL+   KKIA RYLSTWFLMD
Sbjct  107  FLDAIPRRKLLIVDSIVDIFFAIDIVFTFFVAYIDHRTQLLVRDSKKIAIRYLSTWFLMD  166

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +ASTIPF+ +A+L TGK+ L + +++LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  167  LASTIPFDTLAYLSTGKYDLCLPFALLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  224



>sp|Q75HP9.1|AKT2_ORYSJ RecName: Full=Potassium channel AKT2 [Oryza sativa Japonica Group]
 gb|AAS90668.1| putative potassium channel protein [Oryza sativa Japonica Group]
 gb|EEE63802.1| hypothetical protein OsJ_18626 [Oryza sativa Japonica Group]
 gb|AFC96958.1| AKT2/3-like potassium channel [Oryza sativa Japonica Group]
Length=855

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 137/182 (75%), Gaps = 6/182 (3%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSSQPTHTSSQGL------VISPMDSRYRCWETWMVLLVAYSAWVCP  518
            +L  LSK ILPPLG     H  S         VISP+DSRYRCW+T+MV+LVAYSAWV P
Sbjct  31   NLRNLSKLILPPLGVPAGGHAQSGHAGPNDRRVISPLDSRYRCWDTFMVVLVAYSAWVYP  90

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  R++IATRYLST+
Sbjct  91   FEVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRRIATRYLSTF  150

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
            F+MDVASTIPF+ +A++ TG+      +S+LG+LR WRLR+V  FFTRL +DIRF+YFW+
Sbjct  151  FIMDVASTIPFQGLAYIVTGEVRESPAFSLLGILRLWRLRKVKQFFTRLEKDIRFNYFWI  210

Query  879  RC  884
            RC
Sbjct  211  RC  212



>gb|EAY98139.1| hypothetical protein OsI_20054 [Oryza sativa Indica Group]
Length=855

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 137/182 (75%), Gaps = 6/182 (3%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSSQPTHTSSQGL------VISPMDSRYRCWETWMVLLVAYSAWVCP  518
            +L  LSK ILPPLG     H  S         VISP+DSRYRCW+T+MV+LVAYSAWV P
Sbjct  31   NLRNLSKLILPPLGVPAGGHAQSGHAGPNDRRVISPLDSRYRCWDTFMVVLVAYSAWVYP  90

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  R++IATRYLST+
Sbjct  91   FEVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRRIATRYLSTF  150

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
            F+MDVASTIPF+ +A++ TG+      +S+LG+LR WRLR+V  FFTRL +DIRF+YFW+
Sbjct  151  FIMDVASTIPFQGLAYIVTGEVRESPAFSLLGILRLWRLRKVKQFFTRLEKDIRFNYFWI  210

Query  879  RC  884
            RC
Sbjct  211  RC  212



>ref|NP_001147796.1| potassium channel AKT2/3 [Zea mays]
 gb|ACG28726.1| potassium channel AKT2/3 [Zea mays]
 gb|AFW78085.1| potassium channel AKT2/3 [Zea mays]
Length=838

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 134/180 (74%), Gaps = 3/180 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGS---SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            F++  LSK ILPPLG       +H  S   VISP+DSRYR W+T MV+LVAYSAWV PFE
Sbjct  23   FNVRNLSKVILPPLGGPSGQSQSHGGSDKWVISPLDSRYRWWDTLMVVLVAYSAWVYPFE  82

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLL+  RKKI  RYLST+F+
Sbjct  83   VAFMNASPKGGLEVADMVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKITLRYLSTFFI  142

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV   FTRL +DIRFSYFW+R 
Sbjct  143  MDVASTIPFQSLAYLITGEVRENAAYSMLGVLRLWRLRRVKQLFTRLEKDIRFSYFWIRS  202



>ref|XP_008655420.1| PREDICTED: potassium channel protein ZMK2 isoform X1 [Zea mays]
Length=847

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGL----VISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            F+L  LSK ILPPLG      + S G     V+SP+DSRYR W+T+MV+LVAYSAWV PF
Sbjct  28   FNLRNLSKVILPPLGGPSGGQSQSHGGSDKWVVSPLDSRYRWWDTFMVVLVAYSAWVYPF  87

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  RKKI  RYLST+F
Sbjct  88   EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDGRTQLLVRDRKKITLRYLSTFF  147

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRL +DIRFSYFW+R
Sbjct  148  IMDVASTIPFQGLAYLITGEVRENAVYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIR  207



>ref|NP_001105120.1| potassium channel protein ZMK2 [Zea mays]
 emb|CAB54856.1| potassium channel protein ZMK2 [Zea mays]
Length=849

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGL----VISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            F+L  LSK ILPPLG      + S G     V+SP+DSRYR W+T+MV+LVAYSAWV PF
Sbjct  30   FNLRNLSKVILPPLGGPSGGQSQSHGGSDKWVVSPLDSRYRWWDTFMVVLVAYSAWVYPF  89

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+ +     L V D +VDLFFAVDIVLTFFVAYID  TQLL+  RKKI  RYLST+F
Sbjct  90   EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDGRTQLLVRDRKKITLRYLSTFF  149

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVASTIPF+ +A+L TG+      YS+LG+LR WRLRRV  FFTRL +DIRFSYFW+R
Sbjct  150  IMDVASTIPFQGLAYLITGEVRENAVYSMLGVLRLWRLRRVKQFFTRLEKDIRFSYFWIR  209



>ref|XP_006385212.1| potassium channel family protein [Populus trichocarpa]
 gb|ERP63009.1| potassium channel family protein [Populus trichocarpa]
Length=848

 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = +3

Query  339  QEDED---FSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYS  503
            +E+ED    SL  LSK ILPPLG S        S+G +ISP+DSRYRCW T M +LVAYS
Sbjct  33   EEEEDDSPLSLSSLSKIILPPLGVSSFNQNPIESKGWIISPVDSRYRCWGTIMAVLVAYS  92

Query  504  AWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATR  683
             WV PFE++FL S     LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+  R+KIA R
Sbjct  93   LWVYPFEVAFLNSSPYRALYIADNVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRKIARR  152

Query  684  YLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRF  863
            YLSTWFLMDVAST+PFE +A+LFTG   +G+ YS+LG+LRFWRLRRV   FTRL +DIRF
Sbjct  153  YLSTWFLMDVASTVPFELLAYLFTGNEKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRF  212

Query  864  SYFWVRC  884
            SYFWVRC
Sbjct  213  SYFWVRC  219



>emb|CBI23771.3| unnamed protein product [Vitis vinifera]
Length=805

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 152/207 (73%), Gaps = 6/207 (3%)
 Frame = +3

Query  282  APNSMMNKDTAAsssssssQEDED----FSLGKLSKFILPPLGSSQPTHT--SSQGLVIS  443
            A N +  +D +  S     ++  D    F+   LSK ILPPLG S       + +G +IS
Sbjct  13   ASNMIKREDHSRKSLKKPEEKQHDDSKPFNSRNLSKVILPPLGVSSYNQNPLAPKGWIIS  72

Query  444  PMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFV  623
            PMDSRYRCWET+MV+LVAYS W+ PF+++FL++  + +LY+ DN+VDLFFAVDIVLTFFV
Sbjct  73   PMDSRYRCWETFMVVLVAYSLWIYPFQVAFLKASPNRQLYITDNVVDLFFAVDIVLTFFV  132

Query  624  AYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLR  803
            AYID  TQLL+   +KIA RYLSTWFLMD+AST+PFE +  L TGK  +G+ YS+LG+LR
Sbjct  133  AYIDRRTQLLVCDWRKIAVRYLSTWFLMDMASTMPFEALGSLITGKQKVGLSYSLLGLLR  192

Query  804  FWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FWRLRRV   FTRL +DIRFSYFWVRC
Sbjct  193  FWRLRRVKQLFTRLEKDIRFSYFWVRC  219



>ref|XP_004146262.1| PREDICTED: potassium channel AKT2/3 [Cucumis sativus]
 gb|KGN57590.1| hypothetical protein Csa_3G221730 [Cucumis sativus]
Length=636

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +3

Query  360  LGKLSKFILPPLGSSQPTHTS----SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
            L +LSK ILPPLG S  T  S    S   +ISPM SRYR W+++MV+LV+YS WV P E+
Sbjct  48   LRELSKVILPPLGVSSFTDGSNRVKSNRWIISPMSSRYRWWQSFMVVLVSYSVWVYPLEV  107

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL++    KL +VD +VDLFFA+DIV TFFV+YID  TQLL+   KKIA RYLSTWFLM
Sbjct  108  AFLDAIPRRKLLIVDTVVDLFFAIDIVFTFFVSYIDHRTQLLVRDSKKIAIRYLSTWFLM  167

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            D+ASTIPF+ +A+L TGK+ L + +++LG+LRFWRLRRV  FFTRL +DIRFSYFWVRC
Sbjct  168  DLASTIPFDTLAYLSTGKYDLCLPFALLGLLRFWRLRRVKQFFTRLEKDIRFSYFWVRC  226



>ref|XP_002268924.1| PREDICTED: potassium channel AKT2/3 [Vitis vinifera]
Length=841

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 152/207 (73%), Gaps = 6/207 (3%)
 Frame = +3

Query  282  APNSMMNKDTAAsssssssQEDED----FSLGKLSKFILPPLGSSQPTHT--SSQGLVIS  443
            A N +  +D +  S     ++  D    F+   LSK ILPPLG S       + +G +IS
Sbjct  15   ASNMIKREDHSRKSLKKPEEKQHDDSKPFNSRNLSKVILPPLGVSSYNQNPLAPKGWIIS  74

Query  444  PMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFV  623
            PMDSRYRCWET+MV+LVAYS W+ PF+++FL++  + +LY+ DN+VDLFFAVDIVLTFFV
Sbjct  75   PMDSRYRCWETFMVVLVAYSLWIYPFQVAFLKASPNRQLYITDNVVDLFFAVDIVLTFFV  134

Query  624  AYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLR  803
            AYID  TQLL+   +KIA RYLSTWFLMD+AST+PFE +  L TGK  +G+ YS+LG+LR
Sbjct  135  AYIDRRTQLLVCDWRKIAVRYLSTWFLMDMASTMPFEALGSLITGKQKVGLSYSLLGLLR  194

Query  804  FWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FWRLRRV   FTRL +DIRFSYFWVRC
Sbjct  195  FWRLRRVKQLFTRLEKDIRFSYFWVRC  221



>ref|NP_001291251.1| potassium channel AKT2/3 [Populus euphratica]
 gb|ACB56631.1| K+ channel protein [Populus euphratica]
Length=831

 Score =   226 bits (575),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = +3

Query  375  KFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            K ILPPLG S        S+G +ISP+DSRYRCW T M +LVAYS WV PFE++FL S  
Sbjct  34   KIILPPLGVSSFNQNPIESKGWIISPVDSRYRCWGTIMAVLVAYSLWVYPFEVAFLNSSP  93

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+  R+KIA RYLSTWFLMDVAST+P
Sbjct  94   YRALYIADNVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRKIARRYLSTWFLMDVASTVP  153

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FE +A+L TG   +G+ YS+LG+LRFWRLRRV   FTRL +DIRFSYFWVRC
Sbjct  154  FELLAYLITGNEKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWVRC  205



>emb|CAC05489.1| potassium channel 2 [Populus tremula x Populus tremuloides]
Length=830

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 4/186 (2%)
 Frame = +3

Query  339  QEDEDFSLGKLS--KFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  506
            QE++D  L   S  K ILPPLG S        S+G +ISP+ SRYRCW T M +LVAYS 
Sbjct  18   QEEDDSPLSLSSLSKIILPPLGVSSFNQNPIESKGWIISPVGSRYRCWGTIMAVLVAYSL  77

Query  507  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  686
            WV PFE++FL S     LY+ DN+VDLFFAVDIVLTFFVAYID  TQLL+  R+KIA RY
Sbjct  78   WVYPFEVAFLNSSPYRALYIADNVVDLFFAVDIVLTFFVAYIDSRTQLLVRDRRKIARRY  137

Query  687  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFS  866
            LSTWFLMDVAST+PFE +A+LFTG   +G+ YS+LG+LRFWRLRRV   FTRL +DIRFS
Sbjct  138  LSTWFLMDVASTVPFELLAYLFTGNEKVGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFS  197

Query  867  YFWVRC  884
            YFWVRC
Sbjct  198  YFWVRC  203



>ref|XP_010910948.1| PREDICTED: potassium channel AKT2-like isoform X1 [Elaeis guineensis]
Length=836

 Score =   223 bits (569),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            +  F+L  LSK +LPPLG+     T   S G ++SPMDSRYRCWE +MV+LVAYSAWV P
Sbjct  37   EASFNLRNLSKVVLPPLGAPGYNQTQAESGGRIVSPMDSRYRCWEAFMVILVAYSAWVYP  96

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE++F+ S     L + D+I+D+FFA+DIVLTFF+AYID  TQLL+   K+IA RYLSTW
Sbjct  97   FEVAFMNSSPKGVLCITDSIIDIFFAIDIVLTFFLAYIDSKTQLLVRDPKRIAIRYLSTW  156

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
            F+MDVASTIPFE + +L TG+   GV YS+LGMLR WRLR+V  FFTRL +DIRFSYFW+
Sbjct  157  FIMDVASTIPFEGLGYLITGEIKEGVSYSLLGMLRLWRLRKVKQFFTRLEKDIRFSYFWI  216

Query  879  RC  884
            RC
Sbjct  217  RC  218



>gb|KJB79211.1| hypothetical protein B456_013G038200 [Gossypium raimondii]
 gb|KJB79212.1| hypothetical protein B456_013G038200 [Gossypium raimondii]
Length=605

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  387  PPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFL-ESKLDTK  557
            PPLG+S    +H  S+G +ISPMDSRYR WET+MV+LV YSAWV P E++F   S   T 
Sbjct  63   PPLGASTYNHSHIKSKGWIISPMDSRYRWWETFMVMLVFYSAWVYPLEVAFFTSSSPPTN  122

Query  558  LYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEF  737
            LY+ DN+VD FF VDIVLTFF+AYID TT LL+   KKIA RYLSTWFLMDVASTIPF+ 
Sbjct  123  LYIADNVVDFFFGVDIVLTFFLAYIDSTTHLLVRDPKKIALRYLSTWFLMDVASTIPFDA  182

Query  738  VAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +A+LFTGK  +G+ YS+LG+LRFWRLRRV   FTRL +DIRFSYFW+RC
Sbjct  183  LAYLFTGKSKMGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  231



>ref|XP_004299918.1| PREDICTED: potassium channel AKT2/3 [Fragaria vesca subsp. vesca]
Length=843

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 138/184 (75%), Gaps = 10/184 (5%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            ++ +L  LSK ILPPLG+S    T   S+G +ISPMDSRYR WE +MVLLVAYSAWV PF
Sbjct  43   DELNLRNLSKLILPPLGASSYNQTQMQSKGYIISPMDSRYRSWEVFMVLLVAYSAWVYPF  102

Query  522  EISFLESKLDTK---LYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLS  692
            E++FL S   T    LY+ D IVDLFF +DIVLTFFVAYIDP TQLL+    KIA RYLS
Sbjct  103  EVAFLNSTTGTSINPLYLADYIVDLFFGIDIVLTFFVAYIDPRTQLLVLDSNKIAIRYLS  162

Query  693  TWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYF  872
            TWF MD+AST+PFE +     G+H LG+ YS+LG+LRFWRLRR    FTRL +DIRFSYF
Sbjct  163  TWFFMDLASTLPFEVI-----GRHKLGLSYSLLGLLRFWRLRRAKKLFTRLEKDIRFSYF  217

Query  873  WVRC  884
            WVRC
Sbjct  218  WVRC  221



>ref|XP_009403703.1| PREDICTED: potassium channel AKT2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score =   218 bits (554),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 128/172 (74%), Gaps = 2/172 (1%)
 Frame = +3

Query  375  KFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            K +LPPLG S  +     S+  +  PMDSRYRCWE +MV LVAYSAWV PFEI+F+ +  
Sbjct  42   KLVLPPLGMSSCSQNPNGSRWRIFLPMDSRYRCWEAFMVALVAYSAWVYPFEIAFMHAAP  101

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L++ DN++D FFA DIVLTFFVAYID  TQ+L+   +KIATRYLSTWF+MD+ ST+P
Sbjct  102  KGGLFLTDNVIDAFFAADIVLTFFVAYIDSRTQVLVCDPRKIATRYLSTWFIMDLTSTLP  161

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FE + +L TG+   GV YS+LG LR WRLR+V  FFTRL +DIRFSYF +RC
Sbjct  162  FEGLGYLITGRVKAGVSYSLLGTLRLWRLRKVKRFFTRLEKDIRFSYFCIRC  213



>gb|KJB79210.1| hypothetical protein B456_013G038200 [Gossypium raimondii]
Length=847

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  387  PPLGSS--QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFL-ESKLDTK  557
            PPLG+S    +H  S+G +ISPMDSRYR WET+MV+LV YSAWV P E++F   S   T 
Sbjct  63   PPLGASTYNHSHIKSKGWIISPMDSRYRWWETFMVMLVFYSAWVYPLEVAFFTSSSPPTN  122

Query  558  LYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEF  737
            LY+ DN+VD FF VDIVLTFF+AYID TT LL+   KKIA RYLSTWFLMDVASTIPF+ 
Sbjct  123  LYIADNVVDFFFGVDIVLTFFLAYIDSTTHLLVRDPKKIALRYLSTWFLMDVASTIPFDA  182

Query  738  VAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +A+LFTGK  +G+ YS+LG+LRFWRLRRV   FTRL +DIRFSYFW+RC
Sbjct  183  LAYLFTGKSKMGLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRC  231



>gb|EMS50502.1| Potassium channel AKT2/3 [Triticum urartu]
Length=770

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            F+L  LSK +LPPLGSS    TS S   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  34   FNLRNLSKLMLPPLGSSLTQSTSDSDKRVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  93

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F+E++    L V D +VD+FFAVDIVLTFFVAYID  TQLL+  R++I  RYLST+F+MD
Sbjct  94   FMEARPKGGLEVADMVVDIFFAVDIVLTFFVAYIDSRTQLLVRDRRRITFRYLSTFFIMD  153

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRL +DIRFSYFWVRC
Sbjct  154  VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRC  211



>dbj|BAJ96949.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            F+L  LSK +LPPLG S    TS +   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  27   FNLRNLSKLMLPPLGHSLSQSTSGTDERVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  86

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F+E+     L V D +VD+FFAVDI LTFFVAYID  TQLL+  RK+I  RYLST+F+MD
Sbjct  87   FMEASPKGGLEVADMVVDIFFAVDIALTFFVAYIDSRTQLLVRDRKRITFRYLSTFFIMD  146

