BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4611

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365150.1|  PREDICTED: BTB/POZ domain-containing protein...    175   1e-47   Solanum tuberosum [potatoes]
ref|XP_004251284.1|  PREDICTED: BTB/POZ domain-containing protein...    174   2e-47   Solanum lycopersicum
ref|XP_002281741.1|  PREDICTED: BTB/POZ domain-containing protein...    171   5e-46   Vitis vinifera
ref|XP_009610322.1|  PREDICTED: BTB/POZ domain-containing protein...    169   1e-45   Nicotiana tomentosiformis
ref|XP_009774422.1|  PREDICTED: BTB/POZ domain-containing protein...    169   2e-45   Nicotiana sylvestris
ref|XP_010260115.1|  PREDICTED: BTB/POZ domain-containing protein...    168   9e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010112313.1|  hypothetical protein L484_011179                   144   9e-39   
emb|CDP08962.1|  unnamed protein product                                147   2e-37   Coffea canephora [robusta coffee]
ref|XP_010685873.1|  PREDICTED: BTB/POZ domain-containing protein...    141   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008222552.1|  PREDICTED: BTB/POZ domain-containing protein...    138   3e-34   Prunus mume [ume]
ref|XP_009354521.1|  PREDICTED: BTB/POZ domain-containing protein...    136   2e-33   Pyrus x bretschneideri [bai li]
gb|EYU18898.1|  hypothetical protein MIMGU_mgv1a005394mg                135   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_004294641.1|  PREDICTED: BTB/POZ domain-containing protein...    134   6e-33   Fragaria vesca subsp. vesca
gb|KHG07032.1|  hypothetical protein F383_02815                         134   7e-33   Gossypium arboreum [tree cotton]
gb|KJB20225.1|  hypothetical protein B456_003G139200                    133   2e-32   Gossypium raimondii
ref|XP_008349723.1|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-32   Malus domestica [apple tree]
ref|XP_010043649.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    132   5e-32   
gb|KCW85653.1|  hypothetical protein EUGRSUZ_B02440                     131   8e-32   Eucalyptus grandis [rose gum]
ref|XP_011089383.1|  PREDICTED: BTB/POZ domain-containing protein...    131   9e-32   
gb|KJB08821.1|  hypothetical protein B456_001G105900                    129   3e-31   Gossypium raimondii
ref|XP_008358075.1|  PREDICTED: BTB/POZ domain-containing protein...    129   6e-31   
gb|KHG05277.1|  hypothetical protein F383_30980                         127   1e-30   Gossypium arboreum [tree cotton]
ref|XP_007016614.1|  BTB/POZ domain-containing protein                  127   2e-30   
ref|XP_010520319.1|  PREDICTED: BTB/POZ domain-containing protein...    124   2e-29   Tarenaya hassleriana [spider flower]
ref|XP_007205061.1|  hypothetical protein PRUPE_ppa004481mg             120   5e-28   
gb|KHN05697.1|  BTB/POZ domain-containing protein                       118   2e-27   Glycine soja [wild soybean]
ref|XP_003540755.1|  PREDICTED: BTB/POZ domain-containing protein...    118   2e-27   Glycine max [soybeans]
gb|EPS62176.1|  hypothetical protein M569_12618                         116   2e-26   Genlisea aurea
ref|XP_004505925.1|  PREDICTED: BTB/POZ domain-containing protein...    115   3e-26   Cicer arietinum [garbanzo]
ref|XP_002531830.1|  protein binding protein, putative                  115   5e-26   Ricinus communis
ref|XP_007132142.1|  hypothetical protein PHAVU_011G070200g             115   5e-26   Phaseolus vulgaris [French bean]
ref|XP_006591005.1|  PREDICTED: BTB/POZ domain-containing protein...    114   6e-26   Glycine max [soybeans]
ref|XP_009126626.1|  PREDICTED: BTB/POZ domain-containing protein...    114   8e-26   Brassica rapa
emb|CDY09229.1|  BnaA02g06550D                                          114   9e-26   Brassica napus [oilseed rape]
ref|NP_200813.1|  BTB/POZ domain-containing protein                     112   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866364.1|  hypothetical protein ARALYDRAFT_358221             112   5e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_012064931.1|  PREDICTED: BTB/POZ domain-containing protein...    111   9e-25   Jatropha curcas
ref|XP_006281633.1|  hypothetical protein CARUB_v10027763mg             110   2e-24   Capsella rubella
ref|XP_010483651.1|  PREDICTED: BTB/POZ domain-containing protein...    110   2e-24   Camelina sativa [gold-of-pleasure]
gb|KDO73042.1|  hypothetical protein CISIN_1g010024mg                   110   2e-24   Citrus sinensis [apfelsine]
ref|XP_006424700.1|  hypothetical protein CICLE_v10028213mg             110   2e-24   Citrus clementina [clementine]
ref|XP_010455877.1|  PREDICTED: BTB/POZ domain-containing protein...    109   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010443796.1|  PREDICTED: BTB/POZ domain-containing protein...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006400887.1|  hypothetical protein EUTSA_v10013333mg             107   4e-23   Eutrema salsugineum [saltwater cress]
gb|AES88747.2|  BTB/POZ domain plant protein                            105   1e-22   Medicago truncatula
ref|XP_006419001.1|  hypothetical protein EUTSA_v10002519mg             105   1e-22   
ref|XP_003606550.1|  hypothetical protein MTR_4g061670                  105   2e-22   
ref|XP_002299517.2|  hypothetical protein POPTR_0001s09710g             105   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009398931.1|  PREDICTED: BTB/POZ domain-containing protein...    103   8e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012086844.1|  PREDICTED: BTB/POZ domain-containing protein...    101   1e-21   
ref|XP_011015247.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Populus euphratica
ref|XP_011015245.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Populus euphratica
gb|AAR14275.1|  predicted protein                                       102   2e-21   Populus tremula x Populus alba [gray poplar]
ref|XP_010255266.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002303602.2|  hypothetical protein POPTR_0003s13090g             102   4e-21   
ref|XP_011029330.1|  PREDICTED: BTB/POZ domain-containing protein...    102   4e-21   Populus euphratica
ref|XP_011022633.1|  PREDICTED: BTB/POZ domain-containing protein...    101   6e-21   Populus euphratica
ref|XP_012086845.1|  PREDICTED: BTB/POZ domain-containing protein...    100   8e-21   
ref|XP_009628159.1|  PREDICTED: BTB/POZ domain-containing protein...    101   9e-21   Nicotiana tomentosiformis
ref|XP_008807229.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   Phoenix dactylifera
gb|KDP25402.1|  hypothetical protein JCGZ_20558                         100   2e-20   Jatropha curcas
ref|XP_009800799.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   Nicotiana sylvestris
emb|CDP12055.1|  unnamed protein product                              99.4    4e-20   Coffea canephora [robusta coffee]
ref|XP_008776124.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    4e-20   
ref|XP_008776113.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    4e-20   
ref|XP_009389780.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007040317.1|  BTB/POZ domain-containing protein isoform 3      98.2    8e-20   
ref|XP_007040315.1|  BTB/POZ domain-containing protein isoform 1      97.8    1e-19   
ref|XP_011005022.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    2e-19   Populus euphratica
ref|XP_006829095.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    2e-19   
gb|EYU40075.1|  hypothetical protein MIMGU_mgv1a002655mg              97.1    3e-19   Erythranthe guttata [common monkey flower]
ref|XP_008783441.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    3e-19   Phoenix dactylifera
ref|XP_011080923.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    3e-19   
gb|KEH21112.1|  BTB/POZ domain plant protein                          95.9    5e-19   Medicago truncatula
emb|CBI34370.3|  unnamed protein product                              95.5    6e-19   Vitis vinifera
ref|XP_002298385.2|  hypothetical protein POPTR_0001s24050g           95.1    6e-19   Populus trichocarpa [western balsam poplar]
gb|KJB37507.1|  hypothetical protein B456_006G208800                  95.5    7e-19   Gossypium raimondii
ref|XP_010069058.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    7e-19   Eucalyptus grandis [rose gum]
ref|XP_002279382.2|  PREDICTED: BTB/POZ domain-containing protein...  95.9    7e-19   Vitis vinifera
ref|XP_011073126.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  95.5    8e-19   Sesamum indicum [beniseed]
ref|XP_010069057.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    8e-19   Eucalyptus grandis [rose gum]
ref|XP_006343947.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    1e-18   Solanum tuberosum [potatoes]
ref|XP_010058250.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  94.0    2e-18   
ref|XP_004503685.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    2e-18   Cicer arietinum [garbanzo]
ref|XP_004245578.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    2e-18   Solanum lycopersicum
gb|KHG15549.1|  hypothetical protein F383_06896                       94.0    3e-18   Gossypium arboreum [tree cotton]
ref|XP_010933990.1|  PREDICTED: BTB/POZ domain-containing protein...  94.0    3e-18   Elaeis guineensis
ref|XP_008437316.1|  PREDICTED: BTB/POZ domain-containing protein...  93.6    4e-18   Cucumis melo [Oriental melon]
ref|XP_009400477.1|  PREDICTED: BTB/POZ domain-containing protein...  93.6    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010089067.1|  BTB/POZ domain-containing protein                92.0    4e-18   
ref|XP_004143891.2|  PREDICTED: BTB/POZ domain-containing protein...  93.6    4e-18   Cucumis sativus [cucumbers]
gb|KJB52168.1|  hypothetical protein B456_008G248700                  93.2    5e-18   Gossypium raimondii
ref|XP_007160095.1|  hypothetical protein PHAVU_002G291900g           93.2    5e-18   Phaseolus vulgaris [French bean]
ref|XP_003532421.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    5e-18   Glycine max [soybeans]
gb|KHG02986.1|  hypothetical protein F383_23864                       92.8    6e-18   Gossypium arboreum [tree cotton]
ref|XP_006476518.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    1e-17   Citrus sinensis [apfelsine]
gb|AIB05883.1|  TRAF transcription factor                             91.7    1e-17   Zea mays [maize]
ref|NP_001053645.1|  Os04g0579700                                     91.3    1e-17   
gb|AFW59116.1|  hypothetical protein ZEAMMB73_743291                  91.7    1e-17   
ref|NP_001169621.1|  uncharacterized protein LOC100383502             91.3    1e-17   Zea mays [maize]
ref|XP_008238939.1|  PREDICTED: BTB/POZ domain-containing protein...  91.3    2e-17   Prunus mume [ume]
ref|XP_001751363.1|  predicted protein                                90.1    2e-17   
ref|XP_007210316.1|  hypothetical protein PRUPE_ppa002210mg           91.3    3e-17   
gb|KHG01374.1|  hypothetical protein F383_23678                       90.5    4e-17   Gossypium arboreum [tree cotton]
gb|KCW72192.1|  hypothetical protein EUGRSUZ_E00642                   89.0    4e-17   Eucalyptus grandis [rose gum]
ref|XP_006652685.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    5e-17   
ref|XP_010233737.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    7e-17   Brachypodium distachyon [annual false brome]
ref|XP_003524451.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    7e-17   Glycine max [soybeans]
ref|XP_006355468.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    8e-17   Solanum tuberosum [potatoes]
ref|XP_010919095.1|  PREDICTED: BTB/POZ domain-containing protein...  89.0    1e-16   Elaeis guineensis
ref|XP_002531214.1|  protein binding protein, putative                88.2    1e-16   Ricinus communis
ref|XP_009112778.1|  PREDICTED: BTB/POZ domain-containing protein...  88.6    1e-16   Brassica rapa
emb|CDY38217.1|  BnaA09g11720D                                        88.6    2e-16   Brassica napus [oilseed rape]
gb|KHN16799.1|  BTB/POZ domain-containing protein                     87.4    2e-16   Glycine soja [wild soybean]
ref|XP_004976580.1|  PREDICTED: BTB/POZ domain-containing protein...  88.2    2e-16   
dbj|BAJ96039.1|  predicted protein                                    88.2    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY08328.1|  BnaC09g12680D                                        88.2    2e-16   Brassica napus [oilseed rape]
gb|KDO76298.1|  hypothetical protein CISIN_1g006210mg                 88.2    2e-16   Citrus sinensis [apfelsine]
ref|XP_010922477.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-16   
gb|KJB20610.1|  hypothetical protein B456_003G156100                  88.2    2e-16   Gossypium raimondii
ref|XP_006439497.1|  hypothetical protein CICLE_v10019226mg           88.2    3e-16   Citrus clementina [clementine]
ref|XP_004300808.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    4e-16   Fragaria vesca subsp. vesca
ref|XP_002446981.1|  hypothetical protein SORBIDRAFT_06g026230        87.4    4e-16   
ref|XP_008783774.1|  PREDICTED: BTB/POZ domain-containing protein...  87.0    4e-16   Phoenix dactylifera
ref|XP_009341340.1|  PREDICTED: BTB/POZ domain-containing protein...  87.4    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_010555851.1|  PREDICTED: BTB/POZ domain-containing protein...  86.7    7e-16   Tarenaya hassleriana [spider flower]
ref|XP_009419272.1|  PREDICTED: BTB/POZ domain-containing protein...  86.3    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69450.1|  hypothetical protein M569_05314                       86.3    8e-16   Genlisea aurea
gb|KFK38021.1|  hypothetical protein AALP_AA3G059800                  86.3    9e-16   Arabis alpina [alpine rockcress]
gb|AAZ68003.1|  At5g63850-like protein                                83.2    1e-15   Arabidopsis lyrata [lyrate rockcress]
ref|XP_001762013.1|  predicted protein                                85.5    1e-15   
ref|XP_002974611.1|  hypothetical protein SELMODRAFT_271097           85.5    1e-15   
ref|XP_009397488.1|  PREDICTED: BTB/POZ domain-containing protein...  85.5    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002963321.1|  hypothetical protein SELMODRAFT_270367           85.1    1e-15   
ref|XP_002887934.1|  hypothetical protein ARALYDRAFT_315042           85.5    2e-15   Arabidopsis lyrata subsp. lyrata
gb|AAZ67992.1|  At5g63850                                             82.4    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ67986.1|  At5g63850                                             82.4    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009363413.1|  PREDICTED: BTB/POZ domain-containing protein...  85.5    2e-15   Pyrus x bretschneideri [bai li]
gb|AAZ67998.1|  At5g63850                                             82.4    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KJB24321.1|  hypothetical protein B456_004G139400                  84.7    2e-15   Gossypium raimondii
ref|XP_010676445.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    4e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT26347.1|  hypothetical protein F775_16772                       83.6    5e-15   
ref|XP_010430498.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010418426.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    5e-15   Camelina sativa [gold-of-pleasure]
ref|NP_176570.1|  BTB/POZ domain-containing protein                   84.0    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302105.1|  hypothetical protein CARUB_v10020096mg           83.6    6e-15   Capsella rubella
ref|XP_010473631.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006828235.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    1e-14   Amborella trichopoda
ref|XP_002875751.1|  predicted protein                                77.0    3e-14   Arabidopsis lyrata subsp. lyrata
gb|AAZ68001.1|  At5g63850                                             77.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008665486.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    1e-13   Zea mays [maize]
ref|XP_002522395.1|  protein binding protein, putative                78.2    4e-13   Ricinus communis
dbj|BAK06120.1|  predicted protein                                    77.4    6e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006391703.1|  hypothetical protein EUTSA_v10023392mg           77.4    7e-13   Eutrema salsugineum [saltwater cress]
ref|XP_004981619.1|  PREDICTED: BTB/POZ domain-containing protein...  77.0    8e-13   
ref|XP_007203630.1|  hypothetical protein PRUPE_ppa003965mg           77.0    1e-12   Prunus persica
ref|XP_008241873.1|  PREDICTED: BTB/POZ domain-containing protein...  76.6    1e-12   Prunus mume [ume]
gb|EAY91984.1|  hypothetical protein OsI_13674                        76.3    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001051395.1|  Os03g0769400                                     75.9    2e-12   
ref|XP_008808898.1|  PREDICTED: BTB/POZ domain-containing protein...  75.9    2e-12   Phoenix dactylifera
ref|XP_008338977.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  75.5    3e-12   
ref|XP_002990647.1|  hypothetical protein SELMODRAFT_185507           75.5    3e-12   
ref|XP_010941741.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-12   Elaeis guineensis
ref|XP_002968764.1|  hypothetical protein SELMODRAFT_90136            75.1    3e-12   
gb|EMT31851.1|  hypothetical protein F775_21356                       75.1    4e-12   
ref|NP_001058798.2|  Os07g0123500                                     74.7    5e-12   
ref|XP_009376454.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_010243288.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009419041.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650658.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    7e-12   Oryza brachyantha
ref|XP_008338182.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-11   
ref|XP_008797004.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-11   Phoenix dactylifera
ref|XP_003548003.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    1e-11   Glycine max [soybeans]
ref|XP_012079112.1|  PREDICTED: BTB/POZ domain-containing protein...  73.2    2e-11   Jatropha curcas
ref|XP_002307226.1|  hypothetical protein POPTR_0005s13800g           73.2    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003517262.1|  PREDICTED: BTB/POZ domain-containing protein...  72.8    2e-11   
gb|KHN36167.1|  BTB/POZ domain-containing protein                     72.8    2e-11   Glycine soja [wild soybean]
ref|XP_009407677.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002310195.1|  hypothetical protein POPTR_0007s12160g           72.4    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009379165.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_007156873.1|  hypothetical protein PHAVU_002G024700g           72.4    3e-11   Phaseolus vulgaris [French bean]
ref|XP_009407431.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025688.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-11   Populus euphratica
ref|XP_002461387.1|  hypothetical protein SORBIDRAFT_02g001910        72.0    4e-11   Sorghum bicolor [broomcorn]
ref|XP_007156002.1|  hypothetical protein PHAVU_003G250400g           72.0    5e-11   Phaseolus vulgaris [French bean]
ref|XP_009388509.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007047072.1|  Cell division protease ftsH isoform 1            71.6    6e-11   
ref|XP_006657417.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    6e-11   Oryza brachyantha
ref|XP_004955396.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    7e-11   Setaria italica
ref|XP_003558813.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    8e-11   Brachypodium distachyon [annual false brome]
gb|KHN44517.1|  BTB/POZ domain-containing protein                     70.5    9e-11   Glycine soja [wild soybean]
ref|XP_010547478.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   
gb|AAX19868.1|  unknown                                               67.8    1e-10   Doryanthes excelsa
emb|CDP02424.1|  unnamed protein product                              70.5    1e-10   Coffea canephora [robusta coffee]
ref|XP_008440171.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Cucumis melo [Oriental melon]
ref|XP_002275454.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Vitis vinifera
ref|XP_004300583.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Fragaria vesca subsp. vesca
ref|XP_003557600.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_011657811.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Cucumis sativus [cucumbers]
ref|NP_001168062.1|  hypothetical protein                             70.1    2e-10   Zea mays [maize]
gb|KHN42029.1|  BTB/POZ domain-containing protein                     70.1    2e-10   Glycine soja [wild soybean]
ref|XP_003537445.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    2e-10   Glycine max [soybeans]
dbj|BAJ95813.1|  predicted protein                                    70.1    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT14102.1|  hypothetical protein F775_07870                       69.7    2e-10   
gb|KHN00573.1|  BTB/POZ domain-containing protein                     69.3    2e-10   Glycine soja [wild soybean]
ref|XP_010254985.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    3e-10   Nelumbo nucifera [Indian lotus]
gb|KEH20448.1|  BTB/POZ domain plant protein                          69.3    3e-10   Medicago truncatula
ref|XP_004509225.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    4e-10   Cicer arietinum [garbanzo]
ref|XP_009115752.1|  PREDICTED: BTB/POZ domain-containing protein...  68.6    4e-10   
ref|XP_011099262.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    4e-10   
gb|KFK34324.1|  hypothetical protein AALP_AA5G130100                  68.6    5e-10   Arabis alpina [alpine rockcress]
gb|EMS65337.1|  hypothetical protein TRIUR3_32744                     68.6    5e-10   Triticum urartu
gb|EYU39382.1|  hypothetical protein MIMGU_mgv1a003833mg              68.6    6e-10   Erythranthe guttata [common monkey flower]
ref|XP_011009912.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    6e-10   Populus euphratica
ref|XP_006466699.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    7e-10   Citrus sinensis [apfelsine]
ref|XP_006290909.1|  hypothetical protein CARUB_v10017022mg           68.2    8e-10   Capsella rubella
gb|KJB17837.1|  hypothetical protein B456_003G018200                  67.8    9e-10   Gossypium raimondii
ref|XP_010941924.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    1e-09   Elaeis guineensis
gb|KDO79424.1|  hypothetical protein CISIN_1g014635mg                 67.4    1e-09   Citrus sinensis [apfelsine]
ref|XP_010558026.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_010426621.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010503746.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006419030.1|  hypothetical protein EUTSA_v10003115mg           67.0    2e-09   
ref|XP_010515449.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008661718.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   
ref|XP_010680938.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006404002.1|  hypothetical protein EUTSA_v10010286mg           67.0    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_002877770.1|  hypothetical protein ARALYDRAFT_323639           67.0    2e-09   Arabidopsis lyrata subsp. lyrata
emb|CDX77944.1|  BnaA09g31390D                                        67.0    2e-09   
ref|XP_010029862.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    2e-09   
ref|XP_009397738.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    2e-09   
ref|NP_190647.1|  uncharacterized protein                             66.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KHG25971.1|  hypothetical protein F383_06642                       66.2    3e-09   Gossypium arboreum [tree cotton]
ref|XP_009776607.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    3e-09   Nicotiana sylvestris
ref|XP_009629328.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    4e-09   Nicotiana tomentosiformis
ref|XP_006338266.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    5e-09   Solanum tuberosum [potatoes]
ref|XP_004232086.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    7e-09   Solanum lycopersicum
ref|XP_011085536.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    7e-09   Sesamum indicum [beniseed]
ref|XP_006664162.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    1e-08   Oryza brachyantha
gb|ACR38622.1|  unknown                                               62.4    5e-08   Zea mays [maize]
ref|XP_006856144.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    8e-08   Amborella trichopoda
ref|XP_004963062.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   Setaria italica
gb|KFK27540.1|  hypothetical protein AALP_AA8G396600                  61.2    1e-07   Arabis alpina [alpine rockcress]
gb|ABG22069.1|  expressed protein                                     61.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE53535.1|  hypothetical protein OsJ_36742                        61.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99196.2|  expressed protein                                     60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDY31013.1|  BnaC04g24110D                                        60.5    2e-07   Brassica napus [oilseed rape]
ref|XP_010097900.1|  BTB/POZ domain-containing protein                60.5    3e-07   Morus notabilis
ref|XP_002452861.1|  hypothetical protein SORBIDRAFT_04g033760        52.8    5e-05   
ref|XP_002442447.1|  hypothetical protein SORBIDRAFT_08g020150        53.5    6e-05   
ref|XP_002438728.1|  hypothetical protein SORBIDRAFT_10g025090        50.4    1e-04   
ref|XP_006858407.2|  PREDICTED: transcriptional corepressor SEUSS     50.8    6e-04   