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRL +DIRFSYFWVRC
Sbjct  147  VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRC  204



>gb|ABE99811.1| inwardly rectifying potassium channel AKT2 [Hordeum vulgare]
 dbj|BAJ86010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            F+L  LSK +LPPLG S    TS +   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  27   FNLRNLSKLMLPPLGHSLSQSTSGTDERVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  86

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F+E+     L V D +VD+FFAVDI LTFFVAYID  TQLL+  RK+I  RYLST+F+MD
Sbjct  87   FMEASPKGGLEVADMVVDIFFAVDIALTFFVAYIDSRTQLLVRDRKRITFRYLSTFFIMD  146

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRL +DIRFSYFWVRC
Sbjct  147  VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRC  204



>dbj|BAJ86681.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=859

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 138/178 (78%), Gaps = 1/178 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTS-SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            F+L  LSK +LPPLG S    TS +   V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  27   FNLRNLSKLMLPPLGHSLSQSTSGTDERVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  86

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F+E+     L V D +VD+FFAVDI LTFFVAYID  TQLL+  RK+I  RYLST+F+M 
Sbjct  87   FMEASPKGGLEVADMVVDIFFAVDIALTFFVAYIDSRTQLLVRDRKRITFRYLSTFFIMG  146

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRL +DIRFSYFWVRC
Sbjct  147  VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRC  204



>gb|EMT08371.1| hypothetical protein F775_52637 [Aegilops tauschii]
Length=887

 Score =   206 bits (524),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 1/178 (1%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSS-QGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            F+L  LSK +LPPLGSS    TS     V+SP+DSRYRCWET+MV+LVAYSAWV PFE++
Sbjct  117  FNLRNLSKLMLPPLGSSLSQSTSDSDKRVVSPLDSRYRCWETFMVILVAYSAWVYPFEVA  176

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F+E++    L V D +VD+FFAVDIVLTFFVAYID  TQLL+  R++I  RYLST+F+MD
Sbjct  177  FMEARPKGGLEVADMVVDIFFAVDIVLTFFVAYIDSRTQLLVRDRRRITFRYLSTFFIMD  236

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP++ +A+L  G+   G+ YS+LG+LR WRLR+V  FFTRL +DIRFSYFWVRC
Sbjct  237  VASTIPYQGIAYLVNGEVREGMVYSLLGLLRLWRLRKVKQFFTRLEKDIRFSYFWVRC  294



>ref|XP_009403698.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403699.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403700.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403701.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403702.1| PREDICTED: potassium channel AKT2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   203 bits (517),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 128/199 (64%), Gaps = 29/199 (15%)
 Frame = +3

Query  375  KFILPPLGSSQPTHT--SSQGLVISPMDSRYR---------------------------C  467
            K +LPPLG S  +     S+  +  PMDSRYR                           C
Sbjct  42   KLVLPPLGMSSCSQNPNGSRWRIFLPMDSRYRLELRAELHGDEFSLSLANESSKMLSCRC  101

Query  468  WETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQ  647
            WE +MV LVAYSAWV PFEI+F+ +     L++ DN++D FFA DIVLTFFVAYID  TQ
Sbjct  102  WEAFMVALVAYSAWVYPFEIAFMHAAPKGGLFLTDNVIDAFFAADIVLTFFVAYIDSRTQ  161

Query  648  LLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVS  827
            +L+   +KIATRYLSTWF+MD+ ST+PFE + +L TG+   GV YS+LG LR WRLR+V 
Sbjct  162  VLVCDPRKIATRYLSTWFIMDLTSTLPFEGLGYLITGRVKAGVSYSLLGTLRLWRLRKVK  221

Query  828  NFFTRLXEDIRFSYFWVRC  884
             FFTRL +DIRFSYF +RC
Sbjct  222  RFFTRLEKDIRFSYFCIRC  240



>emb|CBI30869.3| unnamed protein product [Vitis vinifera]
Length=665

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 125/180 (69%), Gaps = 3/180 (2%)
 Frame = +3

Query  348  EDFSLGKL-SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            E  SLG + S  +LP LG+     T  Q  +ISP   RYR WE  +++LV YSAW+CPFE
Sbjct  35   ERTSLGSVFSSHLLPSLGARINQATKLQKHIISPFSPRYRAWEMLLIILVIYSAWICPFE  94

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
              FL  K D  L++ DNIV+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY+STWF+
Sbjct  95   FGFLPYKQDA-LFIFDNIVNGFFAIDIVLTFFVAYLDTETYLLVDDAKKIAIRYISTWFI  153

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             DV ST PFE  + LFT KH+ G+ Y  L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  154  FDVCSTAPFEAFSLLFT-KHNSGLGYKALNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  212



>ref|NP_001268073.1| inward rectifying shaker-like K+ channel [Vitis vinifera]
 gb|AAL09479.1|AF359521_1 inward rectifying shaker-like K+ channel [Vitis vinifera]
Length=791

 Score =   201 bits (512),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 125/180 (69%), Gaps = 3/180 (2%)
 Frame = +3

Query  348  EDFSLGKL-SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            E  SLG + S  +LP LG+     T  Q  +ISP   RYR WE  +++LV YSAW+CPFE
Sbjct  21   ERTSLGSVFSSHLLPSLGARINQATKLQKHIISPFSPRYRAWEMLLIILVIYSAWICPFE  80

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
              FL  K D  L++ DNIV+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY+STWF+
Sbjct  81   FGFLPYKQDA-LFIFDNIVNGFFAIDIVLTFFVAYLDTETYLLVDDAKKIAIRYISTWFI  139

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             DV ST PFE  + LFT KH+ G+ Y  L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  140  FDVCSTAPFEAFSLLFT-KHNSGLGYKALNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_002441145.1| hypothetical protein SORBIDRAFT_09g021210 [Sorghum bicolor]
 gb|EES19575.1| hypothetical protein SORBIDRAFT_09g021210 [Sorghum bicolor]
Length=837

 Score =   202 bits (513),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 134/180 (74%), Gaps = 3/180 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGS---SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
             SL  LSK ILPPLG       +H  S   VISP+DSRYR W+T MV+LVAYSAWV  FE
Sbjct  30   LSLRYLSKIILPPLGGPPGQSQSHGGSDKWVISPLDSRYRWWDTLMVVLVAYSAWVYLFE  89

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP TQLLI  RKKI  RYLST+F+
Sbjct  90   VAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRTQLLIRDRKKITFRYLSTFFI  149

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            MDVAST+PF+ +A+  TG+      YSVLG+LR WRLRRV+ FFTRL +DIRFSYFW+RC
Sbjct  150  MDVASTVPFQALAYFITGEVRENGAYSVLGLLRLWRLRRVNQFFTRLEKDIRFSYFWIRC  209



>ref|NP_001046422.2| Os02g0245800 [Oryza sativa Japonica Group]
 dbj|BAF08336.2| Os02g0245800, partial [Oryza sativa Japonica Group]
Length=539

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       Q  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L +KL
Sbjct  30   LLPSLGATINHSNKLQKFIISPYDPRYRSWELFLIVLVVYSAWICPFELAFLRD-LPSKL  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +V+NIVD+FFA+DIVLTFFVAY+D  T LL+  RK+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   LLVENIVDIFFAIDIVLTFFVAYVDSKTHLLVDDRKRIAMRYLSTWFIFDVCSTAPFQPI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
              LFT K +  + + VL +LR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  149  ILLFTHKGN-DIAFKVLNLLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>gb|ABR17684.1| unknown [Picea sitchensis]
Length=659

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LPPLGS   + T  +  +ISP D RYRCWET++++LV YSAWVCPFE+ F ++     L
Sbjct  62   MLPPLGSRWSSDTQLEKNIISPHDPRYRCWETFLIVLVGYSAWVCPFELGFSDAP-KGGL  120

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +VD IVD FFA+D++LTFFVAY D  TQ+LI   +KIA RY+S  F++DV STIPFE +
Sbjct  121  LIVDTIVDAFFAIDVILTFFVAYCDDKTQILIDKPRKIALRYISRGFVLDVTSTIPFETL  180

Query  741  AFLFTGKH-HLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +L  GKH    + YS+L +L  WRLRRV   FTRL +DIRFSYFW+RC
Sbjct  181  IYLIRGKHAGFNIYYSLLNVLHLWRLRRVKTLFTRLEKDIRFSYFWIRC  229



>emb|CAK50799.1| inwardly rectifying potassium channel subunit [Daucus carota]
Length=766

 Score =   200 bits (508),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG++    T  Q  +ISP + RYR WE ++V+LV YSAWVCPF+ +FL  K D
Sbjct  30   SNGLLPSLGANINQGTKLQKNIISPFNPRYRAWEMFLVILVIYSAWVCPFQFAFLTYKQD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L++ DNIV+ FFA+DI+LTFFVAY+D  + LL+  RKKIA RY+STWF+ DV ST P 
Sbjct  90   A-LFIFDNIVNGFFAIDIILTFFVAYVDSQSYLLVDSRKKIAVRYISTWFIFDVCSTAPL  148

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ L T +H  GV + VL MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  149  QPISLLLT-EHSSGVGFKVLNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>gb|EEC72823.1| hypothetical protein OsI_06546 [Oryza sativa Indica Group]
Length=718

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       Q  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L +KL
Sbjct  30   LLPSLGATINHSNKLQKFIISPYDPRYRSWELFLIVLVVYSAWICPFELAFLRD-LPSKL  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +V+NIVD+FFA+DIVLTFFVAY+D  T LL+  RK+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   LLVENIVDIFFAIDIVLTFFVAYVDSKTHLLVDDRKRIAMRYLSTWFIFDVCSTAPFQPI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
              LFT K +  + + VL +LR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  149  ILLFTHKGN-DIAFKVLNLLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>gb|AAL24466.1|AF359522_1 inward rectifying potassium channel [Vitis vinifera]
Length=791

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 3/180 (2%)
 Frame = +3

Query  348  EDFSLGKL-SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            E  SLG + S  +LP LG      T  Q  +ISP   RYR WE  +++LV YSAW+CPFE
Sbjct  21   ERTSLGSVFSSHLLPSLGGRINQATKLQKHIISPFSPRYRAWEMLLIILVIYSAWICPFE  80

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
              FL  K D  L++ DNIV+ FFA+DIVLTFFVAY+D  T LL+   KKIA RY+STWF+
Sbjct  81   FGFLPYKQDA-LFIFDNIVNGFFAIDIVLTFFVAYLDTETYLLVDDAKKIAIRYISTWFI  139

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             DV ST PFE  + LFT  H+ G+ Y  L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  140  FDVCSTAPFERFSLLFT-NHNSGLGYKALNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>sp|Q6K3T2.1|KAT1_ORYSJ RecName: Full=Potassium channel KAT1 [Oryza sativa Japonica Group]
 dbj|BAD19939.1| putative inward rectifying shaker K+ channel; ZmK2.1 [Oryza sativa 
Japonica Group]
 dbj|BAD27742.1| putative inward rectifying shaker K+ channel; ZmK2.1 [Oryza sativa 
Japonica Group]
Length=718

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       Q  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L +KL
Sbjct  30   LLPSLGATINHSNKLQKFIISPYDPRYRSWELFLIVLVVYSAWICPFELAFLRD-LPSKL  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +V+NIVD+FFA+DIVLTFFVAY+D  T LL+  RK+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   LLVENIVDIFFAIDIVLTFFVAYVDSKTHLLVDDRKRIAMRYLSTWFIFDVCSTAPFQPI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
              LFT K +  + + VL +LR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  149  ILLFTHKGN-DIAFKVLNLLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>ref|XP_006647116.1| PREDICTED: potassium channel KAT1-like [Oryza brachyantha]
Length=720

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 122/168 (73%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       Q  +ISP D RYR WE ++++LV YSAW+CPFEI+FL   L +KL
Sbjct  30   LLPSLGATINHSNKLQKFIISPYDPRYRSWELFLIVLVVYSAWICPFEIAFLRD-LPSKL  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +V+NIVD+FFA+DIVLTFFVAY+D  T L +  RKKIA RYLSTWF+ DV ST PF+ +
Sbjct  89   LLVENIVDIFFAIDIVLTFFVAYVDSKTHLFVDDRKKIAVRYLSTWFIFDVCSTAPFQSI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
              LFT K +  + + +L +LR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  149  ILLFTHKGN-DLTFKILNLLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>ref|XP_002519693.1| Potassium channel KAT2, putative [Ricinus communis]
 gb|EEF42666.1| Potassium channel KAT2, putative [Ricinus communis]
Length=813

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP  SRYR WE W+V+LV YSAW+ PFE +FL  + D
Sbjct  30   SSDLLPSLGARINQATKLRRYIISPYSSRYRAWEMWLVVLVVYSAWISPFEFAFLTYRKD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L+++DNIV+ FFA+DIVLTFFVAY+D  T LL+ + KKIA RY+STWF+ DV ST PF
Sbjct  90   DALFIIDNIVNSFFAIDIVLTFFVAYLDSHTYLLVDNPKKIAIRYISTWFMFDVCSTAPF  149

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LFT +    + +S+L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  150  QSLSLLFTHQSSSEIGFSLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  200



>ref|XP_007133476.1| hypothetical protein PHAVU_011G1818001g, partial [Phaseolus vulgaris]
 gb|ESW05470.1| hypothetical protein PHAVU_011G1818001g, partial [Phaseolus vulgaris]
Length=309

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +   +SP D RYR WE  +++LV YSAW+CPFE +FL  K 
Sbjct  29   LSNDLLPSLGARINQETRLRRCTVSPFDPRYRAWEMLLIVLVVYSAWICPFEFAFLPEKQ  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
             T L+++DNIV+ FFA+DIVLTFFVAY+D  + LL+   KKIA RY+STWF+ D+ ST P
Sbjct  89   GT-LFIIDNIVNAFFAIDIVLTFFVAYLDNHSYLLVDEPKKIALRYISTWFVFDICSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LFT  H   + + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSISLLFT-DHSSEIGFKILNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_006585489.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Glycine max]
Length=808

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 120/177 (68%), Gaps = 26/177 (15%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            F+L  +SK ILPPLG S     +S+G +ISPMDSRYRCWE++MVLLVAYSAWV PFE++F
Sbjct  45   FNLRNISKLILPPLGVSSQNPVNSKGWIISPMDSRYRCWESFMVLLVAYSAWVYPFEVAF  104

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            +    + ++Y+VD +VDLFF +DIVLTFFVAYID TT LL+  +KKI  R          
Sbjct  105  MHKSSNKEIYIVDTVVDLFFGIDIVLTFFVAYIDRTTHLLVRDKKKIVVR----------  154

Query  714  ASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
                              +G+ Y +LG+LRFWR+RRV  +FTRL +DIRFSYFWVRC
Sbjct  155  ----------------QKVGLPYFLLGLLRFWRIRRVKQYFTRLEKDIRFSYFWVRC  195



>ref|XP_010056887.1| PREDICTED: potassium channel KAT3 [Eucalyptus grandis]
 gb|KCW73796.1| hypothetical protein EUGRSUZ_E02396 [Eucalyptus grandis]
Length=725

 Score =   197 bits (501),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  S  +LP LG+     T  +  +ISP   RYR WE W+++LV YSAW+CPFE +FL  
Sbjct  27   GFFSSDLLPSLGARINQTTRLRKYIISPYTPRYRAWEMWLIVLVLYSAWICPFEFAFLTY  86

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
            K+D  L+++D+IV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF+ DV ST
Sbjct  87   KIDA-LFIIDHIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKIALRYLSTWFIFDVCST  145

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT KH  G+ +  L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  146  APFQLISLLFT-KHSSGLGFKALNMLRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>ref|XP_002453600.1| hypothetical protein SORBIDRAFT_04g008780 [Sorghum bicolor]
 gb|EES06576.1| hypothetical protein SORBIDRAFT_04g008780 [Sorghum bicolor]
Length=729

 Score =   197 bits (500),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 125/174 (72%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       Q  +ISP D RYR WE ++++LV YSAW+CPFE++FL  
Sbjct  24   GSFTIELLPSLGATINQSNKLQKFIISPYDPRYRYWELFLIVLVIYSAWICPFELAFLRD  83

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL +V+NIV+ FFA+DIVLTFFVAY+D  T LL+  RK+IA RYLSTWF+ DV ST
Sbjct  84   -LSSKLLLVENIVNSFFAIDIVLTFFVAYVDSKTHLLVDDRKRIAVRYLSTWFIFDVCST  142

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K +  + + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  143  APFQPISLLFTHKGN-DLAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>ref|XP_008783944.1| PREDICTED: potassium channel KAT3 isoform X2 [Phoenix dactylifera]
Length=793

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L TKL
Sbjct  31   LLPSLGATINQSVKLRKFIISPYDPRYRVWEMFLIILVIYSAWICPFELAFLRY-LPTKL  89

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++ +NIV+ FFAVDIVLTFFVAY+D  + LLI   K+IATRYLSTWF+ DV ST PF+ +
Sbjct  90   FLAENIVNSFFAVDIVLTFFVAYLDRKSYLLIDDPKRIATRYLSTWFIFDVCSTAPFQPL  149

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT  H  G+ + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  150  SLLFTS-HGNGLVFKILNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  196



>ref|XP_008783946.1| PREDICTED: potassium channel KAT3 isoform X4 [Phoenix dactylifera]
Length=767

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L TKL
Sbjct  31   LLPSLGATINQSVKLRKFIISPYDPRYRVWEMFLIILVIYSAWICPFELAFLRY-LPTKL  89

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++ +NIV+ FFAVDIVLTFFVAY+D  + LLI   K+IATRYLSTWF+ DV ST PF+ +
Sbjct  90   FLAENIVNSFFAVDIVLTFFVAYLDRKSYLLIDDPKRIATRYLSTWFIFDVCSTAPFQPL  149

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT  H  G+ + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  150  SLLFTS-HGNGLVFKILNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  196



>ref|NP_001284388.1| potassium channel KAT3-like [Cucumis melo]
 gb|AAZ66349.2| inward rectifying potassium channel [Cucumis melo]
Length=701

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+S    T  +  +ISP + RYR WE W+V+LV YSAW+CPFE +FL  K 
Sbjct  35   LSPELLPSLGASINQTTHLRKHIISPFNPRYRAWEMWLVVLVIYSAWICPFEFAFLPYKQ  94

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            +  L+++D+ V+ FFA+DI+LTFFVAY+D  + LL+ H KKIA RYLSTWF+ DV ST P
Sbjct  95   NA-LFIIDHFVNAFFAIDIILTFFVAYLDSQSYLLVDHPKKIALRYLSTWFIFDVCSTAP  153

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             + ++FLFT +    V + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  154  LQSISFLFTNQTG-EVGFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  204