>ref|XP_006365150.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
tuberosum]
Length=496

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 107/132 (81%), Gaps = 15/132 (11%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+EQ+R  + S E+R+R QER+SRVLA APF +               GDV+LT
Sbjct  56   TLFEMMSEEQTRESKHSLESRYRTQERVSRVLAEAPFPAV--------------GDVRLT  101

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCED  666
            IAARDG+ KVSMDVHRRVL GRSRFFA+KL+R+GSHSVEILDCDDVEVYV+T+VLMYC+D
Sbjct  102  IAARDGF-KVSMDVHRRVLVGRSRFFADKLQRNGSHSVEILDCDDVEVYVETLVLMYCDD  160

Query  667  LKKKLIGEGVSK  702
            LKK+L+GE V+K
Sbjct  161  LKKRLMGENVNK  172



>ref|XP_004251284.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
lycopersicum]
Length=498

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 106/132 (80%), Gaps = 15/132 (11%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+EQ+R  + S E+R+R QER+SRVLA APF +               GDV+LT
Sbjct  58   TLFEMMSEEQTRESKHSLESRYRTQERVSRVLADAPFPAV--------------GDVRLT  103

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCED  666
            I ARDG+ KVSMDVHRRVL GRSRFFAEKL+R+GSHSVEILDCDDVEVYV+T+VLMYC+D
Sbjct  104  IGARDGF-KVSMDVHRRVLVGRSRFFAEKLQRNGSHSVEILDCDDVEVYVETLVLMYCDD  162

Query  667  LKKKLIGEGVSK  702
            LKK+L+GE V+K
Sbjct  163  LKKRLMGENVNK  174



>ref|XP_002281741.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis 
vinifera]
 ref|XP_010651088.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis 
vinifera]
 emb|CBI16228.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 140/199 (70%), Gaps = 25/199 (13%)
 Frame = +1

Query  112  MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  291
            MA+DN LK+ QV STMIKQGFISDP  +         P+  L+  ++SPPP     S   
Sbjct  1    MAADNILKSRQV-STMIKQGFISDPTITFS-------PSRPLSRVSLSPPPPSASPSKS-  51

Query  292  apptQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  471
                 TLF+MMS+EQSR  R S  AR ++Q++++RVLA APF+ P+          G  G
Sbjct  52   ----PTLFEMMSEEQSRESRHSDVARRKLQDQVARVLADAPFRDPA---------WGEFG  98

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYVKTV  645
            DVKLT+A+RDG+ KVSMDVHRRVL  +SRFFAEKLRR G  SHSVEI DCDDVE+YV+TV
Sbjct  99   DVKLTVASRDGF-KVSMDVHRRVLVEQSRFFAEKLRRDGAVSHSVEICDCDDVEIYVETV  157

Query  646  VLMYCEDLKKKLIGEGVSK  702
            VLMYCEDL+K+L+GE VSK
Sbjct  158  VLMYCEDLRKRLMGEEVSK  176



>ref|XP_009610322.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
tomentosiformis]
Length=503

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 16/133 (12%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSP-EARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            TLF+MMS+EQ+R  + S  E+RH+  ER+S+VLA APF                 GDV+L
Sbjct  63   TLFEMMSEEQTRESKHSLFESRHKAHERVSKVLADAPFPRV--------------GDVRL  108

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCE  663
            TIAARDG+ KVSMDVHRRVL GRSRFFAEKL+ +GSHSVEILDCDDVEVYV+T+VLMYCE
Sbjct  109  TIAARDGF-KVSMDVHRRVLIGRSRFFAEKLKSNGSHSVEILDCDDVEVYVETLVLMYCE  167

Query  664  DLKKKLIGEGVSK  702
            DLKKKLIGE VSK
Sbjct  168  DLKKKLIGEDVSK  180



>ref|XP_009774422.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
sylvestris]
Length=502

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 16/133 (12%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSP-EARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            TLF+MMS+EQ+R  + S  E+RH+  ER+S+VLA APF                 GDV+L
Sbjct  62   TLFEMMSEEQTRESKHSLFESRHKAHERVSKVLADAPFPRV--------------GDVRL  107

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCE  663
            TIAARDG+ KVSMDVHRRVL GRSRFFAEKL+ +GSHSVEILDCDDVEVYV+T+VLMYCE
Sbjct  108  TIAARDGF-KVSMDVHRRVLIGRSRFFAEKLKSNGSHSVEILDCDDVEVYVETLVLMYCE  166

Query  664  DLKKKLIGEGVSK  702
            DLKKKLIGE VSK
Sbjct  167  DLKKKLIGEDVSK  179



>ref|XP_010260115.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nelumbo 
nucifera]
Length=560

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 146/232 (63%), Gaps = 23/232 (10%)
 Frame = +1

Query  31   LLFLDHRPTSPTHS-PLRESSEAAFTPP-----MASDNKLKNNQVVSTMIKQGfisdpff  192
              F  H P S  H+ PL  S    F        MA+DN LK+ +V S MIKQGFISDP  
Sbjct  18   FFFFIHSPYSSPHTVPLSHSLYVLFLSSDLRALMAADNVLKSREV-SAMIKQGFISDPTL  76

Query  193  ssppptsHHLPAAKLaatavspppaytpaspppapptQTLFDMMSKEQSRNFRQSPEARH  372
               P        ++++ ++     +  PA       + TLF+MMS+EQ R  ++S + RH
Sbjct  77   CFSPSRM----ISRVSPSSSPSKSSPPPAFSDKMRSSPTLFEMMSEEQQREAKRSEDKRH  132

Query  373  RVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            ++QERISR+LA APFQ+P+          GS GDVKLT+ +RDG+ +VSM+VHR VLA R
Sbjct  133  KLQERISRILAEAPFQNPNW---------GSAGDVKLTVTSRDGF-RVSMNVHRSVLADR  182

Query  553  SRFFAEKLRRSG--SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFFAEKLR  G  +HSVEI DCDDVEVYV+TVVLMY EDLKK+L+ E V K
Sbjct  183  SRFFAEKLRPDGAITHSVEICDCDDVEVYVETVVLMYSEDLKKRLMKEDVGK  234



>ref|XP_010112313.1| hypothetical protein L484_011179 [Morus notabilis]
 gb|EXC33202.1| hypothetical protein L484_011179 [Morus notabilis]
Length=200

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 133/202 (66%), Gaps = 18/202 (9%)
 Frame = +1

Query  112  MASDNKLKNNQVVSTMIKQGfisdpffs---sppptsHHLPAAKLaatavspppaytpas  282
            MA++N LK+ +V S MIKQGFISD   S   S   +  + P +  + T  SPPP     +
Sbjct  1    MAAENSLKSREV-SAMIKQGFISDRTLSFSPSRSISRLYSPLSPPSKTLSSPPPLSPSPA  59

Query  283  pppapptQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSG  462
               A   QTL+DMMS+EQ R  R S + R ++ ER++++L  APF+S S           
Sbjct  60   NSHAAHNQTLYDMMSEEQHRESRLSDDKRRKLHERVAKLLDKAPFRSGS-----------  108

Query  463  SGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYV  636
            S  DV+LT+ ++DG+ +VSMDVH  VL+ +SRFFA+KLRR    +HSVEI DCDDVEVYV
Sbjct  109  SSSDVRLTVVSKDGF-RVSMDVHGSVLSSKSRFFADKLRRERGVAHSVEISDCDDVEVYV  167

Query  637  KTVVLMYCEDLKKKLIGEGVSK  702
            +TVVLMY EDLKK+LIGE VSK
Sbjct  168  ETVVLMYSEDLKKRLIGEEVSK  189



>emb|CDP08962.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 108/134 (81%), Gaps = 5/134 (4%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS EQ+R+ R S EA  ++Q+R+ +VLA APF++      N  D +   GDV+LT
Sbjct  86   TLFEMMSDEQARDSRHSTEAGLKLQDRVFKVLAEAPFKNSGNDRTN--DNNLGCGDVRLT  143

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVEVYVKTVVLMYC  660
            ++ARDG+ +VSM+VHRRVLA RSRFFAEKLRR+G+H  +VEIL+CDDVEVYV+ VVLMYC
Sbjct  144  VSARDGF-RVSMEVHRRVLADRSRFFAEKLRRNGAHMVTVEILECDDVEVYVEVVVLMYC  202

Query  661  EDLKKKLIGEGVSK  702
            EDLKKKL+GE VSK
Sbjct  203  EDLKKKLMGEEVSK  216



>ref|XP_010685873.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Beta 
vulgaris subsp. vulgaris]
Length=508

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 101/135 (75%), Gaps = 5/135 (4%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEA-RHRVQERISRVLAHAP-FQSPSRADGNFIDGSGSGGDVK  480
            TLF+MM+ EQ R  +QS +  R ++Q++++RVL+  P F   +    N + G G G DVK
Sbjct  50   TLFEMMTDEQLRESKQSSDNNRRKLQDKLARVLSKNPNFGDSNNCSSNNLGGFGDG-DVK  108

Query  481  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG-SHSVEILDCDDVEVYVKTVVLMY  657
            LT++ RDG+ K+SMDVHRRVLA +SRFFAEKL   G +HSVEI DCDDVE+YV+T+VLMY
Sbjct  109  LTVSGRDGF-KISMDVHRRVLAEKSRFFAEKLSDGGITHSVEICDCDDVEIYVETLVLMY  167

Query  658  CEDLKKKLIGEGVSK  702
              DLKKKL+G+ V+K
Sbjct  168  THDLKKKLMGDDVTK  182



>ref|XP_008222552.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Prunus 
mume]
Length=519

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 13/135 (10%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTL++MMS EQ R+   S  A  +V E++ ++L +APF++P+        G    GDV+L
Sbjct  71   QTLYEMMSDEQHRD---SKLADRKVHEKVHKLLQNAPFRNPNW-------GGLVSGDVRL  120

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  657
            T+ A+DG+ +V+MDVH+ VLA +SRFFA+KLR  R  SH VEI DCDDVEVYV+TVVLMY
Sbjct  121  TVVAKDGF-RVTMDVHKSVLAAKSRFFADKLRKDRGVSHCVEISDCDDVEVYVETVVLMY  179

Query  658  CEDLKKKLIGEGVSK  702
            CEDLK++ +GE VS+
Sbjct  180  CEDLKRRFMGEEVSR  194



>ref|XP_009354521.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Pyrus 
x bretschneideri]
Length=523

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 100/135 (74%), Gaps = 12/135 (9%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTL++MMS +Q+R+ +  P+   ++ E++ R+L +APF++P+        G    GDV+L
Sbjct  75   QTLYEMMSDDQNRDSKLLPD--RKIHEKVHRLLQNAPFRNPNW-------GGLVSGDVRL  125

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  657
            T+ A+DG+ +VSMDVH+ VLA +SRFFAEKLR  R  SH VEI DCDDVEVYV+ VVLMY
Sbjct  126  TVVAKDGF-RVSMDVHKSVLAAKSRFFAEKLRKERGVSHCVEISDCDDVEVYVEAVVLMY  184

Query  658  CEDLKKKLIGEGVSK  702
             +DLK++L+GE VS+
Sbjct  185  SDDLKRRLMGEEVSR  199



>gb|EYU18898.1| hypothetical protein MIMGU_mgv1a005394mg [Erythranthe guttata]
Length=485

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 14/137 (10%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF MMS EQSR+ +   EA +++Q+RIS +L+ APF        N  D  G G DV+LT
Sbjct  37   TLFQMMSAEQSRDPKPGSEAHNKLQDRISSLLSRAPF--------NVTDRWGVG-DVRLT  87

Query  487  IAARDGWP-----KVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVL  651
            +A+R         +VSMDVHRRVLA  SRFFAEKLRRSG+HSVEIL+CDDV VYV+ VVL
Sbjct  88   VASRSDSGEGESLRVSMDVHRRVLAAGSRFFAEKLRRSGTHSVEILECDDVAVYVEAVVL  147

Query  652  MYCEDLKKKLIGEGVSK  702
            MY ++L  +L G  VSK
Sbjct  148  MYSDELTAELFGMDVSK  164



>ref|XP_004294641.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Fragaria 
vesca subsp. vesca]
Length=515

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 12/135 (9%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTL++MMS E  R+ +    + H   +++ R+L  APF++P+   G         GDV+L
Sbjct  69   QTLYEMMSDEHHRDSKVPDRSLH---QKVHRLLETAPFRNPNWGGGLV------SGDVRL  119

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  657
            T+ A+DG+ +VSMDVH+ VLA +SRFFAEKLR  R  SH VEI DCDDVEVYV++VVLMY
Sbjct  120  TVVAKDGF-RVSMDVHKSVLASKSRFFAEKLRKDRGVSHCVEISDCDDVEVYVESVVLMY  178

Query  658  CEDLKKKLIGEGVSK  702
            C+DLKK+L+GE VS+
Sbjct  179  CDDLKKRLMGEEVSR  193



>gb|KHG07032.1| hypothetical protein F383_02815 [Gossypium arboreum]
Length=504

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 95/136 (70%), Gaps = 12/136 (9%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+E  R  +   E+R + Q R+++ L             NF +G     DVKLT
Sbjct  54   TLFEMMSEEALRGSKTIEESRKKTQRRVAKFLTELKAY-------NFKNGGLGLSDVKLT  106

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            + +RDG+ +V+MDVHRRVL+ +SRFFAEKL   R  G SH+VEI +CDDVEVYV+TVVLM
Sbjct  107  VVSRDGY-RVAMDVHRRVLSEKSRFFAEKLSQRREKGVSHTVEISECDDVEVYVETVVLM  165

Query  655  YCEDLKKKLIGEGVSK  702
            YC+DLKK+LIGE V+K
Sbjct  166  YCDDLKKRLIGENVTK  181



>gb|KJB20225.1| hypothetical protein B456_003G139200 [Gossypium raimondii]
Length=513

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 95/136 (70%), Gaps = 12/136 (9%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+E  R  +   E+R + Q R+++ L      S       F +G     DVKLT
Sbjct  63   TLFEMMSEEALRGSKTIEESRKKTQRRVAKFLTELKAYS-------FKNGGLGLSDVKLT  115

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            + +RDG+ +V+MDVHRRVL+ +SRFFAEKL   R  G SH+VEI +CDDVEVYV+TVVLM
Sbjct  116  VVSRDGY-RVAMDVHRRVLSEKSRFFAEKLSQRREKGVSHTVEISECDDVEVYVETVVLM  174

Query  655  YCEDLKKKLIGEGVSK  702
            YC+DLKK+LIGE V+K
Sbjct  175  YCDDLKKRLIGENVTK  190



>ref|XP_008349723.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Malus 
domestica]
Length=523

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 98/135 (73%), Gaps = 12/135 (9%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTL++MMS +Q+R+ +  P+   ++ E++ R+L  APF++P+        G    GDV+L
Sbjct  75   QTLYEMMSDDQNRDSKLLPD--RKIHEKVHRLLQDAPFRNPNW-------GGLVSGDVRL  125

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  657
            T+ A+DG+ ++SMDVH+ VLA +SRFFAEKLR  R  SH VEI DCDDVEVYV+ VVLMY
Sbjct  126  TVVAKDGF-RISMDVHKSVLAAKSRFFAEKLRKERGVSHCVEISDCDDVEVYVEAVVLMY  184

Query  658  CEDLKKKLIGEGVSK  702
             +DLK +L+GE VS+
Sbjct  185  SDDLKGRLMGEEVSR  199



>ref|XP_010043649.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g60050 [Eucalyptus grandis]
Length=520

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 12/138 (9%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGS-GSG-GDVK  480
            TLF+MMS+EQ R      E+ + ++ R+S++L++APF +   A+    DG  G G GDV+
Sbjct  66   TLFEMMSQEQHR-----LESSNALKSRLSKILSNAPFVNSIVANSVESDGDLGFGTGDVR  120

Query  481  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSV--EILDCDDVEVYVKTVV  648
            LT+ +RDG+  VSMDVH RVLA +SR+FAEKLRR    SHSV  EI +CDD+EVYV+TVV
Sbjct  121  LTVVSRDGF-SVSMDVHGRVLAEKSRYFAEKLRRDRGVSHSVDIEISECDDLEVYVETVV  179

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMY EDLKK+LIGEGV K
Sbjct  180  LMYSEDLKKRLIGEGVDK  197



>gb|KCW85653.1| hypothetical protein EUGRSUZ_B02440 [Eucalyptus grandis]
Length=539

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 12/138 (9%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGS-GSG-GDVK  480
            TLF+MMS+EQ R      E+ + ++ R+S++L++APF +   A+    DG  G G GDV+
Sbjct  85   TLFEMMSQEQHR-----LESSNALKSRLSKILSNAPFVNSIVANSVESDGDLGFGTGDVR  139

Query  481  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSV--EILDCDDVEVYVKTVV  648
            LT+ +RDG+  VSMDVH RVLA +SR+FAEKLRR    SHSV  EI +CDD+EVYV+TVV
Sbjct  140  LTVVSRDGF-SVSMDVHGRVLAEKSRYFAEKLRRDRGVSHSVDIEISECDDLEVYVETVV  198

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMY EDLKK+LIGEGV K
Sbjct  199  LMYSEDLKKRLIGEGVDK  216



>ref|XP_011089383.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089384.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089385.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
Length=511

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 95/139 (68%), Gaps = 16/139 (12%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            +LF+MMS EQ+R  + S EA  +++ER+S VL+ APF + +              DV+LT
Sbjct  59   SLFEMMSVEQAREPKPSSEAHKKLRERVSSVLSQAPFHNSNH---------WGMCDVRLT  109

Query  487  IAAR-------DGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTV  645
            +AAR        G  +VSMDVHRRVLA +SRFF+EKLRR+G HSVEIL+CDDV  Y++ V
Sbjct  110  VAARPEAGERETGAFRVSMDVHRRVLASKSRFFSEKLRRTGPHSVEILECDDVVAYLEAV  169

Query  646  VLMYCEDLKKKLIGEGVSK  702
            VLMY ++LK KL+G  VSK
Sbjct  170  VLMYSDELKTKLMGMEVSK  188



>gb|KJB08821.1| hypothetical protein B456_001G105900 [Gossypium raimondii]
Length=511

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 95/137 (69%), Gaps = 12/137 (9%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTLF+MMS+E  R+ +   E+R + Q RI++ L     +S +       D     GDV+L
Sbjct  60   QTLFEMMSEEHLRDSKAIEESRKKTQTRIAKFLDELKTRSSN-------DWGLRSGDVRL  112

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGSHSVEILDCDDVEVYVKTVVL  651
            T+ +RDG  +VSMDVH+RVL+ +SRFFAEKL     +  SH+VEI +CDDVEVYV+TVVL
Sbjct  113  TVVSRDG-HRVSMDVHKRVLSEKSRFFAEKLSQRKEKGVSHTVEISECDDVEVYVETVVL  171

Query  652  MYCEDLKKKLIGEGVSK  702
            MY +DLKK+LIGE V+K
Sbjct  172  MYSDDLKKRLIGENVNK  188



>ref|XP_008358075.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Malus 
domestica]
Length=534

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 95/135 (70%), Gaps = 12/135 (9%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTL +MMS  Q RN +  P+   +V E++ R+L +APF++P+        G    GDV+L
Sbjct  86   QTLHEMMSDGQHRNSKLLPD--RKVHEKVHRLLQNAPFRNPNW-------GGLVSGDVRL  136