>ref|XP_003530386.1| PREDICTED: potassium channel KAT1-like [Glycine max]
 gb|KHN38162.1| Potassium channel KAT1 [Glycine soja]
Length=728

 Score =   195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 128/185 (69%), Gaps = 8/185 (4%)
 Frame = +3

Query  348  EDFSLGKL------SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAW  509
            ++F +G L      S  +LP LG+     T  +  +ISP + RYR WE  +++LV YSAW
Sbjct  16   DEFQMGSLPYSSFLSNDLLPSLGARINQETRLRRYIISPFNPRYRAWEMILIVLVVYSAW  75

Query  510  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  689
            +CPFE +FL  K DT L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RY+
Sbjct  76   ICPFEFAFLPYKQDT-LFIIDNIVNAFFAIDIMLTFFVAYLDNHSYLLVDDPKKIAIRYI  134

Query  690  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSY  869
            STWF+ DV ST PF+ ++ LFT  H   + + VL MLR WRLRRVS+ F RL +DIRF+Y
Sbjct  135  STWFIFDVCSTAPFQSISLLFTN-HRSEIGFKVLNMLRLWRLRRVSSLFARLEKDIRFNY  193

Query  870  FWVRC  884
            FW RC
Sbjct  194  FWTRC  198



>ref|XP_010915561.1| PREDICTED: potassium channel KAT3-like [Elaeis guineensis]
Length=778

 Score =   195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG++       +  +ISP D+RYR WE +++LLV YSAWVCPFE++FL   L 
Sbjct  28   SSDLLPSLGATINQSAKLRKFIISPYDTRYRAWEMFLILLVIYSAWVCPFELAFLRY-LP  86

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
            TKL++ +NIV+ FFAVDIVLTFFVAY+D  + LLI   K+IATRYLST F+ DV ST PF
Sbjct  87   TKLFLAENIVNSFFAVDIVLTFFVAYLDRKSYLLIDDPKRIATRYLSTGFIFDVCSTAPF  146

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++FLF   H  G+ + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  147  QPLSFLFMS-HGNGLLFKILNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  196



>gb|AFW65934.1| potassium channel3 [Zea mays]
Length=369

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       +  +ISP D  YR WE ++++LV YSAW+CPFE++FL  
Sbjct  56   GSFTIELLPSLGATINQSNKLRKFIISPYDPCYRYWELFLIVLVIYSAWICPFELAFLRD  115

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL + +NIV+ FFAVDIVLTFFVAY+D  T LL+  +K+IA RYLSTWF+ DV ST
Sbjct  116  -LPSKLLLAENIVNGFFAVDIVLTFFVAYVDSKTHLLVDDQKRIAVRYLSTWFIFDVCST  174

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K + G+ + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  175  APFQPISLLFTRKGN-GLAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  227



>ref|XP_010693510.1| PREDICTED: potassium channel KAT3-like [Beta vulgaris subsp. 
vulgaris]
Length=681

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 122/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  ILP LG+        +  VISP D RYR WE  +V+LV YSAW+ PFE +FLE K D
Sbjct  32   SNDILPSLGARINQAIKLKKHVISPFDPRYRAWEILLVILVIYSAWISPFEFAFLEYKQD  91

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              ++++D+I++ FFAVDIVLTFFVAYID  + LLI   KKIATRYLSTWF++DV ST P 
Sbjct  92   A-VFIIDHIINGFFAVDIVLTFFVAYIDTHSCLLIDDHKKIATRYLSTWFILDVCSTAPL  150

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LFT  H+ G+ +  L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  151  QTLSLLFT-HHNGGLGFKALNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  200



>ref|XP_012072096.1| PREDICTED: potassium channel KAT1 [Jatropha curcas]
 gb|KDP37966.1| hypothetical protein JCGZ_04609 [Jatropha curcas]
Length=787

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP +S YR WE W+VLLV YSAW+ PFE++FL  K D
Sbjct  30   SSDLLPSLGARINRATKLRRYIISPYNSHYRAWEMWLVLLVIYSAWISPFELAFLTYKKD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L+++DNIV+ FF +DIVLTFFVAY+D  + LL+ + KKIA RY+STWF+ DV+ST PF
Sbjct  90   DALFIIDNIVNGFFGIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYISTWFIFDVSSTAPF  149

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF  +    V + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  150  QSLSLLFKTQSGNEVGFRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  200



>ref|XP_009403704.1| PREDICTED: potassium channel AKT2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=780

 Score =   194 bits (494),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 115/154 (75%), Gaps = 2/154 (1%)
 Frame = +3

Query  423  SQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVD  602
            + GL I  +  R  CWE +MV LVAYSAWV PFEI+F+ +     L++ DN++D FFA D
Sbjct  6    AHGLEIQMLSCR--CWEAFMVALVAYSAWVYPFEIAFMHAAPKGGLFLTDNVIDAFFAAD  63

Query  603  IVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCY  782
            IVLTFFVAYID  TQ+L+   +KIATRYLSTWF+MD+ ST+PFE + +L TG+   GV Y
Sbjct  64   IVLTFFVAYIDSRTQVLVCDPRKIATRYLSTWFIMDLTSTLPFEGLGYLITGRVKAGVSY  123

Query  783  SVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            S+LG LR WRLR+V  FFTRL +DIRFSYF +RC
Sbjct  124  SLLGTLRLWRLRKVKRFFTRLEKDIRFSYFCIRC  157



>ref|XP_004233118.1| PREDICTED: potassium channel KAT1-like [Solanum lycopersicum]
Length=688

 Score =   194 bits (492),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  S  +LP LG+     T  +  +ISP + RYRCWE ++V++V Y+AW+  FE++FL  
Sbjct  28   GFFSSDLLPSLGARINYATKLRRFIISPYNPRYRCWEMFLVVMVIYTAWISLFEVAFLSY  87

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
            K D  L++VDNIVD FFA+DI+LTFFVAY+ P + LL+   KKIA RYLSTWF+ DV ST
Sbjct  88   KKDDTLFIVDNIVDCFFAIDILLTFFVAYLHPESYLLVDEPKKIAIRYLSTWFIFDVCST  147

Query  723  IPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +PF+ +  +FT  K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  148  VPFQSLILVFTDHKESGGVGFRLLSMLRLWRLRRVSALFARLEKDIRFNYFWTRC  202



>ref|NP_001275475.1| uncharacterized protein LOC102583546 [Solanum tuberosum]
 emb|CAA56175.1| K+ channel inward rectifying [Solanum tuberosum]
Length=688

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  S  +LP LG+     T  +  +ISP + RYRCWE ++V++V Y+AW+  FE++FL  
Sbjct  28   GFFSSDLLPSLGARINYATKLRRFIISPFNPRYRCWEMFLVVMVIYTAWISLFEVAFLSY  87

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
            K D  L++VDNIVD FFA+DI+LTFFVAY+   + LL+   KKIA RYLSTWF+ DV ST
Sbjct  88   KKDDTLFIVDNIVDCFFAIDILLTFFVAYLHRESYLLVDEPKKIAIRYLSTWFIFDVCST  147

Query  723  IPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +PF+ +  +FTG K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  148  VPFQSLILVFTGHKESGGVGFRLLSMLRLWRLRRVSALFARLEKDIRFNYFWTRC  202



>ref|XP_002441143.1| hypothetical protein SORBIDRAFT_09g021190 [Sorghum bicolor]
 gb|EES19573.1| hypothetical protein SORBIDRAFT_09g021190 [Sorghum bicolor]
Length=845

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 133/180 (74%), Gaps = 4/180 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGS----SQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            F+L  LSK ILPPLG       P +  S   VISP+DSRYR W+T MV++VAYSAWV  F
Sbjct  28   FNLRNLSKVILPPLGGPSAGQSPNNGGSDKWVISPLDSRYRWWDTLMVVMVAYSAWVYLF  87

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E++F+ +     L V D +VDLFFAVDIVLTFFVAYIDP +QLL+  RKKI  RYLST+F
Sbjct  88   EVAFMNASPKGGLEVADIVVDLFFAVDIVLTFFVAYIDPRSQLLVCDRKKITFRYLSTFF  147

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            +MDVAS+IPF+  A+  TG+      YSVLG+LR WRLRRV+ FFTRL +DIRFSYFW+R
Sbjct  148  IMDVASSIPFQAFAYFITGEVREDAVYSVLGLLRLWRLRRVNQFFTRLEKDIRFSYFWIR  207



>ref|XP_008348557.1| PREDICTED: potassium channel KAT1-like isoform X2 [Malus domestica]
Length=425

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR WE  +VLLV YSAW+CPFE +FL  K D  L
Sbjct  33   LLPSLGARINQSTKLRKYIISPYNPRYRTWEMVLVLLVIYSAWICPFEFAFLPYKQDA-L  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FF +DI+LTFFVAY+D  + LL+ + K+IA RYLSTWFL DV ST PF+ +
Sbjct  92   FIVDNIVNGFFGIDIILTFFVAYLDSRSYLLVDNPKQIAMRYLSTWFLFDVCSTAPFQSI  151

Query  741  AFLFTGK-HHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT +   LG  + VL MLR WRLRRVS  F RL +DIRF+YFW+RC
Sbjct  152  SLLFTNRGSELG--FKVLNMLRLWRLRRVSYLFARLEKDIRFNYFWIRC  198



>ref|XP_008645574.1| PREDICTED: potassium channel KAT1-like [Zea mays]
 gb|AFW71117.1| hypothetical protein ZEAMMB73_020763 [Zea mays]
Length=729

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       Q  +ISP D RYR WE ++ +LV YSAW+CPFE++FL  
Sbjct  24   GSFTIELLPSLGATINQSNKLQRFIISPYDPRYRYWELFLTVLVIYSAWICPFELAFLRD  83

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL +V+NIV+  FA+DIVLTFFVAY+D  T LL+  RK+IA RYLSTWF+ DV ST
Sbjct  84   -LSSKLLLVENIVNSVFAIDIVLTFFVAYVDSKTHLLVDDRKRIAVRYLSTWFIFDVCST  142

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K +  + + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  143  APFQSISLLFTHKGN-DLAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>ref|XP_009602723.1| PREDICTED: potassium channel KAT3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=678

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 125/183 (68%), Gaps = 1/183 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            Q + + S G  S  +LP LG+     T  +  +ISP + RYRCWE ++V+LV YSAW+ P
Sbjct  19   QMNTETSNGFFSSDLLPSLGARINYATKLRKFIISPFNPRYRCWEMFLVVLVIYSAWISP  78

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL  K D  L+++D+IV+ FFA+DI LTFFVAY+   + LL+   KKIA RYLS+W
Sbjct  79   FEFAFLSYKEDDALFIIDHIVNCFFAIDIFLTFFVAYLHRESYLLVDEPKKIAIRYLSSW  138

Query  699  FLMDVASTIPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFW  875
            F+ DV ST+PF+ +  LFT  K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW
Sbjct  139  FIFDVCSTVPFQSLILLFTDHKESGGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFW  198

Query  876  VRC  884
             RC
Sbjct  199  TRC  201



>ref|XP_009602722.1| PREDICTED: potassium channel KAT3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=681

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 125/183 (68%), Gaps = 1/183 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            Q + + S G  S  +LP LG+     T  +  +ISP + RYRCWE ++V+LV YSAW+ P
Sbjct  19   QMNTETSNGFFSSDLLPSLGARINYATKLRKFIISPFNPRYRCWEMFLVVLVIYSAWISP  78

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL  K D  L+++D+IV+ FFA+DI LTFFVAY+   + LL+   KKIA RYLS+W
Sbjct  79   FEFAFLSYKEDDALFIIDHIVNCFFAIDIFLTFFVAYLHRESYLLVDEPKKIAIRYLSSW  138

Query  699  FLMDVASTIPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFW  875
            F+ DV ST+PF+ +  LFT  K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW
Sbjct  139  FIFDVCSTVPFQSLILLFTDHKESGGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFW  198

Query  876  VRC  884
             RC
Sbjct  199  TRC  201



>ref|XP_010665823.1| PREDICTED: potassium channel KAT3-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=743

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            +S  ILP LG+        +  +ISP D RYR WE  +VLLV YSAW+CPFE +FL  + 
Sbjct  30   ISNDILPSLGARMNQAIKLKKHIISPFDPRYRAWEMLLVLLVIYSAWICPFEFAFLTFER  89

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+ +D+IV++FFA+DIVLTFFVAY+D  + LLI   KKIA RYLSTWF+ DV ST P
Sbjct  90   DA-LFFIDHIVNVFFAMDIVLTFFVAYLDTRSYLLIDDHKKIAIRYLSTWFIFDVCSTAP  148

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             + ++ +FT +H+ G+ ++ L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  149  LQTISLIFT-EHNGGLGFAALNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  199



>gb|AAX19659.1| inward rectifying potassium channel [Brassica rapa subsp. pekinensis]
Length=685

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++VDNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIVDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>emb|CDX99479.1| BnaC01g10730D [Brassica napus]
Length=685

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++VDNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIVDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|KGN65561.1| hypothetical protein Csa_1G448920 [Cucumis sativus]
Length=598

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG++    T  +  +ISP   RYR WE W+V+LV YSAW+CPFE +FL  K 
Sbjct  34   LSPELLPSLGATINQTTHLRKHIISPFSPRYRAWEMWLVVLVIYSAWICPFEFAFLPYKQ  93

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            +  L+++D  V+ FFA+DI+LTFFVAY+D  + LL+ H KKIA RYLSTWF+ DV ST P
Sbjct  94   NA-LFLIDQFVNAFFAIDIILTFFVAYLDSQSYLLVDHPKKIALRYLSTWFIFDVCSTAP  152

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             + ++FLFT +    V + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  153  LQSISFLFTNETG-EVGFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  203



>ref|XP_008348556.1| PREDICTED: potassium channel KAT1-like isoform X1 [Malus domestica]
Length=478

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR WE  +VLLV YSAW+CPFE +FL  K D  L
Sbjct  33   LLPSLGARINQSTKLRKYIISPYNPRYRTWEMVLVLLVIYSAWICPFEFAFLPYKQDA-L  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FF +DI+LTFFVAY+D  + LL+ + K+IA RYLSTWFL DV ST PF+ +
Sbjct  92   FIVDNIVNGFFGIDIILTFFVAYLDSRSYLLVDNPKQIAMRYLSTWFLFDVCSTAPFQSI  151

Query  741  AFLFTGK-HHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT +   LG  + VL MLR WRLRRVS  F RL +DIRF+YFW+RC
Sbjct  152  SLLFTNRGSELG--FKVLNMLRLWRLRRVSYLFARLEKDIRFNYFWIRC  198



>emb|CDX78839.1| BnaA01g09060D [Brassica napus]
Length=684

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++VDNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIVDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_009131562.1| PREDICTED: potassium channel KAT2-like [Brassica rapa]
Length=687

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++VDNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIVDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_010110981.1| Potassium channel KAT2 [Morus notabilis]
 gb|EXC29367.1| Potassium channel KAT2 [Morus notabilis]
Length=794

 Score =   192 bits (488),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 129/185 (70%), Gaps = 8/185 (4%)
 Frame = +3

Query  348  EDFSLGKL------SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAW  509
            E+F +G L      S  +LP LG+     T  +  +ISP ++RYR WE ++VLLV YSAW
Sbjct  16   EEFGMGSLAHSSFLSSDLLPSLGARINQTTKLRKYIISPFNARYRAWEMFLVLLVIYSAW  75

Query  510  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  689
            +CPFE +FL  K D  L+++DNIV+ FFA+DI LTFFVAY+D  + LL+   K+IA RY+
Sbjct  76   ICPFEFAFLPYKQDA-LFIIDNIVNGFFAIDIFLTFFVAYLDSHSYLLVDDPKRIAIRYI  134

Query  690  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSY  869
            STWF+ DV ST PF+ ++ LFT  H   + + +L MLR WRLRRVS+ F+RL +D+RF+Y
Sbjct  135  STWFIFDVCSTAPFQSISLLFT-NHSGELGFKLLNMLRLWRLRRVSSLFSRLEKDLRFNY  193

Query  870  FWVRC  884
            FW RC
Sbjct  194  FWTRC  198



>ref|XP_011657374.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel KAT2 [Cucumis 
sativus]
Length=662

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG++    T  +  +ISP   RYR WE W+V+LV YSAW+CPFE +FL  K 
Sbjct  34   LSPELLPSLGATINQTTHLRKHIISPFSPRYRAWEMWLVVLVIYSAWICPFEFAFLPYKQ  93

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            +  L+++D  V+ FFA+DI+LTFFVAY+D  + LL+ H KKIA RYLSTWF+ DV ST P
Sbjct  94   NA-LFLIDQFVNAFFAIDIILTFFVAYLDSQSYLLVDHPKKIALRYLSTWFIFDVCSTAP  152

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             + ++FLFT +    V + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  153  LQSISFLFTNETG-EVGFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  203



>ref|NP_001291250.1| uncharacterized protein LOC105118640 [Populus euphratica]
 gb|ABY86891.1| K+ channel protein [Populus euphratica]
Length=746

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP +S YR WE W+V+LV YSAW+ PFE +FL SK D
Sbjct  30   SSDLLPSLGAQINRATKLRRYIISPYNSYYRAWEMWLVVLVVYSAWISPFEFAFLTSKKD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L++ DN+V+ FFAVDIVLTFFVAY+D  + LLI   KKIA RY+STWF+ DV ST PF
Sbjct  90   A-LFIFDNVVNGFFAVDIVLTFFVAYLDSHSYLLIDDPKKIAIRYISTWFIFDVCSTAPF  148

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF   H  G+ +++L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  149  QSLSLLFR-NHGNGLGFNILSMLRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>ref|XP_004951327.1| PREDICTED: potassium channel KAT1-like [Setaria italica]
Length=761

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       Q  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L  KL
Sbjct  60   LLPSLGATINHSNKLQKFIISPYDPRYRYWELFLIVLVIYSAWICPFELAFLRD-LPPKL  118

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
              V+NIV+ FFAVDIVLTFFVAY+D  T LL+  RK+IA RYLSTWF+ DV ST PF+ +
Sbjct  119  LHVENIVNSFFAVDIVLTFFVAYVDSKTHLLVDDRKRIAVRYLSTWFIFDVCSTAPFQPI  178

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LF  K +  + + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  179  SLLFRHKGN-ALAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  225



>ref|XP_011096553.1| PREDICTED: potassium channel KAT3-like [Sesamum indicum]
Length=752

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  S  ++P LG+     T  +  +ISP D RYR WE +++LLV YSAW+ PFE +FL  
Sbjct  27   GFFSSDLIPSLGARINRATKLRKYIISPFDPRYRAWEMFLILLVIYSAWISPFEFAFLPY  86