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  657
             + A+DG+ +VSMDVH+ VL  +SRFFAEKLR  R  SH VEI DCDDVEVYV+ VVLMY
Sbjct  137  MVVAKDGF-RVSMDVHKSVLEAKSRFFAEKLRKDRGVSHCVEISDCDDVEVYVEAVVLMY  195

Query  658  CEDLKKKLIGEGVSK  702
             +DLK++L+GE VS+
Sbjct  196  YDDLKRRLMGEEVSR  210



>gb|KHG05277.1| hypothetical protein F383_30980 [Gossypium arboreum]
Length=510

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 12/137 (9%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTLF MMS+E  R+ +   E+R + Q RI++ L     ++ S  D     G GSG DV+L
Sbjct  59   QTLFGMMSEEHLRDSKAIEESRKKTQTRIAKFLDE--LKTCSSNDW----GLGSG-DVRL  111

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGSHSVEILDCDDVEVYVKTVVL  651
            T+ +RDG  +VSMDVH+RVL+ +SRFFAEKL     +  SH+VEI +CDDVEVYV+TVVL
Sbjct  112  TVVSRDG-HRVSMDVHKRVLSEKSRFFAEKLSQRKEKGVSHTVEISECDDVEVYVETVVL  170

Query  652  MYCEDLKKKLIGEGVSK  702
            MY +DLKK+LIGE V+K
Sbjct  171  MYSDDLKKRLIGENVNK  187



>ref|XP_007016614.1| BTB/POZ domain-containing protein [Theobroma cacao]
 gb|EOY34233.1| BTB/POZ domain-containing protein [Theobroma cacao]
Length=512

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 13/136 (10%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+E  R+ +   E+R +   R+++ L      S +        G GSG DV+LT
Sbjct  63   TLFEMMSEEHLRDSKTIEESRRKTN-RVAKFLTELKICSFNSW------GLGSG-DVRLT  114

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            + +RDG+ +VSMDVHRRVL+ +SRFFAEKL   R  G SH+VEI +CDDVEVYV+TVVLM
Sbjct  115  VVSRDGY-RVSMDVHRRVLSEKSRFFAEKLSQGREKGVSHTVEISECDDVEVYVETVVLM  173

Query  655  YCEDLKKKLIGEGVSK  702
            YC+DLKK+LIGE V+K
Sbjct  174  YCDDLKKRLIGEDVNK  189



>ref|XP_010520319.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Tarenaya 
hassleriana]
Length=507

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 91/137 (66%), Gaps = 14/137 (10%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVKL  483
            TLF+MMS+E +R  +   E+R +   R++++L               +   G G GDV+L
Sbjct  58   TLFEMMSEEHNRESKTLDESRKKSHARVAKILTDFK--------NGIVYAYGLGPGDVRL  109

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGSHSVEILDCDDVEVYVKTVVL  651
            T+  RDG+ +V+MDVHRRVL+ +SRFF EK+     +  SH VEI +CDDVEVYV+TVVL
Sbjct  110  TVVGRDGY-RVTMDVHRRVLSEKSRFFMEKMSSRKEKGVSHMVEISECDDVEVYVETVVL  168

Query  652  MYCEDLKKKLIGEGVSK  702
            MYC+DLKK+L+GE V K
Sbjct  169  MYCDDLKKRLVGENVCK  185



>ref|XP_007205061.1| hypothetical protein PRUPE_ppa004481mg [Prunus persica]
 gb|EMJ06260.1| hypothetical protein PRUPE_ppa004481mg [Prunus persica]
Length=507

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 25/135 (19%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTL++MMS EQ R+   S  A  +V E++ ++L +APF++P+            GG    
Sbjct  71   QTLYEMMSDEQHRD---SKLADRKVHEKVHKLLQNAPFRNPN-----------WGG----  112

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--RSGSHSVEILDCDDVEVYVKTVVLMY  657
                 DG+ +V+MDVH+ VLA +SRFFA+KLR  R  SH VEI DCDDVEVYV+TVVLMY
Sbjct  113  ----LDGF-RVTMDVHKSVLAAKSRFFADKLRKDRGVSHCVEISDCDDVEVYVETVVLMY  167

Query  658  CEDLKKKLIGEGVSK  702
            CEDLK++L+GE VS+
Sbjct  168  CEDLKRRLMGEEVSR  182



>gb|KHN05697.1| BTB/POZ domain-containing protein [Glycine soja]
Length=487

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 24/138 (17%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTLFDMMS+E     + S E R + Q+R+SR+L     +               GGDV+L
Sbjct  47   QTLFDMMSEEH----KFSDEKRRKTQDRVSRLLDEPALRG--------------GGDVRL  88

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG---SHSVEILDCDDVEVYVKTVVLM  654
            T+ ARDG+ + SM+V + VLA +SRFFA+KLR +G   SHSVEI DCDD+EVYV+ +VLM
Sbjct  89   TVVARDGF-RASMEVRKTVLADKSRFFADKLRCAGGDLSHSVEISDCDDIEVYVEAIVLM  147

Query  655  YCEDLKKKL--IGEGVSK  702
            +CEDLK +L  + EGV K
Sbjct  148  HCEDLKPRLRSMAEGVPK  165



>ref|XP_003540755.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=503

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 24/138 (17%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTLFDMMS+E     + S E R + Q+R+SR+L     +               GGDV+L
Sbjct  63   QTLFDMMSEEH----KFSDEKRRKTQDRVSRLLDEPALRG--------------GGDVRL  104

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG---SHSVEILDCDDVEVYVKTVVLM  654
            T+ ARDG+ + SM+V + VLA +SRFFA+KLR +G   SHSVEI DCDD+EVYV+ +VLM
Sbjct  105  TVVARDGF-RASMEVRKTVLADKSRFFADKLRCAGGDLSHSVEISDCDDIEVYVEAIVLM  163

Query  655  YCEDLKKKL--IGEGVSK  702
            +CEDLK +L  + EGV K
Sbjct  164  HCEDLKPRLRSMAEGVPK  181



>gb|EPS62176.1| hypothetical protein M569_12618 [Genlisea aurea]
Length=524

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (65%), Gaps = 23/145 (16%)
 Frame = +1

Query  307  TLFDMMSKEQSR-NFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            TLF+MM+ EQ+R + +   + R  +Q+RIS  L+ APF++ +R             DVKL
Sbjct  65   TLFEMMAIEQARESAKPDSDGRKNLQDRISSALSRAPFRTAAR---------WGIADVKL  115

Query  484  TIAA----------RDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  633
            T+AA           +G+ +VS+DVHRRVLA RSRFFAE+LRRSG HSVEILDCDDV  Y
Sbjct  116  TLAAVGDDDDDDSPEEGF-RVSVDVHRRVLAARSRFFAERLRRSGPHSVEILDCDDVAAY  174

Query  634  VKTVVLMYC--EDLKKKLIGEGVSK  702
            ++ +VLMY   ++LK  L+   VSK
Sbjct  175  LEAIVLMYLHPDELKTSLLEWDVSK  199



>ref|XP_004505925.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Cicer 
arietinum]
Length=495

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 124/203 (61%), Gaps = 37/203 (18%)
 Frame = +1

Query  112  MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  291
            M  DN LK+ +V STMIK GFIS+P FSS  P+    P+                +S   
Sbjct  1    MGGDNSLKSKEV-STMIKHGFISNPTFSSFSPSRTFSPSPP--------------SSTTR  45

Query  292  apptQTLFDMMSKE-QSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG  468
               T +LFDMMS +  +R+ + S +   ++++RI+++L  APF               SG
Sbjct  46   PSQTHSLFDMMSDDHNNRDAKHSDDNLRKMKDRITKLLQEAPF---------------SG  90

Query  469  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYVKT  642
            GDVKLT+  ++G+ KVSM+V + VLA +SRFFAEKLR     SHSVEI DCDDV+VYV+ 
Sbjct  91   GDVKLTVVGKEGF-KVSMEVKKSVLADKSRFFAEKLRCENGMSHSVEISDCDDVDVYVEA  149

Query  643  VVLMYCEDLKKKL--IG-EGVSK  702
            VVLM+C DLKK+L  +G +GVSK
Sbjct  150  VVLMHCVDLKKRLRFMGQQGVSK  172



>ref|XP_002531830.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30550.1| protein binding protein, putative [Ricinus communis]
Length=526

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 19/136 (14%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVKL  483
            TLF MMS+EQS  F Q+   R + Q +IS+++         +   NF +  G G GDV+L
Sbjct  83   TLFQMMSEEQS--FEQN---RQKTQSKISKIV---------KEFDNFNNYCGFGLGDVRL  128

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR---RSGSHSVEILDCDDVEVYVKTVVLM  654
            T+  RDG  KVS DVH+RVL  +S FF EKLR   +   HSVEI +CDDVEVY++ +VLM
Sbjct  129  TVIGRDG-LKVSCDVHKRVLIEKSGFFREKLRDREKGIMHSVEISECDDVEVYLEALVLM  187

Query  655  YCEDLKKKLIGEGVSK  702
            YC+DLKK+L+GE V+K
Sbjct  188  YCDDLKKRLMGEEVTK  203



>ref|XP_007132142.1| hypothetical protein PHAVU_011G070200g [Phaseolus vulgaris]
 gb|ESW04136.1| hypothetical protein PHAVU_011G070200g [Phaseolus vulgaris]
Length=494

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 89/137 (65%), Gaps = 23/137 (17%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            QTLFDMMS+E     + S E R + Q+R+S++L     +               GGDV+L
Sbjct  55   QTLFDMMSEEH----KFSDEKRRKAQDRLSKLLREPALRE--------------GGDVRL  96

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG--SHSVEILDCDDVEVYVKTVVLMY  657
            T+  RDG  +VSM+V + VLA +SRFFAEKLR  G  SHSVEI DCDDVEVYV+ VVLM+
Sbjct  97   TVVGRDGL-RVSMEVRKSVLADKSRFFAEKLRCDGAVSHSVEISDCDDVEVYVEAVVLMH  155

Query  658  CEDLKKKL--IGEGVSK  702
             EDLK +L  +G+GV K
Sbjct  156  SEDLKGRLRSMGDGVPK  172



>ref|XP_006591005.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=494

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 113/206 (55%), Gaps = 43/206 (21%)
 Frame = +1

Query  112  MASDNKLKNNQVVSTMIKQGfisdpffssppptsHHLPAAKLaatavspppaytpasppp  291
            M  D+ LK+ QV S MIKQG                +PA  L+ +          ++ P 
Sbjct  1    MGGDSALKSGQV-SAMIKQG---------------FIPAPNLSFSPSRTFSPPPSSTRPS  44