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
            K D  L+++DNIV+ FFAVDIVLTFFVAY+D  + LLI   +KIA RYLSTWFL DV ST
Sbjct  87   KQDA-LFIIDNIVNCFFAVDIVLTFFVAYLDSQSYLLIDDPRKIAIRYLSTWFLFDVCST  145

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +PF+ +  LFT  H+  + + +L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  146  VPFQALCILFT-DHNGELGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>ref|XP_006449685.1| hypothetical protein CICLE_v10014336mg [Citrus clementina]
 gb|ESR62925.1| hypothetical protein CICLE_v10014336mg [Citrus clementina]
Length=784

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V+LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARINQATKLRRYIISPFNPRYRAWEMWLVVLVVYSAWICPFEFAFLTYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L ++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RY+STWF+ DV ST P
Sbjct  89   DA-LLIIDNIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKIAIRYMSTWFIFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F+A L T      + + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  LQFLALLLTNNSS-ELTFRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|EYU43265.1| hypothetical protein MIMGU_mgv1a002597mg [Erythranthe guttata]
Length=656

 Score =   191 bits (484),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G LS  +LPPLG+     T  +  ++SP++  YR WE +++LLV YSAW+ PF+ +FL  
Sbjct  26   GFLSNDLLPPLGTRMNRATKLRRQIVSPLNPCYRAWEIFLLLLVIYSAWISPFQFAFLTY  85

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
            K D+ L++ DNI++ FFA DI LTFFVAY+DP + LLI   KKIA RYLSTWF  DV ST
Sbjct  86   KQDS-LFIADNIINSFFAADIFLTFFVAYVDPRSYLLIDDPKKIAIRYLSTWFAFDVCST  144

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            IPF+ ++ +FT  H+ G+ +++L MLR WRLRRVS+ F RL +DIRF+YFW R
Sbjct  145  IPFQSLSIIFT-DHNGGLGFNLLSMLRLWRLRRVSSLFARLEKDIRFNYFWTR  196



>ref|XP_010234093.1| PREDICTED: potassium channel KAT1-like [Brachypodium distachyon]
Length=456

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       Q  +ISP D  Y+ WE ++++LV YSAW+CPFE++FL   L +KL
Sbjct  30   LLPSLGATINHCNKLQKFIISPYDRLYKSWELFLIVLVIYSAWICPFELAFLRD-LPSKL  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +++NIV+ FFA+DIVLTFFVAY+D  T LL+ +RK+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   LLLENIVNSFFAIDIVLTFFVAYVDSKTHLLVDNRKRIAVRYLSTWFIFDVCSTAPFQPI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
              LFT K +  + + +L MLR WRL RVS  F R+ +DIRF+YFW RC
Sbjct  149  ILLFTHKGN-DLAFKMLNMLRLWRLHRVSTLFARMEKDIRFNYFWTRC  195



>ref|XP_006414124.1| hypothetical protein EUTSA_v10024618mg [Eutrema salsugineum]
 gb|ESQ55577.1| hypothetical protein EUTSA_v10024618mg [Eutrema salsugineum]
Length=665

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 123/172 (72%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            L+  +LP LG+     T  +  ++SP D R+R WE W+V+LV YSAW+CPFE++F+  K 
Sbjct  29   LTADLLPSLGARINQSTKLRKHIVSPFDPRFRAWEMWLVILVIYSAWICPFEVAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++VDNIV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIVDNIVNGFFAIDIILTFFVAYLDRHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_002870057.1| hypothetical protein ARALYDRAFT_329707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46316.1| hypothetical protein ARALYDRAFT_329707 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|AFW65933.1| potassium channel3 [Zea mays]
Length=757

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       +  +ISP D  YR WE ++++LV YSAW+CPFE++FL  
Sbjct  56   GSFTIELLPSLGATINQSNKLRKFIISPYDPCYRYWELFLIVLVIYSAWICPFELAFLRD  115

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL + +NIV+ FFAVDIVLTFFVAY+D  T LL+  +K+IA RYLSTWF+ DV ST
Sbjct  116  -LPSKLLLAENIVNGFFAVDIVLTFFVAYVDSKTHLLVDDQKRIAVRYLSTWFIFDVCST  174

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K + G+ + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  175  APFQPISLLFTRKGN-GLAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  227



>ref|XP_006283236.1| hypothetical protein CARUB_v10004269mg [Capsella rubella]
 gb|EOA16134.1| hypothetical protein CARUB_v10004269mg [Capsella rubella]
Length=694

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_006845349.1| PREDICTED: potassium channel KAT3 [Amborella trichopoda]
 gb|ERN07024.1| hypothetical protein AMTR_s00141p00107890 [Amborella trichopoda]
Length=760

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+        +  +ISP + RYR WE +++ LV YSAW+CPFE +FL  K 
Sbjct  27   LSTELLPSLGARINQRIKLRKPIISPFNPRYRAWEIFLIFLVIYSAWICPFEFAFLRYKQ  86

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++VDNIV+ FF +DIVLTFFVAY D  + LLI + KKIATRY+STWF+ DV ST+P
Sbjct  87   DA-LFIVDNIVNGFFTIDIVLTFFVAYFDHRSYLLIDNPKKIATRYISTWFIFDVCSTVP  145

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+  + LFT     G+ + VL MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  146  FQPFSLLFTDDDP-GIGFKVLNMLRLWRLRRVSALFARLEKDIRFNYFWTRC  196



>ref|XP_010517557.1| PREDICTED: potassium channel KAT2-like [Camelina sativa]
 ref|XP_010517558.1| PREDICTED: potassium channel KAT2-like [Camelina sativa]
Length=687

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|NP_001105240.1| potassium channel3 [Zea mays]
 gb|AAR21352.1| inward rectifying shaker K+ channel [Zea mays]
 gb|AAR21353.1| inward rectifying shaker K+ channel [Zea mays]
Length=725

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 124/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       +  +ISP D  YR WE ++++LV YSAW+CPFE++FL  
Sbjct  24   GSFTIELLPSLGATINQSNKLRKFIISPYDPCYRYWELFLIVLVIYSAWICPFELAFLRD  83

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL + +NIV+ FFAVDIVLTFFVAY+D  T LL+  +K+IA RYLSTWF+ DV ST
Sbjct  84   -LPSKLLLAENIVNGFFAVDIVLTFFVAYVDSKTHLLVDDQKRIAVRYLSTWFVFDVCST  142

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K + G+ + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  143  APFQPISLLFTRKGN-GLAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  195



>ref|NP_001289500.1| potassium channel KAT3-like [Nicotiana sylvestris]
 gb|AGU99205.1| potassium channel NKT6 [Nicotiana sylvestris]
Length=681

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 124/183 (68%), Gaps = 1/183 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            Q + + S G  S  +LP LG+     T  +  ++SP + RYRCWE ++V+LV YSAW+ P
Sbjct  19   QMNTETSNGFFSNDLLPSLGARINYATKLRKFIVSPFNPRYRCWEMFLVVLVIYSAWISP  78

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL    D  L+++D+IV+ FFA+DI LTFFVAY+   + LL+   KKIA RYLS+W
Sbjct  79   FEFAFLSYNEDDALFIIDHIVNCFFAIDIFLTFFVAYLHRESYLLVDEPKKIAIRYLSSW  138

Query  699  FLMDVASTIPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFW  875
            F+ DV ST+PF+ +  LFT  K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW
Sbjct  139  FIFDVCSTVPFQSLILLFTDHKESGGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFW  198

Query  876  VRC  884
             RC
Sbjct  199  TRC  201



>gb|KDO78166.1| hypothetical protein CISIN_1g003951mg [Citrus sinensis]
Length=784

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V+LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARINQATKLRRYIISPFNPRYRAWEMWLVVLVVYSAWICPFEFAFLTYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L ++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RY+STWF+ DV ST P
Sbjct  89   DA-LLIIDNIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKIAIRYMSTWFIFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F+A L T      + + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  LQFLALLLTNNIS-ELTFRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_006281669.1| hypothetical protein CARUB_v10027805mg [Capsella rubella]
 gb|EOA14567.1| hypothetical protein CARUB_v10027805mg [Capsella rubella]
Length=666

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+VLLV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWELWLVLLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_006467473.1| PREDICTED: potassium channel KAT2-like [Citrus sinensis]
Length=784

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V+LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARINQATKLRRYIISPFNPRYRAWEMWLVVLVVYSAWICPFEFAFLTYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L ++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RY+STWF+ DV ST P
Sbjct  89   DA-LLIIDNIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKIAIRYMSTWFIFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F+A L T      + + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  LQFLALLLTNNIS-ELTFRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_008381130.1| PREDICTED: potassium channel KAT1-like [Malus domestica]
Length=761

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR WE  +VLLV YSAW+CPFE +FL  K D  L
Sbjct  33   LLPSLGARINQSTKLRKYIISPYNPRYRTWEMVLVLLVIYSAWICPFEFAFLPYKQDA-L  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FF +DI+LTFFVAY+D  + LL+ + K+IA RYLSTWFL DV ST PF+ +
Sbjct  92   FIVDNIVNGFFGIDIILTFFVAYLDSRSYLLVDNPKQIAMRYLSTWFLFDVCSTAPFQSI  151

Query  741  AFLFTGK-HHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT +   LG  + VL MLR WRLRRVS  F RL +DIRF+YFW+RC
Sbjct  152  SLLFTNRGSELG--FKVLNMLRLWRLRRVSYLFARLEKDIRFNYFWIRC  198



>ref|XP_009101530.1| PREDICTED: potassium channel KAT1-like [Brassica rapa]
Length=688

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP +S+YR WE W+VLLV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINHSTKLRKHIISPFNSKYRSWEMWLVLLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DIVLTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDDPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_010538533.1| PREDICTED: potassium channel KAT1 [Tarenaya hassleriana]
Length=795

 Score =   190 bits (483),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP D RYR WE W+V+LV YSAW+CPF+ +F+  K D
Sbjct  30   SADLLPSLGARINQSTKLRKHIISPFDPRYRAWEMWLVVLVIYSAWICPFDFAFITYKKD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST PF
Sbjct  90   A-LFIIDNIVNGFFAIDIILTFFVAYLDSDSYLLVDNPKKIAIRYLSTWFAFDVCSTAPF  148

Query  732  EFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF      LG  + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  149  QSLSLLFNYNGSELG--FRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>emb|CAC28122.1| inward rectifying K+ channel [Arabidopsis thaliana]
Length=708

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  40   LSADLLPSLGARINQSTKLRKHIISPFDPRFRGWEMWLVILVIYSAWICPFEFAFITYKK  99

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  100  DA-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAP  158

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  159  FQSLSLLFK-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  209



>ref|XP_011085251.1| PREDICTED: potassium channel KAT1-like [Sesamum indicum]
Length=760

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  S  +LP LG+     T  +  ++SP D  YR WE +++LLV YSAW+ PFE +FL  
Sbjct  27   GFFSSDLLPSLGARINQATKLRRHIVSPFDPHYRAWEMFLILLVIYSAWISPFEFAFLNY  86

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
            K D  L++ DNIV+ FFAVDIVLTFFVAY+D  + LLI + K+IA RY+STWF  DV ST
Sbjct  87   KQDV-LFIFDNIVNSFFAVDIVLTFFVAYLDSQSYLLIDNPKRIAIRYVSTWFTFDVCST  145

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +PF+ ++ LFT  H  G+ + +L MLR WRLRRVS+ FTRL +DIRF+YFW RC
Sbjct  146  LPFQSLSLLFT-DHTGGLGFKLLSMLRLWRLRRVSSLFTRLEKDIRFNYFWTRC  198



>ref|NP_193563.3| potassium channel KAT2 [Arabidopsis thaliana]
 sp|Q38849.3|KAT2_ARATH RecName: Full=Potassium channel KAT2 [Arabidopsis thaliana]
 emb|CAA16801.1| potassium channel protein KAT2 [Arabidopsis thaliana]
 emb|CAB78831.1| potassium channel protein KAT2 [Arabidopsis thaliana]
 gb|AEE84021.1| potassium channel KAT2 [Arabidopsis thaliana]
Length=697

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRGWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFK-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>emb|CAA63601.1| K+ channel [Arabidopsis thaliana]
Length=677

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+VLLV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVLLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|NP_199436.1| potassium channel KAT1 [Arabidopsis thaliana]
 sp|Q39128.2|KAT1_ARATH RecName: Full=Potassium channel KAT1 [Arabidopsis thaliana]
 gb|AAA32824.1| potassium channel protein [Arabidopsis thaliana]
 gb|AAC49113.1| potassium channel protein [Arabidopsis thaliana]
 dbj|BAB11079.1| potassium channel protein KAT1 [Arabidopsis thaliana]
 dbj|BAD44268.1| potassium channel protein KAT1 [Arabidopsis thaliana]
 dbj|BAD95094.1| potassium channel protein KAT1 [Arabidopsis thaliana]
 gb|ACI49797.1| At5g46240 [Arabidopsis thaliana]
 gb|AED95356.1| potassium channel KAT1 [Arabidopsis thaliana]
Length=677

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+VLLV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVLLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_008349191.1| PREDICTED: potassium channel KAT1-like, partial [Malus domestica]
Length=568

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR W   +VLLV YSAW+CPFE +FL  K D  L
Sbjct  33   LLPSLGARINQSTKLRKYIISPYNPRYRAWGMLLVLLVIYSAWICPFEFAFLPYKRDA-L  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            +V+DNIV+ FF +DI+LTFFVAY+D  + LL+ + K+IA RYLSTWFL DV ST PF+ +
Sbjct  92   FVIDNIVNGFFGIDIILTFFVAYLDSRSYLLVDNPKQIAMRYLSTWFLFDVCSTAPFQSI  151

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + L T  H   + + VL MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  152  SLLLT-NHGSELEFKVLNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>gb|KFK31483.1| hypothetical protein AALP_AA6G118100 [Arabis alpina]
Length=644

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP   RYR WE W+V LV YSAW+CPFE +F+  + 
Sbjct  29   LSSDLLPSLGARINQSTKLRKHIISPFSPRYRAWEMWLVFLVIYSAWICPFEFAFITYEK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++V+DNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFVIDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_009804745.1| PREDICTED: potassium channel KAT3-like isoform X1 [Nicotiana 
sylvestris]
Length=685

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 124/183 (68%), Gaps = 1/183 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            Q + + S G  S  +LP LG+     T  +  ++SP + RYRCWE ++V+LV YSAW+ P
Sbjct  19   QMNTETSNGFFSNDLLPSLGARINYATKLRKFIVSPFNPRYRCWEMFLVVLVIYSAWISP  78

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL    +  L+++D+IV+ FFA+DI LTFFVAY+   + LL+   KKIA RYLS+W
Sbjct  79   FEFAFLSYNEEDALFIIDHIVNCFFAIDIFLTFFVAYLHRESYLLVDEPKKIAIRYLSSW  138

Query  699  FLMDVASTIPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFW  875
            F+ DV ST+PF+ +  LFT  K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW
Sbjct  139  FIFDVCSTVPFQSLILLFTDHKESGGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFW  198

Query  876  VRC  884
             RC
Sbjct  199  TRC  201



>ref|XP_009804747.1| PREDICTED: potassium channel KAT3-like isoform X2 [Nicotiana 
sylvestris]
Length=682

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 124/183 (68%), Gaps = 1/183 (1%)
 Frame = +3

Query  339  QEDEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            Q + + S G  S  +LP LG+     T  +  ++SP + RYRCWE ++V+LV YSAW+ P
Sbjct  19   QMNTETSNGFFSNDLLPSLGARINYATKLRKFIVSPFNPRYRCWEMFLVVLVIYSAWISP  78

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE +FL    +  L+++D+IV+ FFA+DI LTFFVAY+   + LL+   KKIA RYLS+W
Sbjct  79   FEFAFLSYNEEDALFIIDHIVNCFFAIDIFLTFFVAYLHRESYLLVDEPKKIAIRYLSSW  138

Query  699  FLMDVASTIPFEFVAFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFW  875
            F+ DV ST+PF+ +  LFT  K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW
Sbjct  139  FIFDVCSTVPFQSLILLFTDHKESGGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFW  198

Query  876  VRC  884
             RC
Sbjct  199  TRC  201



>ref|XP_010481478.1| PREDICTED: potassium channel KAT1-like [Camelina sativa]
Length=678

 Score =   188 bits (478),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V LV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVFLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_010441608.1| PREDICTED: potassium channel KAT1-like [Camelina sativa]
Length=676

 Score =   188 bits (478),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V LV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVFLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>emb|CDX76529.1| BnaA08g08710D [Brassica napus]
Length=712

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+S    T  +  ++SP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  10   LSADLLPSLGASTNQSTKLRKHIVSPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYK-  68

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L++VDNIV+ FFA+DI+LTFFVA +D  + +L+ + KKIA RYLSTWF+ DV ST P
Sbjct  69   KHALFIVDNIVNGFFAIDIILTFFVANVDSHSYILVDNPKKIAMRYLSTWFVFDVCSTAP  128

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF  K    + ++VL MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  129  FKSLSLLFNYKGS-QIGFTVLSMLRLWRLRRVSLLFARLEKDIRFNYFWTRC  179



>emb|CAD18901.1| inwardly rectifying potassium channel [Zea mays]
Length=757

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 2/174 (1%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       +  +ISP D  YR WE ++++LV YSAW CPFE++FL  
Sbjct  56   GSFTIELLPSLGATINQSNKLRKFIISPYDPCYRYWELFLIVLVIYSAWFCPFELAFLRD  115

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL + +NIV+ FFAVDIVLTFFVAY+D  T LL+  +K+IA RYLSTWF+ DV ST
Sbjct  116  -LPSKLLLAENIVNGFFAVDIVLTFFVAYVDTKTHLLVDDQKRIAVRYLSTWFIFDVCST  174

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K + G+ + +L MLR WRL RVS+ F RL +DIRF+YFW RC
Sbjct  175  APFQPISLLFTRKGN-GLAFKILNMLRLWRLHRVSSLFARLEKDIRFNYFWTRC  227



>ref|XP_010919840.1| PREDICTED: potassium channel KAT3-like [Elaeis guineensis]
Length=780

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG++       +   +SP +  YR WE +++LLV YSAW+CPFE +FL   L 
Sbjct  28   SSDLLPSLGATINQSMKLRKYTVSPYNPHYRVWEIFLILLVVYSAWICPFEFAFLRY-LP  86

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L++VDNIV++FFA+DIVLTFFVA+++  T LL+   K+IA RYLSTWF+ DV ST+PF
Sbjct  87   GTLFLVDNIVNIFFAIDIVLTFFVAFLERKTYLLVDDHKRIALRYLSTWFIFDVCSTVPF  146

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF  KH  G+ + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  147  QPISLLFN-KHGSGLAFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  196



>ref|XP_010496011.1| PREDICTED: potassium channel KAT1 [Camelina sativa]
Length=678

 Score =   188 bits (478),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V LV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVFLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_010439874.1| PREDICTED: potassium channel KAT2-like [Camelina sativa]
Length=693

 Score =   188 bits (478),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+ +DNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFFIDNIVNGFFAIDIILTFFVAYLDSHSYLLVDKPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|EYU33359.1| hypothetical protein MIMGU_mgv1a002393mg [Erythranthe guttata]
Length=680

 Score =   188 bits (477),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            ++P LG+     T+ +  ++SP + RYR W+ ++++LV YSAW+ PFE +FL  K D  L
Sbjct  32   LIPSLGARINRATTLRKNIVSPFNPRYRAWQVFLIVLVIYSAWISPFEFAFLSYKQDA-L  90

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            +V+DNIV+ FFA+DIVLTFFVAY+D  + LLI   +KIA RY+STWF+ DV ST+PF+ +
Sbjct  91   FVIDNIVNSFFAIDIVLTFFVAYLDSQSYLLIDDPRKIALRYISTWFVFDVCSTVPFQSL  150

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT  H+ G+ + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  151  SILFT-DHNGGLGFKLLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  197



>ref|XP_009114367.1| PREDICTED: potassium channel KAT1 [Brassica rapa]
Length=657

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + +YR WE W+V LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPKYRAWEMWLVFLVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNI++ FFA+DIVLTFFVAY+D  + LL+ + KKI  RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIINGFFAIDIVLTFFVAYLDSHSYLLVDNPKKITIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLG--VCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   H+ G  + + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLF---HYNGSELGFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_008812840.1| PREDICTED: potassium channel KAT3-like [Phoenix dactylifera]
Length=780

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG++    T  +   +SP D  YR WE +++LLV YSAW+CPFE +FL   L 
Sbjct  28   SSDLLPSLGATINQSTKLRRYTVSPYDPHYRVWEIFLILLVVYSAWICPFEFAFLR-HLP  86

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L +VDNIV++FFA+DIVLTFFVA++D  T LL+   K+IA RYLS+WF+ DV ST+PF
Sbjct  87   GTLCLVDNIVNIFFAIDIVLTFFVAFLDRKTYLLVDDHKRIAVRYLSSWFIFDVCSTVPF  146

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF  KH   + + +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  147  QSISLLFN-KHGSDLAFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  196



>ref|XP_006398319.1| hypothetical protein EUTSA_v10000798mg [Eutrema salsugineum]
 gb|ESQ39772.1| hypothetical protein EUTSA_v10000798mg [Eutrema salsugineum]
Length=716

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 123/173 (71%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + +YR WE W+V+LV YSAW+CPF+ +F+  K 
Sbjct  29   LSSDLLPSLGARINQSTKLRKHIISPFNPQYRAWEMWLVVLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGSELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>emb|CDY35154.1| BnaA09g17910D [Brassica napus]
Length=657

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + +YR WE W+V LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPKYRAWEMWLVFLVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNI++ FFA+DIVLTFFVAY+D  + LL+ + KKI  RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIINGFFAIDIVLTFFVAYLDSHSYLLVDNPKKITIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLG--VCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   H+ G  + + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLF---HYNGSELGFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_009360884.1| PREDICTED: potassium channel KAT1-like [Pyrus x bretschneideri]
Length=771

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR W   +VLLV YSAW+CPFE +FL  K D  L
Sbjct  33   LLPSLGARINQSTKLRKYIISPYNPRYRAWGMLLVLLVIYSAWICPFEFAFLPYKRDA-L  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            +V+DNIV+ FF +DI+LTFFVAY+D  + LL+ + K+IA RYLSTWFL DV ST PF+ +
Sbjct  92   FVIDNIVNGFFGIDIILTFFVAYLDSRSYLLVDNPKQIAIRYLSTWFLFDVCSTAPFQSI  151

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + L T  H   + + VL MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  152  SLLLTN-HSSELEFKVLNMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_004486026.1| PREDICTED: potassium channel KAT1-like isoform X1 [Cicer arietinum]
Length=782

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  Q  +ISP +  YR WE  +V+LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARINRETRLQKHLISPFNPHYRAWELLLVVLVIYSAWICPFEFAFLTYKQ  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LLI   KKIA RY+STWF  D+ ST P
Sbjct  89   DG-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLIDDPKKIAIRYISTWFAFDICSTAP  147

Query  729  FEFVAFLFTGKH-HLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             E ++ LFT ++  LG  + VL M R WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  LEPISLLFTNRNSELG--FKVLNMFRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_004486027.1| PREDICTED: potassium channel KAT1-like isoform X2 [Cicer arietinum]
Length=788

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  Q  +ISP +  YR WE  +V+LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARINRETRLQKHLISPFNPHYRAWELLLVVLVIYSAWICPFEFAFLTYKQ  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+ FFA+DI+LTFFVAY+D  + LLI   KKIA RY+STWF  D+ ST P
Sbjct  89   DG-LFIIDNIVNGFFAIDIILTFFVAYLDSHSYLLIDDPKKIAIRYISTWFAFDICSTAP  147

Query  729  FEFVAFLFTGKH-HLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             E ++ LFT ++  LG  + VL M R WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  LEPISLLFTNRNSELG--FKVLNMFRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_004293533.2| PREDICTED: potassium channel KAT1-like [Fragaria vesca subsp. 
vesca]
Length=779

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP + RYR WE  +++LV YSAW+CPFE +FL  K D
Sbjct  30   SSDLLPSLGARINQSTKLRKYIISPYNPRYRAWEMLLIVLVIYSAWICPFEFAFLTYKQD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L+++DNIV+ FFA+DI LTFFVAY+D  + LL+ + K+IA RY+STWF+ DV ST PF
Sbjct  90   A-LFIIDNIVNGFFAIDIFLTFFVAYLDNQSYLLVDNPKQIAMRYISTWFIFDVCSTAPF  148

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ +FT  H   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  149  QPISLMFT-NHGSELGFKVLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_002305337.2| K+ channel family protein [Populus trichocarpa]
 gb|EEE85848.2| K+ channel family protein [Populus trichocarpa]
Length=674

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP +S YR WE W+V+LV YSAW+ PFE +FL SK D
Sbjct  30   SSDLLPSLGARINRATKLRRYIISPYNSCYRAWEMWLVVLVVYSAWISPFEFAFLTSKKD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L++ DN+V+ FFAVDIVLTFFVA +D  + LLI   KKIA RY+STWF+ DV ST PF
Sbjct  90   A-LFIFDNVVNGFFAVDIVLTFFVACLDSHSYLLIDDPKKIAIRYISTWFIFDVCSTAPF  148

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF   H  G+ +++L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  149  QSLSLLFR-NHGNGLGFNILSMLRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>emb|CDY03233.1| BnaC09g19230D [Brassica napus]
Length=656

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 121/173 (70%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + +YR WE W+V LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPKYRAWEMWLVFLVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L+++DNIV+  FA+DIVLTFFVAY+D  + LL+ + KKI  RYLSTWF  DV ST P
Sbjct  89   DA-LFIIDNIVNGLFAIDIVLTFFVAYLDSHSYLLVDNPKKITIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF    + LG  + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLFNYNGNELG--FRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>ref|XP_008225478.1| PREDICTED: potassium channel KAT1-like [Prunus mume]
Length=767

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP + RYR WE  +VLLV YS+W+CPFE +FL  K D
Sbjct  30   SSDLLPSLGARINQSTKLRKYIISPYNPRYRAWEMLLVLLVIYSSWICPFEFAFLPYKQD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L+V+DNIV+ FFA+DI LTFFVAY+D  + LL+ + K+IA RY+STWF+ DV ST PF
Sbjct  90   A-LFVIDNIVNGFFAIDIFLTFFVAYLDSRSYLLVDNPKQIAMRYISTWFIFDVCSTAPF  148

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LFT  H   + + +L MLR WRLRRVS  F RL +DIRF+YFW+RC
Sbjct  149  QSISLLFT-NHGSELGFKLLNMLRLWRLRRVSFLFARLEKDIRFNYFWIRC  198



>ref|XP_002863415.1| hypothetical protein ARALYDRAFT_494350 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39674.1| hypothetical protein ARALYDRAFT_494350 [Arabidopsis lyrata subsp. 
lyrata]
Length=676

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + RYR WE W+V LV YSAW+CPF+ +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFNPRYRAWEMWLVFLVIYSAWICPFQFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  ++++DNIV+ FFA+DIVLTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-IFIIDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + +L MLR WRLRRVS+ F RL +DIRF+YFW+RC
Sbjct  148  FQPLSLLF-NYNGSELEFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRC  198



>emb|CAC87141.1| K+ channel protein [Populus tremula x Populus tremuloides]
Length=751

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLD  551
            S  +LP LG+     T  +  +ISP +S YR WE W+V+LV YSAW  PFE +FL SK D
Sbjct  30   SSDLLPSLGAQINRATKLRRYIISPYNSCYRAWEMWLVVLVVYSAWFSPFEFAFLTSKKD  89

Query  552  TKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPF  731
              L++ DNIV+ FFAVDI LTFFVA++D  + LLI   KKIA RY+STWF+ DV ST PF
Sbjct  90   A-LFIFDNIVNGFFAVDIALTFFVAFLDSHSYLLIDDPKKIAIRYISTWFIFDVCSTAPF  148

Query  732  EFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + ++ LF   H  G+ +++L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  149  QSLSLLFR-NHGNGLGFNILSMLRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>ref|XP_008677784.1| PREDICTED: potassium channel3 isoform X1 [Zea mays]
Length=758

 Score =   186 bits (473),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = +3

Query  363  GKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            G  +  +LP LG++       +  +ISP D  YR WE ++++LV YSAW+CPFE++FL  
Sbjct  56   GSFTIELLPSLGATINQSNKLRKFIISPYDPCYRYWELFLIVLVIYSAWICPFELAFLRD  115

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVAST  722
             L +KL + +NIV+ FFAVDIVLTFFVAY+D  T LL+  +K+IA RYLSTWF+ DV ST
Sbjct  116  -LPSKLLLAENIVNGFFAVDIVLTFFVAYVDSKTHLLVDDQKRIAVRYLSTWFIFDVCST  174

Query  723  IPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFF-TRLXEDIRFSYFWVRC  884
             PF+ ++ LFT K + G+ + +L MLR WRL RVS+ F +RL +DIRF+YFW RC
Sbjct  175  APFQPISLLFTRKGN-GLAFKILNMLRLWRLHRVSSLFASRLEKDIRFNYFWTRC  228



>ref|XP_009108358.1| PREDICTED: potassium channel KAT2-like [Brassica rapa]
Length=728

 Score =   186 bits (473),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+S    T  +  ++SP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  68   LSADLLPSLGASTNQSTKLRKHIVSPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYK-  126

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L++VDNIV+ FFA+DI+LTFFVA +D  + +L+ + KKIA RYLSTWF+ DV ST P
Sbjct  127  KHALFIVDNIVNGFFAIDIILTFFVANVDSHSYILVDNPKKIAMRYLSTWFVFDVCSTAP  186

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF  K    + ++VL MLR WRLRR S  F RL +DIRF+YFW RC
Sbjct  187  FKSLSLLFNYKGS-QIGFTVLSMLRLWRLRRGSLLFARLEKDIRFNYFWTRC  237



>ref|XP_007213639.1| hypothetical protein PRUPE_ppa001715mg [Prunus persica]
 gb|EMJ14838.1| hypothetical protein PRUPE_ppa001715mg [Prunus persica]
Length=775

 Score =   186 bits (473),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR WE  +VLLV YS+W+CPFE +FL  K D  L
Sbjct  33   LLPSLGARINQSTKLRKYIISPYNPRYRAWEMLLVLLVIYSSWICPFEFAFLPYKQDA-L  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            +V+DNIV+ FFA+DI LTFFVAY+D  + LL+ + K+IA RY+STWF+ DV ST PF+ +
Sbjct  92   FVLDNIVNGFFAIDIFLTFFVAYLDSRSYLLVDNPKQIAMRYISTWFIFDVCSTAPFQSI  151

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LFT  H   + + +L MLR WRLRRVS  F RL +DIRF+YFW+RC
Sbjct  152  SLLFTN-HGSELGFKLLNMLRLWRLRRVSFLFARLEKDIRFNYFWIRC  198



>ref|XP_010559246.1| PREDICTED: potassium channel KAT1 [Tarenaya hassleriana]
 ref|XP_010559247.1| PREDICTED: potassium channel KAT1 [Tarenaya hassleriana]
 ref|XP_010559248.1| PREDICTED: potassium channel KAT1 [Tarenaya hassleriana]
Length=774

 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 4/173 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D RYR WE W+V+LV YSA +CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINHSTKLRKHIISPFDPRYRAWEMWLVILVIYSALICPFEFAFITYKN  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L ++DNIV+ FFA+DIVLTFFVAY+D  + LL+   KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LSIIDNIVNGFFAIDIVLTFFVAYLDSHSYLLVDSPKKIAIRYLSTWFAFDVCSTAP  147

Query  729  FEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF      LG  + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  148  FQSLSLLFNYNGSELG--FRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_007025090.1| Potassium channel in 2 [Theobroma cacao]
 gb|EOY27712.1| Potassium channel in 2 [Theobroma cacao]
Length=828

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 8/185 (4%)
 Frame = +3

Query  348  EDFSLGK------LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAW  509
            ++F +G        S  +LP LG+     T  +  +ISP +  YR WE W+V+LV YSAW
Sbjct  78   DEFQMGSDIHGSFFSSDLLPSLGARINQATKLRKYIISPFNPHYRAWEMWLVVLVIYSAW  137

Query  510  VCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL  689
            +CPFE +FL  K D  L++VDNIV+ FFA+DI+LTFFVAY+D  + LL+   KKIA RY+
Sbjct  138  ICPFEFAFLTYKKDA-LFIVDNIVNGFFAIDIILTFFVAYLDSQSYLLVDDPKKIAIRYI  196

Query  690  STWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSY  869
            STWF  DV ST+PF++++ L T      +   +L MLR WRLRRVS+ F RL +DIRF+Y
Sbjct  197  STWFAFDVCSTVPFQYLSILLTDNGS-ELWLRLLNMLRLWRLRRVSSLFARLEKDIRFNY  255

Query  870  FWVRC  884
            FW RC
Sbjct  256  FWTRC  260



>ref|XP_003593936.1| Potassium channel [Medicago truncatula]
Length=786

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + +YR WE  +++LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARTNQETRLRKYIISPFNPQYRLWELLLIVLVIYSAWICPFEFAFLTYK-  87

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L+++DNIV+ FFA+DIVLTFFVAY D  + LLI   KKIAT Y+STWF++D+ ST P
Sbjct  88   QNGLFIIDNIVNGFFAIDIVLTFFVAYHDSHSSLLIDDPKKIATSYMSTWFVLDICSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             E ++ LFT  +   + + +L MLR WRLRRVS+ F RL +DIRF+YFWVRC
Sbjct  148  LEPISLLFT-TYDSELGFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWVRC  198



>ref|XP_003541662.1| PREDICTED: potassium channel KAT2-like [Glycine max]
Length=777

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 116/168 (69%), Gaps = 3/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP   RYR WE  +V+LV YSAW+CPFE +FL  K +  L
Sbjct  34   LLPSLGARINQETRLRRYIISPFHPRYRAWELVLVVLVIYSAWICPFEFAFLPYK-ENAL  92

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++ DNIV+ FFA+DIVLTFFVAY+D  + LL+   KKIA RY+STWF  DV STIPF+  
Sbjct  93   FIADNIVNGFFAIDIVLTFFVAYLDRHSYLLVDDPKKIAIRYISTWFAFDVCSTIPFQSF  152

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +FLF     LG  + VL M R WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  153  SFLFNHSSELG--FKVLNMFRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|KHN47317.1| Potassium channel KAT2 [Glycine soja]
Length=777

 Score =   186 bits (471),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 116/168 (69%), Gaps = 3/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP   RYR WE  +V+LV YSAW+CPFE +FL  K +  L
Sbjct  34   LLPSLGARINQETRLRRYIISPFHPRYRAWELVLVVLVIYSAWICPFEFAFLPYK-ENAL  92

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++ DNIV+ FFA+DIVLTFFVAY+D  + LL+   KKIA RY+STWF  DV STIPF+  
Sbjct  93   FIADNIVNGFFAIDIVLTFFVAYLDRHSYLLVDDPKKIAIRYISTWFAFDVCSTIPFQSF  152

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +FLF     LG  + VL M R WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  153  SFLFNHSSELG--FKVLNMFRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|AES64187.2| inwardly rectifying potassium channel subunit [Medicago truncatula]
Length=780

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP + +YR WE  +++LV YSAW+CPFE +FL  K 
Sbjct  29   LSSDLLPSLGARTNQETRLRKYIISPFNPQYRLWELLLIVLVIYSAWICPFEFAFLTYK-  87

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L+++DNIV+ FFA+DIVLTFFVAY D  + LLI   KKIAT Y+STWF++D+ ST P
Sbjct  88   QNGLFIIDNIVNGFFAIDIVLTFFVAYHDSHSSLLIDDPKKIATSYMSTWFVLDICSTAP  147

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             E ++ LFT  +   + + +L MLR WRLRRVS+ F RL +DIRF+YFWVRC
Sbjct  148  LEPISLLFT-TYDSELGFKLLNMLRLWRLRRVSSLFARLEKDIRFNYFWVRC  198



>ref|XP_004511133.1| PREDICTED: potassium channel KAT1-like [Cicer arietinum]
Length=690

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  ILP LG+     T  +  +ISP +  YR W+  +++LV YSAW+CPFE  FL  K 
Sbjct  28   LSNDILPSLGARINQETRLRKYIISPFNPNYRAWDMLLIILVIYSAWICPFEFGFLSYKQ  87

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            DT L+++DNIV+ FFA+DIV+TFF+AY+D  + LLI   K+IA RYL TWFL+DV+ST P
Sbjct  88   DT-LFIIDNIVNAFFAIDIVMTFFLAYLDVHSYLLIDDPKRIAARYLCTWFLLDVSSTAP  146

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             + +  +FT  H   + + VL MLR WRLRRV+  F RL +DIRF+YFW RC
Sbjct  147  LQSIISIFT-DHSGEIGFKVLNMLRLWRLRRVNYLFARLEKDIRFNYFWTRC  197



>ref|XP_010279668.1| PREDICTED: potassium channel KAT3 [Nelumbo nucifera]
Length=768

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 124/180 (69%), Gaps = 4/180 (2%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
            E  S G  S  ILP LG+     T  +  +ISP ++ YR W  ++++LV YSAW+CPFE 
Sbjct  21   ESGSYGFFSSDILPSLGARLNQETKLRRCIISPFNTHYRAWGMFLIVLVIYSAWICPFEF  80