Query  292  app----tQTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGS  459
                   TQTLF+MMS+E     + S E R    +R+SR+L     +S S          
Sbjct  45   QTQSHPHTQTLFNMMSEEH----KFSDEKRRNTHDRVSRLLDEPALRSAS----------  90

Query  460  GSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSG---SHSVEILDCDDVEV  630
               GDV+LT+  RDG+ +VSM+V + VLA +SRFFA+KLR  G   SHSVEI DCDDVEV
Sbjct  91   ---GDVRLTVVGRDGF-RVSMEVRKTVLADKSRFFADKLRCCGGGLSHSVEISDCDDVEV  146

Query  631  YVKTVVLMYCEDLKKKL--IGEGVSK  702
            YV+ VVLM+C+DLK +L  + EGV K
Sbjct  147  YVEAVVLMHCDDLKPRLRSMAEGVPK  172



>ref|XP_009126626.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Brassica 
rapa]
Length=495

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 90/140 (64%), Gaps = 27/140 (19%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAH----APFQSPSRADGNFIDGSGSGGD  474
            TLFDMMS+E  R   Q P  R +   R+++++A       + +PS              D
Sbjct  58   TLFDMMSEEHHRE--QPP--RRKSHARVAQIMAEFKNGVVYDAPS--------------D  99

Query  475  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKT  642
            VKLT+  RDG+ +V+MDVHR+VL+ +SRFF  K+   R  G SH VEI +CDDVE+YV+T
Sbjct  100  VKLTVVGRDGY-RVTMDVHRKVLSEKSRFFMAKMSSRREKGVSHMVEISECDDVEIYVET  158

Query  643  VVLMYCEDLKKKLIGEGVSK  702
            VVLMYC+DLKKKL+GE V K
Sbjct  159  VVLMYCDDLKKKLVGENVVK  178



>emb|CDY09229.1| BnaA02g06550D [Brassica napus]
Length=497

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 90/140 (64%), Gaps = 27/140 (19%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAH----APFQSPSRADGNFIDGSGSGGD  474
            TLFDMMS+E  R   Q P  R +   R+++++A       + +PS              D
Sbjct  60   TLFDMMSEEHHRE--QPP--RRKSHARVAQIMAEFKNGVVYDAPS--------------D  101

Query  475  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKT  642
            VKLT+  RDG+ +V+MDVHR+VL+ +SRFF  K+   R  G SH VEI +CDDVE+YV+T
Sbjct  102  VKLTVVGRDGY-RVTMDVHRKVLSEKSRFFMAKMSSRREKGVSHMVEISECDDVEIYVET  160

Query  643  VVLMYCEDLKKKLIGEGVSK  702
            VVLMYC+DLKKKL+GE V K
Sbjct  161  VVLMYCDDLKKKLVGENVVK  180



>ref|NP_200813.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q9LVG9.1|Y5600_ARATH RecName: Full=BTB/POZ domain-containing protein At5g60050 [Arabidopsis 
thaliana]
 dbj|BAA96934.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42168.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04024.1| unknown protein [Arabidopsis thaliana]
 gb|AED97271.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=499

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 17/136 (13%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS E +R        R +   R++++L           +G     S   GDVKLT
Sbjct  57   TLFDMMSDEHNREL-----PRRKSHARVAQILTEFK-------NGVVYGHSLGPGDVKLT  104

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  163

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLKKKLIGE V K
Sbjct  164  YSDDLKKKLIGENVIK  179



>ref|XP_002866364.1| hypothetical protein ARALYDRAFT_358221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42623.1| hypothetical protein ARALYDRAFT_358221 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 87/136 (64%), Gaps = 17/136 (13%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS E +R        R +   R++++L           +G     S   GDVKLT
Sbjct  57   TLFDMMSDEHNREL-----PRRKSHARVAQILTEFK-------NGVVYGHSLGPGDVKLT  104

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+Y++TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYIETVVLM  163

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLKKKLIGE V K
Sbjct  164  YSDDLKKKLIGENVIK  179



>ref|XP_012064931.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Jatropha 
curcas]
 gb|KDP44149.1| hypothetical protein JCGZ_05616 [Jatropha curcas]
Length=510

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 91/136 (67%), Gaps = 20/136 (15%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVKL  483
            TLF MMS+EQ+       + R R Q +IS+++           + + ++  G G GDV+L
Sbjct  69   TLFQMMSEEQALE-----QNRQRSQSKISKLVK----------EFDNLNNCGLGLGDVRL  113

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR---RSGSHSVEILDCDDVEVYVKTVVLM  654
            T+  +DG+ +VS DVH+RVL  +S FF EKLR   +   HSVEI +CDDVEVY++T+VLM
Sbjct  114  TVIGKDGY-RVSFDVHKRVLMEKSGFFREKLRDGEKGVMHSVEISECDDVEVYMETLVLM  172

Query  655  YCEDLKKKLIGEGVSK  702
            YC+DLKK+L+GE V+K
Sbjct  173  YCDDLKKRLLGEEVTK  188



>ref|XP_006281633.1| hypothetical protein CARUB_v10027763mg [Capsella rubella]
 gb|EOA14531.1| hypothetical protein CARUB_v10027763mg [Capsella rubella]
Length=500

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 87/136 (64%), Gaps = 16/136 (12%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS E +R     P  R +   R++++L           +G     S    DVKLT
Sbjct  56   TLFDMMSDEHNRE----PPPRRKSHARVAQILTEFK-------NGVVYGHSLGPSDVKLT  104

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CD++E+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDELEIYVETVVLM  163

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLKKKLIGE V K
Sbjct  164  YSDDLKKKLIGENVIK  179



>ref|XP_010483651.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Camelina 
sativa]
Length=500

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 87/136 (64%), Gaps = 15/136 (11%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS E +R   + P  R +   R++++L           +G     S    DVKLT
Sbjct  55   TLFDMMSDEHNR---EPPPPRRKSHARVAQILTEF-------KNGVVYGHSLGPSDVKLT  104

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  163

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLK KLIGE V K
Sbjct  164  YSDDLKNKLIGETVLK  179



>gb|KDO73042.1| hypothetical protein CISIN_1g010024mg [Citrus sinensis]
Length=520

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 94/138 (68%), Gaps = 11/138 (8%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+EQ +    + +   + Q RI ++L+   F++P+  D +F   +   G+V+LT
Sbjct  65   TLFEMMSQEQLQETTTTNKP-IKSQSRIFKLLSE--FKNPNIRD-SFSYLALGPGNVRLT  120

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL------RRSGSHSVEILDCDDVEVYVKTVV  648
            +  +DG+ +V MDVH+ VLA +SRFFAEKL       R   H VEI +CDDVEVYV+TVV
Sbjct  121  VVGKDGF-RVCMDVHKNVLAEKSRFFAEKLAIRDKENREMLHVVEISECDDVEVYVETVV  179

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC+DLK++L+GE + K
Sbjct  180  LMYCDDLKRRLLGEDLDK  197



>ref|XP_006424700.1| hypothetical protein CICLE_v10028213mg [Citrus clementina]
 ref|XP_006488215.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Citrus 
sinensis]
 gb|ESR37940.1| hypothetical protein CICLE_v10028213mg [Citrus clementina]
Length=520

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 94/138 (68%), Gaps = 11/138 (8%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLF+MMS+EQ +    + +   + Q RI ++L+   F++P+  D +F   +   G+V+LT
Sbjct  65   TLFEMMSQEQLQETTTTNKP-IKSQSRIFKLLSE--FKNPNIRD-SFSYLALGPGNVRLT  120

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL------RRSGSHSVEILDCDDVEVYVKTVV  648
            +  +DG+ +V MDVH+ VLA +SRFFAEKL       R   H VEI +CDDVEVYV+TVV
Sbjct  121  VVGKDGF-RVCMDVHKNVLAEKSRFFAEKLAIRDKENREMLHVVEISECDDVEVYVETVV  179

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC+DLK++L+GE + K
Sbjct  180  LMYCDDLKRRLLGEDLDK  197



>ref|XP_010455877.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=499

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 86/136 (63%), Gaps = 14/136 (10%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS E +R     P  R +   R++++L           +G     S    DVKLT
Sbjct  55   TLFDMMSDEHNRE--PPPPQRRKSHARVAQILTEF-------KNGVVYGHSLGPSDVKLT  105

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  106  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  164

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLK KLIGE V K
Sbjct  165  YSDDLKNKLIGETVLK  180



>ref|XP_010443796.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=498

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 15/136 (11%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS E +R    SP  R +   R++++L           +G     S    DVKLT
Sbjct  53   TLFDMMSDEHNRE--PSP-PRRKSHARVAQILTEF-------KNGVVYGHSLGPSDVKLT  102

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDD+E+YV+TVVLM
Sbjct  103  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDLEIYVETVVLM  161

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLK KLIGE V K
Sbjct  162  YSDDLKNKLIGETVLK  177



>ref|XP_006400887.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
 gb|ESQ42340.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
Length=500

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 89/136 (65%), Gaps = 17/136 (13%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TLFDMMS+E +R   + P  R +   R++++L           +G     S    +VKL+
Sbjct  57   TLFDMMSEEHNR---EPP--RRKSHARVTQILTEFK-------NGVVYGHSLGPSNVKLS  104

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHSVEILDCDDVEVYVKTVVLM  654
            +  +DG+ +V+MDVHR+VL+ +SRFF EK+   R  G SH VEI +CDDVE+YV+TVVLM
Sbjct  105  VVGKDGY-RVTMDVHRKVLSEKSRFFMEKMNSRREKGVSHMVEISECDDVEIYVETVVLM  163

Query  655  YCEDLKKKLIGEGVSK  702
            Y +DLKK+LIGE V K
Sbjct  164  YSDDLKKRLIGENVIK  179



>gb|AES88747.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=451

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 87/139 (63%), Gaps = 27/139 (19%)
 Frame = +1

Query  310  LFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTI  489
            LFDM+S  Q+     S + R ++Q+R++++L  A F                GGDVKLT+
Sbjct  43   LFDMISSNQTP---LSDDNRRKMQDRVNKLLQEAHF---------------IGGDVKLTV  84

Query  490  AARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS-----HSVEILDCDDVEVYVKTVVLM  654
              ++G  +VSMDV + VLA +SRFFAEKLR SG+     HSVEI DCDDV+VYV+ +VLM
Sbjct  85   VGKEG-IRVSMDVKKSVLAEKSRFFAEKLRGSGNGNGMVHSVEISDCDDVDVYVEAIVLM  143

Query  655  YCEDLKKKL---IGEGVSK  702
            +C DLK +L      GVSK
Sbjct  144  HCVDLKNRLRFMADAGVSK  162



>ref|XP_006419001.1| hypothetical protein EUTSA_v10002519mg [Eutrema salsugineum]
 gb|ESQ37437.1| hypothetical protein EUTSA_v10002519mg [Eutrema salsugineum]
Length=464