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL+ K DT L++VD I+D FFA+DI+LTFFVAY+D  + LL+   KKIA RY+STWF+ 
Sbjct  81   AFLKYKQDT-LFIVDYIIDGFFAIDIILTFFVAYLDRRSYLLVDDPKKIAIRYMSTWFVF  139

Query  708  DVASTIPFEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DV ST P + ++ LFT   + LG  + VL MLR WRL+RVS+ F RL +DIRF YFW RC
Sbjct  140  DVCSTAPLQPLSLLFTDNSNELG--FKVLSMLRLWRLQRVSSLFERLEKDIRFDYFWTRC  197



>gb|KJB69811.1| hypothetical protein B456_011G043500 [Gossypium raimondii]
Length=763

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 124/186 (67%), Gaps = 8/186 (4%)
 Frame = +3

Query  345  DEDFSLGK------LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  506
            +++F +G        S  +LP LG+     T  +  +ISP +  YR WE W+V+LV YSA
Sbjct  25   NDEFQMGSDIHGNFFSSDLLPSLGARINQTTKLRRYIISPFNPYYRAWEMWLVVLVIYSA  84

Query  507  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  686
            W+CPFE +FL  + D  L++ DNIV+ FFAVDIVLTFFVAY+D  + LL+   KKIA RY
Sbjct  85   WICPFEFAFLTYEKD-GLFIFDNIVNGFFAVDIVLTFFVAYLDSHSYLLVDDPKKIAIRY  143

Query  687  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFS  866
            +STWF  DV ST PF+ ++ LFT  H   +   +L MLR WRLRRVS+ F RL +DIRF+
Sbjct  144  ISTWFAFDVCSTAPFQSLSLLFT-NHGSELWLRLLNMLRLWRLRRVSSLFARLEKDIRFN  202

Query  867  YFWVRC  884
            YFW RC
Sbjct  203  YFWTRC  208



>ref|XP_007147900.1| hypothetical protein PHAVU_006G164300g [Phaseolus vulgaris]
 ref|XP_007147901.1| hypothetical protein PHAVU_006G164300g [Phaseolus vulgaris]
 gb|ESW19894.1| hypothetical protein PHAVU_006G164300g [Phaseolus vulgaris]
 gb|ESW19895.1| hypothetical protein PHAVU_006G164300g [Phaseolus vulgaris]
Length=773

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 125/186 (67%), Gaps = 9/186 (5%)
 Frame = +3

Query  348  EDFSLGKLSKF-------ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  506
            ++F +G +S+        +LP LG+        +  VISP + RYR WE  +V+LV YSA
Sbjct  16   DEFQMGNISQGSFLANDDLLPSLGARINQEFRLRRYVISPFNPRYRAWELVLVVLVIYSA  75

Query  507  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  686
            W+CPFE +FL  K DT L+++DNIV+ FFA+DIVLTFFVAY+D  + LL+   K+IA RY
Sbjct  76   WICPFEFAFLPYKEDT-LFIIDNIVNGFFAIDIVLTFFVAYLDHHSYLLVDDPKRIAIRY  134

Query  687  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFS  866
            LS+WF  DV STIPF+  +FL T  H   + + V  M R WRLRRVS+ F RL +DIRF+
Sbjct  135  LSSWFAFDVCSTIPFQSFSFLLT-NHINELGFKVFNMFRLWRLRRVSSLFARLEKDIRFN  193

Query  867  YFWVRC  884
            YFW RC
Sbjct  194  YFWTRC  199



>ref|XP_009381861.1| PREDICTED: potassium channel KAT3-like [Musa acuminata subsp. 
malaccensis]
Length=754

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+        +  +ISP + RYR W+ ++VLLV YSAW+CPFE++FL   L  KL
Sbjct  31   LLPSLGAKINQSIKLRKFIISPYNPRYRAWQMFLVLLVIYSAWICPFELAFLRY-LPPKL  89

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            + V+NI++ FFA+DI+LTFFVAY+D  + LLI   K+IA RYLS+WF+ D+ ST PF+ +
Sbjct  90   FWVENILNSFFAIDIILTFFVAYLDRKSYLLIDDPKRIAARYLSSWFIFDILSTAPFQAI  149

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LF G  +  + + +L MLR WRLRRVS+ F+RL +DIRF+YFW RC
Sbjct  150  SLLFEGSGN-DLGFKILNMLRLWRLRRVSSLFSRLEKDIRFNYFWTRC  196



>gb|KHG04443.1| Potassium channel KAT1 -like protein [Gossypium arboreum]
Length=763

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 124/186 (67%), Gaps = 8/186 (4%)
 Frame = +3

Query  345  DEDFSLGK------LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  506
            +++F +G        S  +LP LG+     T  +  +ISP +  YR WE W+V+LV YSA
Sbjct  25   NDEFQMGSDIHGNFFSSDLLPSLGARINQTTKLRRYIISPFNPYYRAWEMWLVILVIYSA  84

Query  507  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  686
            W+CPFE +FL  + D  L++ DNIV+ FFAVDIVLTFFVAY+D  + LL+   KKIA RY
Sbjct  85   WICPFEFAFLTYEKD-GLFIFDNIVNGFFAVDIVLTFFVAYLDSHSYLLVDDPKKIAIRY  143

Query  687  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFS  866
            +STWF  DV ST PF+ ++ +FT  H   +   +L MLR WRLRRVS+ F RL +DIRF+
Sbjct  144  ISTWFAFDVCSTAPFQSLSLMFT-NHGSELWLRLLNMLRLWRLRRVSSLFARLEKDIRFN  202

Query  867  YFWVRC  884
            YFW RC
Sbjct  203  YFWTRC  208



>emb|CAM88967.1| AKT2 inward rectifier channel [Physcomitrella patens]
Length=967

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = +3

Query  372  SKFILPPLGSSQPTHTSS---QGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLES  542
            S  ILP LGS     + +      VI P + RYR W  W++LLV YSAWV PFE  F+E 
Sbjct  35   SSGILPALGSRASISSRNIVLNKYVIHPHNHRYRLWCNWLILLVFYSAWVSPFEFGFIED  94

Query  543  KLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYL-STWFLMDVAS  719
                 L+  D IV+ FFA+DI+LTFFVAY+D  T L++   +KIA RYL STWF +DVAS
Sbjct  95   PRGA-LFTADMIVNGFFAIDIILTFFVAYLDSETYLMVDSFRKIAKRYLTSTWFTLDVAS  153

Query  720  TIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            T+PF  +A +FTGK+  G  YS++ MLR WRLRRVS  F R  +D+RFSYFW+RC
Sbjct  154  TVPFGLLALVFTGKYGTGFTYSLINMLRLWRLRRVSAMFARFEKDVRFSYFWIRC  208



>gb|KHN33141.1| Potassium channel KAT1 [Glycine soja]
Length=777

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 114/168 (68%), Gaps = 3/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR WE  +V+LV YSAW+CPFE +FL  K D  L
Sbjct  34   LLPSLGARLNQETRLRRYIISPFNPRYRAWELVLVVLVIYSAWICPFEFAFLPYKEDA-L  92

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FF +DIVLTFFVAY D  + LL+   KKIA RY+STWF  DV STIPF+  
Sbjct  93   FIVDNIVNGFFVIDIVLTFFVAYPDRHSYLLVDDPKKIAIRYISTWFGFDVCSTIPFQSF  152

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +FLF     LG  + V  M R WRLRRVS  F RL +DIRF+YFW RC
Sbjct  153  SFLFNNSSELG--FKVFNMFRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>ref|XP_006597528.1| PREDICTED: potassium channel KAT1-like [Glycine max]
Length=777

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 114/168 (68%), Gaps = 3/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP + RYR WE  +V+LV YSAW+CPFE +FL  K D  L
Sbjct  34   LLPSLGARLNQETRLRRYIISPFNPRYRAWELVLVVLVIYSAWICPFEFAFLPYKEDA-L  92

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FF +DIVLTFFVAY D  + LL+   KKIA RY+STWF  DV STIPF+  
Sbjct  93   FIVDNIVNGFFVIDIVLTFFVAYPDRHSYLLVDDPKKIAIRYISTWFGFDVCSTIPFQSF  152

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +FLF     LG  + V  M R WRLRRVS  F RL +DIRF+YFW RC
Sbjct  153  SFLFNNSSELG--FKVFNMFRLWRLRRVSALFARLEKDIRFNYFWTRC  198



>gb|KJB57249.1| hypothetical protein B456_009G155200 [Gossypium raimondii]
Length=723

 Score =   182 bits (463),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            D D      S  ++P LG+     T  +  +ISP +  YR WE W+V+LV YSAW+CPFE
Sbjct  21   DSDIHGSCFSSDLIPSLGARINHATKLRTYIISPFNPHYRAWEIWLVVLVIYSAWICPFE  80

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
             +FL  K D  L++ DNIV+ FFA DI+LTFFVAY+D  + LL+   KKIA RY+STW  
Sbjct  81   FAFLTDKNDA-LFIFDNIVNGFFAADIILTFFVAYLDGQSYLLVDDPKKIAIRYISTWLA  139

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             DV ST PF+ +  +FT  H   +   +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  140  FDVCSTAPFQSLNLMFT-DHGSELGLRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>gb|KJB57248.1| hypothetical protein B456_009G155200 [Gossypium raimondii]
Length=766

 Score =   183 bits (464),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            D D      S  ++P LG+     T  +  +ISP +  YR WE W+V+LV YSAW+CPFE
Sbjct  21   DSDIHGSCFSSDLIPSLGARINHATKLRTYIISPFNPHYRAWEIWLVVLVIYSAWICPFE  80

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
             +FL  K D  L++ DNIV+ FFA DI+LTFFVAY+D  + LL+   KKIA RY+STW  
Sbjct  81   FAFLTDKNDA-LFIFDNIVNGFFAADIILTFFVAYLDGQSYLLVDDPKKIAIRYISTWLA  139

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             DV ST PF+ +  +FT  H   +   +L MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  140  FDVCSTAPFQSLNLMFT-DHGSELGLRLLNMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  198



>ref|XP_008783945.1| PREDICTED: potassium channel KAT3 isoform X3 [Phoenix dactylifera]
Length=792

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 124/193 (64%), Gaps = 27/193 (14%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L TKL
Sbjct  31   LLPSLGATINQSVKLRKFIISPYDPRYRVWEMFLIILVIYSAWICPFELAFLRY-LPTKL  89

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++ +NIV+ FFAVDIVLTFFVAY+D  + LLI   K+IATRYLSTWF+ DV ST PF+ +
Sbjct  90   FLAENIVNSFFAVDIVLTFFVAYLDRKSYLLIDDPKRIATRYLSTWFIFDVCSTAPFQPL  149

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFT-------------------------RL  845
            + LFT  H  G+ + +L MLR WRLRRVS+ F                          RL
Sbjct  150  SLLFTS-HGNGLVFKILNMLRLWRLRRVSSLFARSEYHPVSLKLNGYRMDAHQTISLIRL  208

Query  846  XEDIRFSYFWVRC  884
             +DIRF+YFW RC
Sbjct  209  EKDIRFNYFWTRC  221



>ref|XP_009393618.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=897

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 117/178 (66%), Gaps = 4/178 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            D S   LS  ILP LG+      +    ++SP D RYR WET++V LV Y+AWV PFE  
Sbjct  45   DGSHYSLSSGILPSLGARSNRRVNLPSFIVSPYDRRYRSWETFLVTLVVYTAWVSPFEFG  104

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            FLE K    L ++DNIV++FFA+DIVLTFFVAY+D TT LLI  RK+IA RYLSTWF++D
Sbjct  105  FLE-KSRGVLALIDNIVNVFFAIDIVLTFFVAYLDRTTYLLIDSRKQIAWRYLSTWFILD  163

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP E    +          Y    MLR WRLRRVS+ F RL +D  F+YFWVRC
Sbjct  164  VASTIPSEIARKILPKNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRNFNYFWVRC  218



>ref|XP_008783943.1| PREDICTED: potassium channel KAT2 isoform X1 [Phoenix dactylifera]
Length=818

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 124/193 (64%), Gaps = 27/193 (14%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  +ISP D RYR WE ++++LV YSAW+CPFE++FL   L TKL
Sbjct  31   LLPSLGATINQSVKLRKFIISPYDPRYRVWEMFLIILVIYSAWICPFELAFLRY-LPTKL  89

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++ +NIV+ FFAVDIVLTFFVAY+D  + LLI   K+IATRYLSTWF+ DV ST PF+ +
Sbjct  90   FLAENIVNSFFAVDIVLTFFVAYLDRKSYLLIDDPKRIATRYLSTWFIFDVCSTAPFQPL  149

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFT-------------------------RL  845
            + LFT  H  G+ + +L MLR WRLRRVS+ F                          RL
Sbjct  150  SLLFTS-HGNGLVFKILNMLRLWRLRRVSSLFARSEYHPVSLKLNGYRMDAHQTISLIRL  208

Query  846  XEDIRFSYFWVRC  884
             +DIRF+YFW RC
Sbjct  209  EKDIRFNYFWTRC  221



>ref|XP_009406246.1| PREDICTED: potassium channel KAT2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=799

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  ++SP D RYR WE +++LLV YSAW+CPFE +FL   L + +
Sbjct  30   LLPSLGATINNTIKLRKHIVSPYDPRYRLWEMFLILLVLYSAWICPFEFAFLRY-LPSTI  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FFA+DIVLTFFVA+ID  + LL+   K+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   FLVDNIVNSFFAIDIVLTFFVAFIDHKSYLLVDDPKRIAIRYLSTWFMFDVCSTFPFQTI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +F F  +H   + + +L MLR WRL RVS+ F RL +DIR +YFW RC
Sbjct  149  SFFFN-RHGNSLGFKLLSMLRLWRLHRVSSLFARLEKDIRLNYFWTRC  195



>ref|XP_009396647.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=888

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 120/178 (67%), Gaps = 4/178 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            + +L  LS  ILP LG+        +  ++SP   RY+ WET++++LV Y+AW  PFE  
Sbjct  30   EANLYNLSSGILPSLGARSTRRVKLRRFIVSPYARRYKAWETYLIVLVVYTAWASPFEFG  89

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            FLE +    L +VDN+VD FFAVDIVLTFFVAY+D T+ LLI  RKKIA RYLSTWF++D
Sbjct  90   FLE-RSRGALALVDNVVDAFFAVDIVLTFFVAYVDKTSYLLIDSRKKIAWRYLSTWFVLD  148

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +AST+P E    +   K  LG  Y    MLR WRLRRVS+ F RL +D +F+YFWVRC
Sbjct  149  LASTVPLEIARRILPRK--LG-SYGFFTMLRLWRLRRVSSLFARLEKDRKFNYFWVRC  203



>ref|XP_009355247.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Pyrus x bretschneideri]
Length=831

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 109/180 (61%), Gaps = 42/180 (23%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  69   ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  128

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++FL +     LY+ DN+VDLFFA DI+LTFFVAY+DP TQLL+H  KKIA         
Sbjct  129  VAFLNTSKSRPLYIADNVVDLFFAADIILTFFVAYVDPRTQLLVHESKKIA---------  179

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
                                           +RFWRLRR    FTRL +DIRFSYFWVRC
Sbjct  180  -------------------------------MRFWRLRRAKQLFTRLEKDIRFSYFWVRC  208



>ref|XP_009406249.1| PREDICTED: potassium channel KAT3-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  ++SP D RYR WE +++LLV YSAW+CPFE +FL   L + +
Sbjct  30   LLPSLGATINNTIKLRKHIVSPYDPRYRLWEMFLILLVLYSAWICPFEFAFLRY-LPSTI  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FFA+DIVLTFFVA+ID  + LL+   K+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   FLVDNIVNSFFAIDIVLTFFVAFIDHKSYLLVDDPKRIAIRYLSTWFMFDVCSTFPFQTI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +F F  +H   + + +L MLR WRL RVS+ F RL +DIR +YFW RC
Sbjct  149  SFFFN-RHGNSLGFKLLSMLRLWRLHRVSSLFARLEKDIRLNYFWTRC  195



>ref|XP_009406247.1| PREDICTED: potassium channel KAT3-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=777

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  ++SP D RYR WE +++LLV YSAW+CPFE +FL   L + +
Sbjct  30   LLPSLGATINNTIKLRKHIVSPYDPRYRLWEMFLILLVLYSAWICPFEFAFLRY-LPSTI  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FFA+DIVLTFFVA+ID  + LL+   K+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   FLVDNIVNSFFAIDIVLTFFVAFIDHKSYLLVDDPKRIAIRYLSTWFMFDVCSTFPFQTI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +F F  +H   + + +L MLR WRL RVS+ F RL +DIR +YFW RC
Sbjct  149  SFFFN-RHGNSLGFKLLSMLRLWRLHRVSSLFARLEKDIRLNYFWTRC  195



>ref|XP_009406245.1| PREDICTED: potassium channel KAT3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=805

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  ++SP D RYR WE +++LLV YSAW+CPFE +FL   L + +
Sbjct  30   LLPSLGATINNTIKLRKHIVSPYDPRYRLWEMFLILLVLYSAWICPFEFAFLRY-LPSTI  88

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FFA+DIVLTFFVA+ID  + LL+   K+IA RYLSTWF+ DV ST PF+ +
Sbjct  89   FLVDNIVNSFFAIDIVLTFFVAFIDHKSYLLVDDPKRIAIRYLSTWFMFDVCSTFPFQTI  148

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +F F  +H   + + +L MLR WRL RVS+ F RL +DIR +YFW RC
Sbjct  149  SFFFN-RHGNSLGFKLLSMLRLWRLHRVSSLFARLEKDIRLNYFWTRC  195



>ref|XP_004244802.1| PREDICTED: potassium channel KAT3 [Solanum lycopersicum]
Length=683

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 119/180 (66%), Gaps = 7/180 (4%)
 Frame = +3

Query  354  FSLGKLSKF----ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            FS  K S F    +LP LG+     T  +  +ISP+D RYR WE +++LLV Y+AW+ PF
Sbjct  3    FSYAKFSGFFSSDLLPSLGTKTNHETKLRKYIISPLDLRYRAWEMFLLLLVIYTAWITPF  62

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E +FL  K+D  L + DNIV+ FFA+DI L FF+AY+D  + +L+   KKIA RYLSTWF
Sbjct  63   EFAFLIYKIDA-LVIFDNIVNCFFAIDIFLNFFMAYLDKESYILVDDPKKIAIRYLSTWF  121

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            + DV ST+PF    FLF      GV + +L MLR WRLRRVS  F RL +DIRF+YFW R
Sbjct  122  IFDVCSTVPFH--DFLFIDHKEGGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTR  179



>ref|XP_009416516.1| PREDICTED: potassium channel KAT1-like [Musa acuminata subsp. 
malaccensis]
Length=503

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 117/168 (70%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  ++SP D  YR WE ++++LV YSAW+CPFE +FL   L + +
Sbjct  29   LLPSLGATINHRIKLRKHIVSPYDPHYRLWEMFLMVLVLYSAWICPFEFAFLHY-LPSTM  87

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNIV+ FFA+DI LTFFVA++DP + LL+   K+IA RYLSTWF+ D  ST PF+ +
Sbjct  88   FLVDNIVNSFFAIDIALTFFVAFVDPKSYLLVDEPKRIAVRYLSTWFIFDACSTFPFQTI  147

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +F F  +H   + + +L MLR WRL RV + F RL +DIRF+YFW RC
Sbjct  148  SFFF-NRHGNSLGFKLLSMLRLWRLHRVGSLFARLEKDIRFNYFWTRC  194



>ref|XP_009386140.1| PREDICTED: potassium channel AKT1 [Musa acuminata subsp. malaccensis]
Length=891

 Score =   181 bits (460),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 115/178 (65%), Gaps = 4/178 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            D S   LS  ILP LG+        +  ++SP D RYR WET++++LV YSAWV PFE  
Sbjct  29   DGSHYSLSSGILPSLGARSNRRVKLRSFIVSPYDRRYRAWETFLIILVIYSAWVSPFEFG  88

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            FLE    + L +VDNIV+ FFA+DI+LTFFVAY+D  T LL+  RKKIA RYL +WF++D
Sbjct  89   FLEDSRGS-LALVDNIVNAFFAIDIMLTFFVAYLDKATYLLVDDRKKIAWRYLHSWFILD  147

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP E    +   K      Y    MLR WRLRRVS  F RL +D  F+YFWVRC
Sbjct  148  VASTIPSEIARKMLPPKIR---SYGFFNMLRLWRLRRVSALFARLEKDRNFNYFWVRC  202



>ref|XP_010051190.1| PREDICTED: potassium channel AKT1-like [Eucalyptus grandis]
Length=931

 Score =   181 bits (460),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 119/180 (66%), Gaps = 7/180 (4%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            DE++S+   SK ILP LG+        +  +ISP D RYR W++++VLLV Y+AWV PFE
Sbjct  45   DEEYSM---SKGILPSLGARTHRRVKLRQFIISPFDYRYRLWQSFLVLLVFYTAWVSPFE  101

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
              FLE K    L + DN+V+ FFA+DI+LTFFVAY+D T+ LL+  RKKIA RY++TW  
Sbjct  102  FGFLE-KPQGPLAITDNVVNGFFAIDIILTFFVAYLDKTSYLLVDDRKKIALRYVTTWLA  160

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             D+ STIPFE V  +          Y +  MLR WRLRRVS+ F RL +D  F+YFWVRC
Sbjct  161  FDIISTIPFEVVKSILPSPLE---QYGIFNMLRLWRLRRVSSMFARLEKDKNFNYFWVRC  217



>ref|XP_010540570.1| PREDICTED: potassium channel KAT2-like isoform X3 [Tarenaya hassleriana]
Length=526

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  384  LPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLY  563
            LPP           +  VISP D RYR WE+W+ +LV YSAWV PFE++FL  K D+ L 
Sbjct  17   LPPSLGGANKAKKLRKHVISPFDPRYRAWESWLTVLVIYSAWVTPFELAFLTCKRDS-LL  75

Query  564  VVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVA  743
            V+DNIV+ FFA+DI+L FFVAY D  T LL+   KKIA RY+STWF++DV ST PF  + 
Sbjct  76   VLDNIVNTFFAIDIILAFFVAYKDSRTYLLVDDHKKIALRYVSTWFVLDVCSTTPFRALC  135

Query  744  FLF-TGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F  G   LG+   VL +LR WRLRRVS  F+RL +DI FSYFW+RC
Sbjct  136  IVFDDGGSELGL--RVLTVLRLWRLRRVSLLFSRLEKDIHFSYFWIRC  181



>ref|XP_010540571.1| PREDICTED: potassium channel KAT2-like isoform X4 [Tarenaya hassleriana]
Length=525

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  384  LPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLY  563
            LPP           +  VISP D RYR WE+W+ +LV YSAWV PFE++FL  K D+ L 
Sbjct  17   LPPSLGGANKAKKLRKHVISPFDPRYRAWESWLTVLVIYSAWVTPFELAFLTCKRDS-LL  75

Query  564  VVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVA  743
            V+DNIV+ FFA+DI+L FFVAY D  T LL+   KKIA RY+STWF++DV ST PF  + 
Sbjct  76   VLDNIVNTFFAIDIILAFFVAYKDSRTYLLVDDHKKIALRYVSTWFVLDVCSTTPFRALC  135

Query  744  FLF-TGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F  G   LG+   VL +LR WRLRRVS  F+RL +DI FSYFW+RC
Sbjct  136  IVFDDGGSELGL--RVLTVLRLWRLRRVSLLFSRLEKDIHFSYFWIRC  181



>ref|XP_008378876.1| PREDICTED: potassium channel AKT2/3 isoform X2 [Malus domestica]
Length=797

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 108/180 (60%), Gaps = 42/180 (23%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHT--SSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFE  524
            +  L  +SK ILPPLG+S    T   S G ++SPMDSRYRCWET+MV+LVAYSAWV PFE
Sbjct  65   ELDLRNISKLILPPLGASSYNQTPIQSNGWIVSPMDSRYRCWETFMVVLVAYSAWVYPFE  124

Query  525  ISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFL  704
            ++FL +     LY+ DN+VDLFF  DI+LTFFVAY+DP TQLL+H  KKIA         
Sbjct  125  VAFLNTSKSRPLYIADNVVDLFFXADIILTFFVAYVDPRTQLLVHDSKKIA---------  175

Query  705  MDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
                                           +RFWRLRR    FTRL +DIRFSYFWVRC
Sbjct  176  -------------------------------MRFWRLRRAKQLFTRLEKDIRFSYFWVRC  204



>ref|XP_010434553.1| PREDICTED: potassium channel KAT2 [Camelina sativa]
 ref|XP_010434554.1| PREDICTED: potassium channel KAT2 [Camelina sativa]
Length=685

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 119/172 (69%), Gaps = 5/172 (3%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+     T  +  +ISP D R+R WE W+V+LV YSAW+CPFE +F+  K 
Sbjct  29   LSADLLPSLGARINQSTKLRKHIISPFDPRFRAWEMWLVILVIYSAWICPFEFAFITYKK  88

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            D  L++   IV+ FFA+DI+LTFFVAY+D  + LL+ + KKIA RYLSTWF  DV ST P
Sbjct  89   DA-LFI---IVNGFFAIDIILTFFVAYLDSHSYLLVDNPKKIAIRYLSTWFAFDVCSTAP  144

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            F+ ++ LF   +   + + VL MLR WRLRRVS+ F RL +DIRF+YFW RC
Sbjct  145  FQSLSLLFN-YNGSEIGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRC  195



>ref|XP_009408890.1| PREDICTED: potassium channel KAT3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=763

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 122/169 (72%), Gaps = 4/169 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  +ISP D  YR W+ ++VLLV YSAW+CPFE++FL   L  KL
Sbjct  31   LLPSLGANINQSIKLRKFMISPYDPHYRAWQMFLVLLVIYSAWICPFELAFLRY-LPAKL  89

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            + V+NI++ FFA+DI++TFFVA++D  + LLI   K+IA RYLS+WF+ D+ ST PF+ +
Sbjct  90   FWVENILNSFFAIDIIVTFFVAFLDRKSYLLIDDPKRIAARYLSSWFIFDILSTAPFQAI  149

Query  741  AFLFTGK-HHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            + LF G  ++LG  + +L MLR WRLRRV + F+RL +DIRF+YFW RC
Sbjct  150  SLLFRGSGNNLG--FKILNMLRLWRLRRVGSLFSRLEKDIRFNYFWTRC  196



>gb|KEH19291.1| inwardly rectifying potassium channel subunit [Medicago truncatula]
Length=694

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 121/179 (68%), Gaps = 7/179 (4%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
            +DF  G     +LP LG+     T  +  +ISP +  Y  W+ W+++LV YSAW+CPF+ 
Sbjct  16   DDFQTG-----MLPSLGARVHQETKLRSYIISPFNRNYWAWDKWLIILVLYSAWICPFQF  70

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL  K DT L+++DNIV+ FFA+DIV+TFFVAY+D  + LLI   KKIA RYL TWF+ 
Sbjct  71   AFLPQKHDT-LFIIDNIVNGFFAIDIVMTFFVAYLDNHSYLLIDDHKKIAKRYLCTWFIF  129

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DV ST P + ++ +FT  H     + +L MLR WRLRRVS+ F  L ++IR++YFW+RC
Sbjct  130  DVCSTAPLQAISSIFT-DHSSEFGFRILDMLRLWRLRRVSSLFASLEKNIRWNYFWIRC  187



>ref|XP_009389833.1| PREDICTED: potassium channel KAT3-like [Musa acuminata subsp. 
malaccensis]
Length=574

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  ++SP D RYR WE ++++LV YSAW+CPFE +F    L + +
Sbjct  89   LLPSLGATINHTIKLRKHIVSPYDPRYRLWEKFLIVLVLYSAWICPFEFAF-RRYLPSTI  147

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
            ++VDNI++ FFA+DIVLTFFVA++D  + LL+   K+IA RYLSTWF+ D  ST PF+ +
Sbjct  148  FLVDNIINSFFAIDIVLTFFVAFVDHKSYLLVDEPKRIAVRYLSTWFIFDACSTFPFQTI  207

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +FLF G H   + + +L +LR WRL RV++ F RL +DIRF+YFW RC
Sbjct  208  SFLFNG-HSKSLGFKLLSVLRLWRLHRVNSLFARLEKDIRFNYFWTRC  254



>ref|XP_006356880.1| PREDICTED: potassium channel KAT1-like [Solanum tuberosum]
Length=689

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 118/180 (66%), Gaps = 7/180 (4%)
 Frame = +3

Query  354  FSLGKLSKF----ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPF  521
            FS  K S F    +LP LG+     T  +  +ISP+D RYR WE +++ LV Y+AW+ PF
Sbjct  3    FSYAKYSGFFSSDLLPSLGTKINHETKLRKYIISPLDLRYRAWEMFLLFLVIYTAWITPF  62

Query  522  EISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWF  701
            E +FL  K+D  L + DNIV+ FFA+DI L FF+AY+D  + +L+   KKIA RYLSTWF
Sbjct  63   EFAFLICKIDA-LVIFDNIVNCFFAIDIFLNFFMAYLDKESYILVDDPKKIAIRYLSTWF  121

Query  702  LMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            + DV ST+PF    FLF      GV + +L MLR WRLRRVS  F RL +DIRF+YFW R
Sbjct  122  IFDVCSTVPFH--DFLFIDHKESGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTR  179



>ref|XP_009396648.1| PREDICTED: LOW QUALITY PROTEIN: potassium channel AKT1-like [Musa 
acuminata subsp. malaccensis]
Length=541

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 115/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            ILP LG+        +  ++SP   RY+ WET++++LV Y+AW  PFE  FLE +    L
Sbjct  9    ILPSLGARSTRRVKLRRFIVSPYARRYKAWETFLIVLVVYTAWASPFEFGFLE-RSRGAL  67

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             +VDN+VD  FAVDIVLTFFVAY+D T+ LLI  RKKIA RYLSTWF++D+AST+P E V
Sbjct  68   ALVDNVVDALFAVDIVLTFFVAYVDKTSYLLIDSRKKIAWRYLSTWFVLDLASTVPLEIV  127

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
              +   K  LG  Y    MLR WRLRRVS+ F RL +D +F+YFWVRC
Sbjct  128  RRILPRK--LG-SYGFFTMLRLWRLRRVSSLFARLEKDRKFNYFWVRC  172



>ref|XP_010540569.1| PREDICTED: potassium channel KAT3-like isoform X2 [Tarenaya hassleriana]
Length=642

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  384  LPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLY  563
            LPP           +  VISP D RYR WE+W+ +LV YSAWV PFE++FL  K D+ L 
Sbjct  17   LPPSLGGANKAKKLRKHVISPFDPRYRAWESWLTVLVIYSAWVTPFELAFLTCKRDS-LL  75

Query  564  VVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVA  743
            V+DNIV+ FFA+DI+L FFVAY D  T LL+   KKIA RY+STWF++DV ST PF  + 
Sbjct  76   VLDNIVNTFFAIDIILAFFVAYKDSRTYLLVDDHKKIALRYVSTWFVLDVCSTTPFRALC  135

Query  744  FLF-TGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F  G   LG+   VL +LR WRLRRVS  F+RL +DI FSYFW+RC
Sbjct  136  IVFDDGGSELGL--RVLTVLRLWRLRRVSLLFSRLEKDIHFSYFWIRC  181



>ref|XP_010540568.1| PREDICTED: potassium channel KAT3-like isoform X1 [Tarenaya hassleriana]
Length=643

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 114/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  384  LPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKLY  563
            LPP           +  VISP D RYR WE+W+ +LV YSAWV PFE++FL  K D+ L 
Sbjct  17   LPPSLGGANKAKKLRKHVISPFDPRYRAWESWLTVLVIYSAWVTPFELAFLTCKRDS-LL  75

Query  564  VVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFVA  743
            V+DNIV+ FFA+DI+L FFVAY D  T LL+   KKIA RY+STWF++DV ST PF  + 
Sbjct  76   VLDNIVNTFFAIDIILAFFVAYKDSRTYLLVDDHKKIALRYVSTWFVLDVCSTTPFRALC  135

Query  744  FLF-TGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             +F  G   LG+   VL +LR WRLRRVS  F+RL +DI FSYFW+RC
Sbjct  136  IVFDDGGSELGL--RVLTVLRLWRLRRVSLLFSRLEKDIHFSYFWIRC  181



>gb|KCW81436.1| hypothetical protein EUGRSUZ_C02815 [Eucalyptus grandis]
Length=882

 Score =   179 bits (454),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            +SK ILP LG+        +  +ISP D RYR W++++VLLV Y+AWV PFE  FLE K 
Sbjct  1    MSKGILPSLGARTHRRVKLRQFIISPFDYRYRLWQSFLVLLVFYTAWVSPFEFGFLE-KP  59

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L + DN+V+ FFA+DI+LTFFVAY+D T+ LL+  RKKIA RY++TW   D+ STIP
Sbjct  60   QGPLAITDNVVNGFFAIDIILTFFVAYLDKTSYLLVDDRKKIALRYVTTWLAFDIISTIP  119

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FE V  +          Y +  MLR WRLRRVS+ F RL +D  F+YFWVRC
Sbjct  120  FEVVKSILPSPLE---QYGIFNMLRLWRLRRVSSMFARLEKDKNFNYFWVRC  168



>ref|XP_009403508.1| PREDICTED: potassium channel KAT3 [Musa acuminata subsp. malaccensis]
Length=762

 Score =   178 bits (451),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG++       +  +ISP + RYR W+ +++ LV YSAW+CP+E++FL      KL
Sbjct  33   LLPSLGANINQSVKLRKFIISPYNPRYRAWQIFLIPLVIYSAWICPYELAFLR-HYPAKL  91

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
              V+NI++ FFAVDI+LTFFVAY+D  + LL    KKIA RYLS+WF+ D+ ST PF+ +
Sbjct  92   LWVENILNSFFAVDIILTFFVAYLDRKSYLLTDDPKKIAARYLSSWFIFDILSTAPFQLI  151

Query  741  AFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            +FL     + G+ + +L MLR WRLRR+S+FF+RL +DIRF+YFW RC
Sbjct  152  SFLSDSSVN-GLGFKILNMLRLWRLRRISSFFSRLEKDIRFNYFWTRC  198



>ref|XP_009760491.1| PREDICTED: potassium channel KAT3-like isoform X1 [Nicotiana 
sylvestris]
Length=713

 Score =   177 bits (450),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 116/168 (69%), Gaps = 4/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP D RYR WE ++++LV Y+AW+ PFE +FL+ K+D   
Sbjct  17   LLPSLGTRINHDTKLRKYIISPFDPRYRAWEMFLLILVIYTAWITPFEFAFLKYKIDG-F  75

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             + DNIV+ FFA+DI LTFF+AY+ P + +L+   KKIA RYLSTWF+ DV ST+PF   
Sbjct  76   VIFDNIVNCFFAIDIFLTFFMAYLHPESYILVDDPKKIAIRYLSTWFMFDVCSTVPFH--  133

Query  741  AFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            AFLF   K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW R
Sbjct  134  AFLFIDHKRSDGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTR  181



>gb|ABR16408.1| unknown [Picea sitchensis]
Length=265

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 131/186 (70%), Gaps = 5/186 (3%)
 Frame = +3

Query  339  QEDEDFSLGK----LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSA  506
             E ED S  +     SK  LPPLG+ +    + +  +ISP D+ YRCW T++++LV Y A
Sbjct  22   HEHEDASDHQNFHYFSKVSLPPLGA-RDIRMNLRKYIISPYDTIYRCWNTFLIILVVYCA  80

Query  507  WVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRY  686
            W+ PFE+ F++      L++ D ++D+FFA+DIV+TFFVAY+D  TQ +  + K+IA RY
Sbjct  81   WINPFELGFIDEPKPGALFIADIVIDIFFAIDIVVTFFVAYVDDKTQQIEDNPKRIAVRY  140

Query  687  LSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFS  866
            +STWF+ D+ ST+PF+  +++FTGK   G+ Y++L +LR WRLRRV + FTRL +DIRFS
Sbjct  141  ISTWFIFDITSTVPFQPFSYIFTGKFGSGLSYNLLNLLRLWRLRRVKSLFTRLEKDIRFS  200

Query  867  YFWVRC  884
            YFWVRC
Sbjct  201  YFWVRC  206



>ref|XP_009760492.1| PREDICTED: potassium channel KAT3-like isoform X2 [Nicotiana 
sylvestris]
Length=688

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 116/168 (69%), Gaps = 4/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP D RYR WE ++++LV Y+AW+ PFE +FL+ K+D   
Sbjct  17   LLPSLGTRINHDTKLRKYIISPFDPRYRAWEMFLLILVIYTAWITPFEFAFLKYKIDG-F  75

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             + DNIV+ FFA+DI LTFF+AY+ P + +L+   KKIA RYLSTWF+ DV ST+PF   
Sbjct  76   VIFDNIVNCFFAIDIFLTFFMAYLHPESYILVDDPKKIAIRYLSTWFMFDVCSTVPFH--  133

Query  741  AFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            AFLF   K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW R
Sbjct  134  AFLFIDHKRSDGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTR  181



>ref|XP_009400651.1| PREDICTED: potassium channel AKT1-like [Musa acuminata subsp. 
malaccensis]
Length=890