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 86/134 (64%), Gaps = 16/134 (12%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQ-SPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKL  483
            +L DM+S EQ+   R+   E R +   R++++L                  S   GDVKL
Sbjct  51   SLLDMISDEQNCETRRVQEEPRRKYHARVAKILTD-------------FKNSVEPGDVKL  97

Query  484  TIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEVYVKTVVLMYC  660
            ++  R G+  V+MDVH++VL+ +S FF ++++ +S SH+VEI +CDDVEV+V+TVVLM+C
Sbjct  98   SLVGRSGYA-VTMDVHKKVLSEKSSFFMDRIKSQSESHTVEISECDDVEVFVETVVLMHC  156

Query  661  EDLKKKLIGEGVSK  702
            EDLK KLIGE V K
Sbjct  157  EDLKNKLIGENVFK  170



>ref|XP_003606550.1| hypothetical protein MTR_4g061670 [Medicago truncatula]
Length=565

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 87/139 (63%), Gaps = 27/139 (19%)
 Frame = +1

Query  310  LFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTI  489
            LFDM+S  Q+     S + R ++Q+R++++L  A F                GGDVKLT+
Sbjct  43   LFDMISSNQTP---LSDDNRRKMQDRVNKLLQEAHF---------------IGGDVKLTV  84

Query  490  AARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS-----HSVEILDCDDVEVYVKTVVLM  654
              ++G  +VSMDV + VLA +SRFFAEKLR SG+     HSVEI DCDDV+VYV+ +VLM
Sbjct  85   VGKEG-IRVSMDVKKSVLAEKSRFFAEKLRGSGNGNGMVHSVEISDCDDVDVYVEAIVLM  143

Query  655  YCEDLKKKL---IGEGVSK  702
            +C DLK +L      GVSK
Sbjct  144  HCVDLKNRLRFMADAGVSK  162



>ref|XP_002299517.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
 gb|EEE84322.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
Length=656

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 94/158 (59%), Gaps = 28/158 (18%)
 Frame = +1

Query  307  TLFDMMSKE---QSR--------------NFRQSPEARHRVQERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   Q R              +FR +  ++  VQ+R + +L        +R+
Sbjct  182  TLFEMMASEPEMQPRTITQMPINANNGNISFRNTQSSQMSVQDRQALILQRITDILGNRS  241

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  588
             GN  + S S  DVKLT++++DG   VSMDVHR++L G SRFFA KL         R S 
Sbjct  242  PGNQFNDSNSS-DVKLTLSSKDG-ISVSMDVHRQILVGHSRFFAVKLSDKWSNKQQRMST  299

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL++KL+ E VS+
Sbjct  300  PYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVSR  337



>ref|XP_009398931.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=584

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 91/155 (59%), Gaps = 25/155 (16%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPE-ARHRVQERISRVLAHAPFQSP-----------SRADGNFI  450
            TLFDMM+ EQ   +R+SPE   H   +++ R +A     SP           +   GN  
Sbjct  104  TLFDMMTNEQG-FYRRSPEHVVHPPMQQLGRAVADPEATSPQDRQLLLQDRVAEIIGNCS  162

Query  451  DGSG----SGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-------RSGSHS  597
             G+       GDV LT+++ DG   VS++VHR +L G SRFFA KLR       RS  + 
Sbjct  163  PGNQLNDPESGDVHLTLSSMDGL-TVSLNVHRHILVGHSRFFAAKLRDLWSKQQRSLPYI  221

Query  598  VEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            VEI DCDDVE+YV+T+ LMYC+DL+++L+ E VSK
Sbjct  222  VEISDCDDVEIYVETLCLMYCKDLRRRLMREDVSK  256



>ref|XP_012086844.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Jatropha 
curcas]
Length=404

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 23/153 (15%)
 Frame = +1

Query  307  TLFDMMSKE---QSRN----------FRQSPEARHRVQERISRVLAHAPFQSPSRADGNF  447
            TLF+MM+ E   Q RN           R S  A+  VQ++ + ++        +R+ GN 
Sbjct  196  TLFEMMASEPEMQPRNQIPINNGNVPVRSSQNAQMSVQDKQTLIMHRIADILSNRSPGNQ  255

Query  448  IDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSVE  603
             + S S  DVKLT++++DG   VSM+VHR++L   SRFFA KL        R S  + VE
Sbjct  256  FNDS-STSDVKLTLSSKDGI-SVSMNVHRQILVAHSRFFAVKLSDRWAKNQRTSSPYVVE  313

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDDVEVY++T+ LMYC+DL++KL+ + V K
Sbjct  314  IADCDDVEVYIETLRLMYCKDLRRKLMKDDVGK  346



>ref|XP_011015247.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Populus euphratica]
Length=621

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 92/158 (58%), Gaps = 28/158 (18%)
 Frame = +1

Query  307  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   Q RN  Q P               ++  VQ+R + +L        +R+
Sbjct  147  TLFEMMASEPEIQPRNTTQIPIIGNNGNINVKNTQSSQMSVQDRQALILQRITNILGNRS  206

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  588
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R S 
Sbjct  207  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMSA  264

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL++KL+ E VS+
Sbjct  265  PYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVSR  302



>ref|XP_011015245.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Populus euphratica]
Length=658

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 92/158 (58%), Gaps = 28/158 (18%)
 Frame = +1

Query  307  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   Q RN  Q P               ++  VQ+R + +L        +R+
Sbjct  184  TLFEMMASEPEIQPRNTTQIPIIGNNGNINVKNTQSSQMSVQDRQALILQRITNILGNRS  243

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  588
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R S 
Sbjct  244  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMSA  301

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL++KL+ E VS+
Sbjct  302  PYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVSR  339



>gb|AAR14275.1| predicted protein [Populus tremula x Populus alba]
Length=533

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 11/129 (9%)
 Frame = +1

Query  343  NFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSM  522
            +FR +  ++  VQ+R + +L        +R+ GN  + S S  DVKLT++++DG   VSM
Sbjct  88   SFRNTQSSQMSVQDRQALILQRITDILGNRSPGNQFNDSNSS-DVKLTLSSKDG-ISVSM  145

Query  523  DVHRRVLAGRSRFFAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKK  675
            DVHR++L G SRFFA KL         R S  + VEI DCDDVEVY++T+ LMYC+DL++
Sbjct  146  DVHRQILVGHSRFFAVKLSDKWSNKQQRMSTPYVVEIADCDDVEVYIETLRLMYCKDLRR  205

Query  676  KLIGEGVSK  702
            KL+ E VS+
Sbjct  206  KLMKEDVSR  214



>ref|XP_010255266.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nelumbo 
nucifera]
Length=667

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 95/158 (60%), Gaps = 36/158 (23%)
 Frame = +1

Query  307  TLFDMMSKEQS---RN------------FRQSPEARHR---VQERISRVLAHAPFQSPSR  432
            TLF+MM+ EQ    RN             R  P  + +   +Q+R++ +L        S 
Sbjct  201  TLFEMMANEQDCQLRNQIPLPNNLPVIPIRPPPSVQDKQLLLQQRVAEILG-------SC  253

Query  433  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSG  588
            + GN F D + S  DVKLT++++DG+  VSM+VHR++L   SRFFA KL       +RS 
Sbjct  254  SPGNQFNDPTSS--DVKLTMSSKDGF-SVSMNVHRQILVAHSRFFAAKLSDRWSKQQRSI  310

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             H +EI DCDDVEVY++T+ LMYC+DL+KKL+ E VSK
Sbjct  311  PHIIEISDCDDVEVYIETLRLMYCKDLRKKLMKEDVSK  348



>ref|XP_002303602.2| hypothetical protein POPTR_0003s13090g [Populus trichocarpa]
 gb|EEE78581.2| hypothetical protein POPTR_0003s13090g [Populus trichocarpa]
Length=656

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 92/158 (58%), Gaps = 28/158 (18%)
 Frame = +1

Query  307  TLFDMMSKE---QSR--------------NFRQSPEARHRVQERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   Q R              N R +  ++  VQ+R + +L        +R+
Sbjct  182  TLFEMMASEPEMQPRTITQIPIIGNNGNINVRNTQSSQMSVQDRQALILQRITNILGNRS  241

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  588
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R S 
Sbjct  242  PGNQFNDSSSS-DVNLTLSSKDGI-SVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMSA  299

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL++KL+ E VS+
Sbjct  300  PYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVSR  337



>ref|XP_011029330.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=648

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 90/158 (57%), Gaps = 28/158 (18%)
 Frame = +1

Query  307  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   Q R   Q P                +  VQ+R + +L        +R+
Sbjct  174  TLFEMMASEPEMQPRTITQMPINAYNGNISCRNTQSNQMSVQDRQALILQRITDILGNRS  233

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  588
             GN  + S S  DVKLT+ ++DG   VSMDVHR++L G SRFFA KL         R S 
Sbjct  234  PGNQFNDSNSS-DVKLTLTSKDG-ICVSMDVHRQILVGHSRFFALKLSDKWSNKQQRIST  291

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL++KL+ E VS+
Sbjct  292  PYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVSR  329



>ref|XP_011022633.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=658

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 91/158 (58%), Gaps = 28/158 (18%)
 Frame = +1

Query  307  TLFDMMSKE---QSRNFRQSP--------------EARHRVQERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   Q RN  Q P               ++  VQ+R + +L        +R+
Sbjct  184  TLFEMMASEPEIQPRNTTQIPIIGNNGNINVKNTQSSQMSVQDRQALILQRITNILGNRS  243

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSG  588
             GN  + S S  DV LT++++DG   VSM+VHR++L G SRFFA KL         R   
Sbjct  244  PGNQFNDSSSS-DVNLTLSSKDG-ISVSMNVHRQILVGHSRFFAVKLSDKWANKQQRMYA  301

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL++KL+ E VS+
Sbjct  302  PYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVSR  339



>ref|XP_012086845.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Jatropha 
curcas]
 ref|XP_012086846.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Jatropha 
curcas]
Length=525

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 23/153 (15%)
 Frame = +1

Query  307  TLFDMMSKE---QSRN----------FRQSPEARHRVQERISRVLAHAPFQSPSRADGNF  447
            TLF+MM+ E   Q RN           R S  A+  VQ++ + ++        +R+ GN 
Sbjct  56   TLFEMMASEPEMQPRNQIPINNGNVPVRSSQNAQMSVQDKQTLIMHRIADILSNRSPGNQ  115

Query  448  IDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSVE  603
             + S S  DVKLT++++DG   VSM+VHR++L   SRFFA KL        R S  + VE
Sbjct  116  FNDS-STSDVKLTLSSKDG-ISVSMNVHRQILVAHSRFFAVKLSDRWAKNQRTSSPYVVE  173