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 115/178 (65%), Gaps = 4/178 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            D S   LS  ILP LG+        +  ++SP D RYR WET++++LV YSAWV PFE  
Sbjct  18   DGSHYSLSSGILPSLGARSNRRVKLRSSIVSPYDRRYRTWETFLIVLVIYSAWVSPFEFG  77

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            FL++   + L + DNIV+ FFAVDIVLTFFVAY++ TT LL+   KKIA RYL+TWF++D
Sbjct  78   FLDNSKGS-LALADNIVNAFFAVDIVLTFFVAYLNRTTYLLVDDHKKIAVRYLTTWFILD  136

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP E    +          Y    MLR WRLRRVS  F RL +D  F+YFWVRC
Sbjct  137  VASTIPSEIALRILPSSLR---SYGFFNMLRLWRLRRVSALFARLEKDRSFNYFWVRC  191



>ref|XP_002456376.1| hypothetical protein SORBIDRAFT_03g034980 [Sorghum bicolor]
 gb|EES01496.1| hypothetical protein SORBIDRAFT_03g034980 [Sorghum bicolor]
Length=530

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 118/179 (66%), Gaps = 5/179 (3%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSSQPTHTSSQGL---VISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
            S G LS  +LP LG++         L   ++SP D RY+ WE +++LLV YSAW+CP E 
Sbjct  29   SGGNLSGDLLPSLGATAQAQQQPPRLRRNLVSPYDPRYKVWEIFLILLVVYSAWICPLEF  88

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
            +FL   L    ++VD++V+ FFAVDIVLTFFV Y+D  + LL+   KKIA RYLSTWF  
Sbjct  89   AFLRY-LPRAPFIVDDVVNGFFAVDIVLTFFVPYVDSKSYLLVDDHKKIAVRYLSTWFAF  147

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            DV ST PF+ ++ LF  KH  G+    L +LR WRLRRVS+ F RL +DIRF+Y  +RC
Sbjct  148  DVCSTFPFQSISLLFN-KHDHGLGLKFLNVLRLWRLRRVSSMFARLEKDIRFNYAVIRC  205



>gb|ERN03604.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda]
Length=852

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 116/173 (67%), Gaps = 5/173 (3%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS   LP LG+        +  ++SP D RYR WET++++LV YSAWV PFE+ F+ +K 
Sbjct  25   LSSGFLPSLGARSNRMVKLRKFIVSPYDRRYRAWETFLIVLVVYSAWVSPFELGFM-TKA  83

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            +  L V DN+V+ FFA+DI+LTFFVA++D  T LL+   K IA RY+STWF  DVASTIP
Sbjct  84   EGGLLVADNVVNGFFAIDILLTFFVAFLDRRTYLLVDEPKMIAFRYISTWFAFDVASTIP  143

Query  729  FE-FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FE F + LF       +   +L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  144  FELFASRLFRISP---LASGILNMLRLWRLRRVSALFARLEKDIRFNYFWTRC  193



>ref|XP_006841929.2| PREDICTED: potassium channel AKT1 [Amborella trichopoda]
Length=930

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 116/173 (67%), Gaps = 5/173 (3%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS   LP LG+        +  ++SP D RYR WET++++LV YSAWV PFE+ F+ +K 
Sbjct  25   LSSGFLPSLGARSNRMVKLRKFIVSPYDRRYRAWETFLIVLVVYSAWVSPFELGFM-TKA  83

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
            +  L V DN+V+ FFA+DI+LTFFVA++D  T LL+   K IA RY+STWF  DVASTIP
Sbjct  84   EGGLLVADNVVNGFFAIDILLTFFVAFLDRRTYLLVDEPKMIAFRYISTWFAFDVASTIP  143

Query  729  FE-FVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            FE F + LF       +   +L MLR WRLRRVS  F RL +DIRF+YFW RC
Sbjct  144  FELFASRLFRISP---LASGILNMLRLWRLRRVSALFARLEKDIRFNYFWTRC  193



>ref|XP_009616641.1| PREDICTED: potassium channel KAT3 isoform X2 [Nicotiana tomentosiformis]
Length=698

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP D RYR WE ++++LV Y+AW+ PFE +FL+ K+D   
Sbjct  17   LLPSLGTRINHDTKLRKYIISPFDPRYRAWEMFLLILVIYTAWITPFEFAFLKYKIDG-F  75

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             + DNIV+  FA+DI LTFF+AY+ P + +L+   KKIA RYLSTWF+ DV ST+PF   
Sbjct  76   VIFDNIVNCLFAIDIFLTFFMAYLHPESYILVDDPKKIAIRYLSTWFMFDVCSTVPFH--  133

Query  741  AFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            AFLF   K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW R
Sbjct  134  AFLFIDHKKSDGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTR  181



>ref|XP_009616640.1| PREDICTED: potassium channel KAT3 isoform X1 [Nicotiana tomentosiformis]
Length=709

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%), Gaps = 4/168 (2%)
 Frame = +3

Query  381  ILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKLDTKL  560
            +LP LG+     T  +  +ISP D RYR WE ++++LV Y+AW+ PFE +FL+ K+D   
Sbjct  17   LLPSLGTRINHDTKLRKYIISPFDPRYRAWEMFLLILVIYTAWITPFEFAFLKYKIDG-F  75

Query  561  YVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIPFEFV  740
             + DNIV+  FA+DI LTFF+AY+ P + +L+   KKIA RYLSTWF+ DV ST+PF   
Sbjct  76   VIFDNIVNCLFAIDIFLTFFMAYLHPESYILVDDPKKIAIRYLSTWFMFDVCSTVPFH--  133

Query  741  AFLFTG-KHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            AFLF   K   GV + +L MLR WRLRRVS  F RL +DIRF+YFW R
Sbjct  134  AFLFIDHKKSDGVGFKLLSMLRLWRLRRVSALFARLEKDIRFNYFWTR  181



>ref|XP_010047933.1| PREDICTED: potassium channel AKT1-like isoform X2 [Eucalyptus 
grandis]
Length=515

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             D S   LS  ILP LG+        +  ++SP D  YRCWET +V+LVAY+AWV PFE 
Sbjct  28   RDGSHYSLSTSILPSLGARSSRRIKLRRFIVSPYDRYYRCWETLLVVLVAYTAWVSPFEF  87

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
             FL       L ++DNIV+ FFA+DI+LTFFVAY+D TT LL+ + KKIA +Y +TWF  
Sbjct  88   GFLRDP-AIALSIIDNIVNAFFAIDIILTFFVAYLDKTTYLLVDNPKKIAWKYTTTWFAF  146

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            D+ STIP E    +F    +    Y +  MLR WRLRRVS  F+RL +D  ++YFWVRC
Sbjct  147  DLISTIPSELARKIFPSNFN---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRC  202



>ref|XP_012077507.1| PREDICTED: potassium channel AKT6-like [Jatropha curcas]
Length=869

 Score =   176 bits (446),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 119/189 (63%), Gaps = 11/189 (6%)
 Frame = +3

Query  339  QEDEDFSLGKLSKF-----ILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVA  497
            +E E FS    S F     ILP LG++  +      +  ++SP+DSRYR WET++V LV 
Sbjct  6    KEMEQFSRDDRSHFSLTGEILPSLGATARSGRRIILRRFIVSPLDSRYRTWETFLVFLVF  65

Query  498  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  677
            Y+AW  PFE  FLE    T +  +DN+V+ FFAVDIVLTFFVAY+D +T LL+  R KIA
Sbjct  66   YTAWASPFEFGFLEKPAGT-IAAIDNVVNAFFAVDIVLTFFVAYLDKSTYLLVDDRNKIA  124

Query  678  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDI  857
             RY  TW ++DV STIP E +  +   +      Y    MLR WRLRRVS FF+RL +D 
Sbjct  125  LRYAKTWLILDVISTIPSELIRSMLPNRLQ---SYGYFSMLRLWRLRRVSKFFSRLEKDR  181

Query  858  RFSYFWVRC  884
             +SYFW+RC
Sbjct  182  NYSYFWIRC  190



>gb|KDP33617.1| hypothetical protein JCGZ_07188 [Jatropha curcas]
Length=889

 Score =   176 bits (445),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 119/189 (63%), Gaps = 11/189 (6%)
 Frame = +3

Query  339  QEDEDFSLGKLSKF-----ILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVA  497
            +E E FS    S F     ILP LG++  +      +  ++SP+DSRYR WET++V LV 
Sbjct  26   KEMEQFSRDDRSHFSLTGEILPSLGATARSGRRIILRRFIVSPLDSRYRTWETFLVFLVF  85

Query  498  YSAWVCPFEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIA  677
            Y+AW  PFE  FLE    T +  +DN+V+ FFAVDIVLTFFVAY+D +T LL+  R KIA
Sbjct  86   YTAWASPFEFGFLEKPAGT-IAAIDNVVNAFFAVDIVLTFFVAYLDKSTYLLVDDRNKIA  144

Query  678  TRYLSTWFLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDI  857
             RY  TW ++DV STIP E +  +   +      Y    MLR WRLRRVS FF+RL +D 
Sbjct  145  LRYAKTWLILDVISTIPSELIRSMLPNRLQ---SYGYFSMLRLWRLRRVSKFFSRLEKDR  201

Query  858  RFSYFWVRC  884
             +SYFW+RC
Sbjct  202  NYSYFWIRC  210



>ref|XP_010047780.1| PREDICTED: potassium channel AKT1-like isoform X2 [Eucalyptus 
grandis]
Length=515

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             D S   LS  ILP LG+        +  ++SP D  YRCWET +V+LVAY+AWV PFE 
Sbjct  28   RDGSHYSLSTSILPSLGARSSRRIKLRRFIVSPYDRYYRCWETLLVVLVAYTAWVSPFEF  87

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
             FL       L ++DN+V+ FFA+DI+LTFFVAY+D TT LL+ + KKIA +Y +TWF  
Sbjct  88   GFLRDP-AIALSIIDNVVNAFFAIDIILTFFVAYLDKTTYLLVDNPKKIAWKYTTTWFAF  146

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            D+ STIP E    +F    +    Y +  MLR WRLRRVS  F+RL +D  ++YFWVRC
Sbjct  147  DLISTIPSELARKIFPSNFN---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRC  202



>gb|AAF81249.1|AF267753_1 putative potassium channel protein Mkt1p [Mesembryanthemum crystallinum]
Length=870

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 5/172 (3%)
 Frame = +3

Query  369  LSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISFLESKL  548
            LS  +LP LG+        +  +ISP DSRYR WET+++LLV Y+AWV PFE  FL+  +
Sbjct  32   LSNGLLPSLGARSNRRVILRRFIISPFDSRYRWWETFLILLVFYTAWVSPFEFGFLKKPI  91

Query  549  DTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDVASTIP  728
               L + DNIV+ FFAVDI+LTFFVA++DP T LL+ ++KKI+ RY+ TWFL DV ST+P
Sbjct  92   KV-LAITDNIVNGFFAVDIILTFFVAFLDPQTYLLVDNQKKISWRYIRTWFLFDVISTVP  150

Query  729  FEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             E V  +F         Y +  MLR WRLRRVS  FTRL +D   SYF VRC
Sbjct  151  SELVEKMFPSMQ----VYGLFNMLRLWRLRRVSKMFTRLEKDRNISYFLVRC  198



>gb|KCW79762.1| hypothetical protein EUGRSUZ_C011051, partial [Eucalyptus grandis]
Length=591

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = +3

Query  348  EDFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEI  527
             D S   LS  ILP LG+        +  ++SP D  YRCWET +V+LVAY+AWV PFE 
Sbjct  28   RDGSHYSLSTSILPSLGARSSRRIKLRRFIVSPYDRYYRCWETLLVVLVAYTAWVSPFEF  87

Query  528  SFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLM  707
             FL       L ++DN+V+ FFA+DI+LTFFVAY+D TT LL+ + KKIA +Y +TWF  
Sbjct  88   GFLRDPA-IALSIIDNVVNAFFAIDIILTFFVAYLDKTTYLLVDNPKKIAWKYTTTWFAF  146

Query  708  DVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            D+ STIP E    +F    +    Y +  MLR WRLRRVS  F+RL +D  ++YFWVRC
Sbjct  147  DLISTIPSELARKIFPSNFN---SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRC  202



>ref|XP_010419342.1| PREDICTED: potassium channel AKT6-like [Camelina sativa]
Length=829

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 115/182 (63%), Gaps = 6/182 (3%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            D   S   LSK +LPPLG+S  +      +  ++SP D RYR WET++V LV Y+AW  P
Sbjct  36   DGTMSQYSLSKGLLPPLGASARSSRDVILRRFIVSPFDPRYRAWETFLVFLVLYTAWASP  95

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   KKIA RY STW
Sbjct  96   FEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKKIAWRYTSTW  154

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
               DV ST P+E    L    H     Y +  MLR WRLRRVSN F RL +D ++SYFWV
Sbjct  155  LAFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWV  211

Query  879  RC  884
            RC
Sbjct  212  RC  213



>tpg|DAA58342.1| TPA: potassium channel 1 [Zea mays]
Length=790

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 113/178 (63%), Gaps = 4/178 (2%)
 Frame = +3

Query  351  DFSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEIS  530
            D S   +S  ILP LG+        +  ++SP D RYRCWET++++LV YSAWV PFE  
Sbjct  28   DGSHYSISSGILPSLGARSNRRAKLRPFIVSPYDRRYRCWETFLIILVIYSAWVSPFEFG  87

Query  531  FLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMD  710
            F+  K    L  VDN+V+ FFAVDI+LTFFVAY+D  T LL    K+IA RY ++WF++D
Sbjct  88   FIR-KPAGALAAVDNVVNAFFAVDIILTFFVAYLDRMTYLLEDDPKRIAWRYTTSWFILD  146

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
            VASTIP EF   +          Y    MLR WRLRRVS+ F RL +D  F+YFWVRC
Sbjct  147  VASTIPSEFARKILPPNLR---SYGFFNMLRLWRLRRVSSLFARLEKDRHFNYFWVRC  201



>ref|XP_004970003.1| PREDICTED: potassium channel KAT3-like isoform X1 [Setaria italica]
Length=505

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 120/178 (67%), Gaps = 4/178 (2%)
 Frame = +3

Query  354  FSLGKLSKFILPPLGSSQPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            FS   L+  +LP LG++       +  ++SP D RY+ WE +++LLV YSAW+CP E +F
Sbjct  26   FSGRNLAGDLLPSLGATTQQPPKLRKYLVSPYDPRYKVWEIFLILLVVYSAWICPLEFAF  85

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTWFLMDV  713
            L   L    +VVD++V+ FFAVDIVLTFFV Y+D  + LL+   KKIA RYLS+WF+ DV
Sbjct  86   LR-YLPRAPFVVDDVVNGFFAVDIVLTFFVPYVDSKSHLLVDDPKKIAARYLSSWFVFDV  144

Query  714  ASTIPFEFVAFLFT-GKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVRC  884
             ST PF  ++ LF   +H LG+ +  L +LR WRLRRVS+ F RL +DIRF+Y  +RC
Sbjct  145  CSTFPFHSISLLFNRHEHSLGLKF--LNVLRLWRLRRVSSLFARLEKDIRFNYAVIRC  200



>ref|XP_010429557.1| PREDICTED: potassium channel AKT6 [Camelina sativa]
Length=888

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 115/182 (63%), Gaps = 6/182 (3%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            D   S   LSK +LPPLG+S  +      +  ++SP D RYR WET++V LV Y+AW  P
Sbjct  36   DGTMSQYSLSKGLLPPLGASARSSRDVILRRFIVSPFDPRYRAWETFLVFLVLYTAWASP  95

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   KKIA RY STW
Sbjct  96   FEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKKIAWRYTSTW  154

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
               DV ST P+E    L    H     Y +  MLR WRLRRVSN F RL +D ++SYFWV
Sbjct  155  LAFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWV  211

Query  879  RC  884
            RC
Sbjct  212  RC  213



>ref|XP_010423759.1| PREDICTED: potassium channel AKT6 [Camelina sativa]
Length=887

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 115/182 (63%), Gaps = 6/182 (3%)
 Frame = +3

Query  345  DEDFSLGKLSKFILPPLGSSQPTHTSS--QGLVISPMDSRYRCWETWMVLLVAYSAWVCP  518
            D   S   LSK +LPPLG+S  +      +  ++SP D RYR WET++V LV Y+AW  P
Sbjct  36   DGTMSQYSLSKGLLPPLGASARSSRDVILRRFIVSPFDPRYRAWETFLVFLVLYTAWASP  95

Query  519  FEISFLESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLSTW  698
            FE  FL+ K    L ++DNIV+ FFAVDI+LTFFVA++D  T LLI   KKIA RY STW
Sbjct  96   FEFGFLQ-KPRAPLSILDNIVNGFFAVDIILTFFVAFLDKVTYLLIDDPKKIAWRYTSTW  154

Query  699  FLMDVASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWV  878
               DV ST P+E    L    H     Y +  MLR WRLRRVSN F RL +D ++SYFWV
Sbjct  155  LAFDVVSTFPYESFGSLL---HESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWV  211

Query  879  RC  884
            RC
Sbjct  212  RC  213



>ref|XP_004136462.1| PREDICTED: potassium channel KAT3 [Cucumis sativus]
 gb|KGN60142.1| hypothetical protein Csa_3G881060 [Cucumis sativus]
Length=632

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = +3

Query  357  SLGKLSKFILPPLGSS-QPTHTSSQGLVISPMDSRYRCWETWMVLLVAYSAWVCPFEISF  533
            +L  +S  +LP  G+     +T     VI P D RYR W+T++V+LV YSAWV PFE++F
Sbjct  26   NLTSVSSSLLPAFGTVVNDGYTHLNKFVIVPYDRRYRWWQTFLVVLVVYSAWVSPFELAF  85

Query  534  LESKLDTKLYVVDNIVDLFFAVDIVLTFFVAYIDPTTQLLIHHRKKIATRYLST-WFLMD  710
             +    + L  VD +VD FFA+DIVLTFFVAY+D  T LL+ + KKIA RYL++  F MD
Sbjct  86   KKVATGS-LLPVDLVVDAFFAIDIVLTFFVAYLDKGTYLLVDNHKKIALRYLTSLGFPMD  144

Query  711  VASTIPFEFVAFLFTGKHHLGVCYSVLGMLRFWRLRRVSNFFTRLXEDIRFSYFWVR  881
            VAST+PF+ +  +FTG+ H    +  L +LRFWRLRRVS  FTRL +DIRFSYF+ R
Sbjct  145  VASTLPFQVIYRIFTGRMHRSEAFGFLNLLRFWRLRRVSQLFTRLEKDIRFSYFYTR  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2018536237851