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDDVEVY++T+ LMYC+DL++KL+ + V K
Sbjct  174  IADCDDVEVYIETLRLMYCKDLRRKLMKDDVGK  206



>ref|XP_009628159.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
tomentosiformis]
Length=667

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 24/154 (16%)
 Frame = +1

Query  307  TLFDMMSKEQS----RNFRQSPEARHRVQERISRVLAHAPFQS----------PSRADGN  444
            TLF+MM+ E           +P +   + +++S  L     Q+            R+ GN
Sbjct  197  TLFEMMANEPECIPRSTINNTPISNGGLNQKLSTSLMPQDKQALMQHRLLDLLACRSPGN  256

Query  445  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSV  600
              + SGS  DVKLT++++DG+  V+M+VHR++L   SRFFA KL        R SG + V
Sbjct  257  QFNDSGSS-DVKLTLSSKDGF-SVAMNVHRQILVAHSRFFAVKLSEKWVKQQRNSGPYIV  314

Query  601  EILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            EI DCDD+EVY++T+ LMYC+DL+KKL+ E V K
Sbjct  315  EIADCDDIEVYIETLRLMYCKDLRKKLMKEDVPK  348



>ref|XP_008807229.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
Length=630

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 30/153 (20%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR------QSPEARH--------RVQERISRVLAHAPFQSPSRADGN  444
            TLFDMM+ E   + R      QSP  R          +QER++ +L        S + GN
Sbjct  155  TLFDMMANEHDYHARPALPPPQSPAGRAVPVQDRQLLLQERVAGILG-------SCSPGN  207

Query  445  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVE  603
              +   S  DV+LT+ +RDG   VS++VHR +L   SRFFA KL       +RS  H VE
Sbjct  208  QFNDPDSS-DVRLTLTSRDGL-SVSLNVHRHILVAHSRFFAAKLSDRWSRQQRSLPHLVE  265

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDDVEVY++T+ LMYC+D++++L+ E VSK
Sbjct  266  ISDCDDVEVYIETLRLMYCKDIRRRLMKEDVSK  298



>gb|KDP25402.1| hypothetical protein JCGZ_20558 [Jatropha curcas]
Length=665

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 23/153 (15%)
 Frame = +1

Query  307  TLFDMMSKE---QSRN----------FRQSPEARHRVQERISRVLAHAPFQSPSRADGNF  447
            TLF+MM+ E   Q RN           R S  A+  VQ++ + ++        +R+ GN 
Sbjct  196  TLFEMMASEPEMQPRNQIPINNGNVPVRSSQNAQMSVQDKQTLIMHRIADILSNRSPGNQ  255

Query  448  IDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSVE  603
             + S S  DVKLT++++DG   VSM+VHR++L   SRFFA KL        R S  + VE
Sbjct  256  FNDS-STSDVKLTLSSKDG-ISVSMNVHRQILVAHSRFFAVKLSDRWAKNQRTSSPYVVE  313

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDDVEVY++T+ LMYC+DL++KL+ + V K
Sbjct  314  IADCDDVEVYIETLRLMYCKDLRRKLMKDDVGK  346



>ref|XP_009800799.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
sylvestris]
Length=645

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 89/154 (58%), Gaps = 24/154 (16%)
 Frame = +1

Query  307  TLFDMMSKEQS----RNFRQSPEARHRVQERISRVLAHAPFQS----------PSRADGN  444
            TLF+MM+ E           +P     + +++S  L     Q+            R+ GN
Sbjct  175  TLFEMMANEPECIPRSTINNTPILNGGLNQKLSTSLMPQDKQALMQQRLLDLLACRSPGN  234

Query  445  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSV  600
              + SGS  DVKLT++++DG+  V+M+VHR++L   SRFFA KL        R SG   V
Sbjct  235  QFNDSGSS-DVKLTLSSKDGF-SVAMNVHRQILVAHSRFFAVKLSEKWVKQQRNSGPFIV  292

Query  601  EILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            EI DCDD+EVY++T+ LMYC+DL+KKL+ E V+K
Sbjct  293  EIADCDDIEVYIETLRLMYCKDLRKKLMKEDVTK  326



>emb|CDP12055.1| unnamed protein product [Coffea canephora]
Length=648

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 86/154 (56%), Gaps = 24/154 (16%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEAR--HRVQERISRVLAHAPFQSPS------------RADGN  444
            TLF+MM+ E   + R +      H+V   +   L   P    +            R+ GN
Sbjct  178  TLFEMMASEPDCHPRTAAAGTTTHQVSNGVISTLNQKPLDRQALMLQRLNDLLSCRSPGN  237

Query  445  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSGSHSV  600
              + S S  DVKLT++++DG   VSM VHR++L   SRFFAEKL        R +G   V
Sbjct  238  QFNDSASA-DVKLTLSSKDGL-HVSMSVHRQILVANSRFFAEKLSEKWVRQQRNAGPCIV  295

Query  601  EILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            EI DCDD+EVY++T+ LMYC+DL+KKL+ E V +
Sbjct  296  EIADCDDIEVYIETLKLMYCKDLRKKLMKEDVCR  329



>ref|XP_008776124.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X2 [Phoenix dactylifera]
Length=507

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 86/142 (61%), Gaps = 24/142 (17%)
 Frame = +1

Query  307  TLFDMMSKEQ-----SRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  471
            TLF+M+S+E              + R R++E IS++L+               D S   G
Sbjct  56   TLFEMISQEDFSRRGPPPPPSDDQKRRRLEEMISKILSTE-------------DPSWVPG  102

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGS-HSVEILDCDDVEVYV  636
            DV+L++++ DG+ + SMDVHR+VLA RSRFFAEKL    R  GS   VEI +CDDVEVYV
Sbjct  103  DVELSVSSDDGF-RFSMDVHRQVLARRSRFFAEKLEGISRVPGSPVVVEICECDDVEVYV  161

Query  637  KTVVLMYCEDLKKKLIGEGVSK  702
            + V +MYC DL+++L GE V K
Sbjct  162  QAVGMMYCRDLRRRLAGEAVGK  183



>ref|XP_008776113.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X1 [Phoenix dactylifera]
Length=509

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 86/142 (61%), Gaps = 24/142 (17%)
 Frame = +1

Query  307  TLFDMMSKEQ-----SRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGG  471
            TLF+M+S+E              + R R++E IS++L+               D S   G
Sbjct  56   TLFEMISQEDFSRRGPPPPPSDDQKRRRLEEMISKILSTE-------------DPSWVPG  102

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----RRSGS-HSVEILDCDDVEVYV  636
            DV+L++++ DG+ + SMDVHR+VLA RSRFFAEKL    R  GS   VEI +CDDVEVYV
Sbjct  103  DVELSVSSDDGF-RFSMDVHRQVLARRSRFFAEKLEGISRVPGSPVVVEICECDDVEVYV  161

Query  637  KTVVLMYCEDLKKKLIGEGVSK  702
            + V +MYC DL+++L GE V K
Sbjct  162  QAVGMMYCRDLRRRLAGEAVGK  183



>ref|XP_009389780.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=652

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 93/159 (58%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR-----QSP---------------EARHRVQERISRVLAHAPFQSP  426
            TLFDMM+ EQ  + R     Q P               + +  +QER++ ++      SP
Sbjct  161  TLFDMMANEQDYHPRPAVPPQLPLPGRAGAALAAASAQDRQLLLQERVAEIIGSC---SP  217

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
                GN ++ + SG DV+LT+ ++DG   VS++VHR +L   SRFFA KL       +RS
Sbjct  218  ----GNQLNDAESG-DVRLTLTSKDGL-TVSLNVHRNILVAHSRFFAAKLSDRWSKQQRS  271

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              H VEI DCDDVEVYV+T+ LMYC+DL+++L+ E VSK
Sbjct  272  LPHIVEISDCDDVEVYVETLRLMYCKDLRRRLMREDVSK  310



>ref|XP_007040317.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 ref|XP_007040318.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY24818.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY24819.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=566

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 93/157 (59%), Gaps = 27/157 (17%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAP----------FQSPS-----RADG  441
            TLF+MM+ E   + R   + + ++Q  IS    + P           Q  S     R+ G
Sbjct  184  TLFEMMASEPDIHPRNQSQNQAQIQVPISAPRQNQPPPVIDKQALTMQRISDLLSNRSPG  243

Query  442  NFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGS---  591
            N  +  GS  D+KLT++++DG   VSM+VHR++L   SRFFA KL       +R+GS   
Sbjct  244  NQFNDPGSS-DIKLTLSSKDGI-NVSMNVHRQILVAHSRFFAVKLSDRWAKQQRNGSGGP  301

Query  592  HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VSK
Sbjct  302  YIVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSK  338



>ref|XP_007040315.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040316.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040319.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24816.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24817.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24820.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=657

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 93/157 (59%), Gaps = 27/157 (17%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAP----------FQSPS-----RADG  441
            TLF+MM+ E   + R   + + ++Q  IS    + P           Q  S     R+ G
Sbjct  184  TLFEMMASEPDIHPRNQSQNQAQIQVPISAPRQNQPPPVIDKQALTMQRISDLLSNRSPG  243

Query  442  NFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGS---  591
            N  +  GS  D+KLT++++DG   VSM+VHR++L   SRFFA KL       +R+GS   
Sbjct  244  NQFNDPGSS-DIKLTLSSKDG-INVSMNVHRQILVAHSRFFAVKLSDRWAKQQRNGSGGP  301

Query  592  HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VSK
Sbjct  302  YIVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSK  338



>ref|XP_011005022.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Populus 
euphratica]
Length=503

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 80/138 (58%), Gaps = 29/138 (21%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVK  480
            QTLF MMS EQ+             Q +IS+++              F D +  G GDV+
Sbjct  67   QTLFQMMSDEQNH------------QSKISKIMKE------------FEDLNCYGRGDVR  102

Query  481  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS----HSVEILDCDDVEVYVKTVV  648
            LT+  +DG  ++SMDVH+RVL  +S FF + LR         SVEI DCDDVEVY++T+V
Sbjct  103  LTVIGKDGHTRISMDVHKRVLLEKSGFFRDTLRGRDQGVVMQSVEISDCDDVEVYLETLV  162

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMY  DLK++L+ E VS+
Sbjct  163  LMYSHDLKRRLMDEDVSR  180



>ref|XP_006829095.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Amborella 
trichopoda]
 gb|ERM96511.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
Length=613

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 89/150 (59%), Gaps = 27/150 (18%)
 Frame = +1

Query  307  TLFDMMSKEQ-SRNFRQSPEARHRV----------QERISRVLAHAPFQSPSRADGNFID  453
            TL +MM  EQ SR     P  +  V          QE+++ +L        S + GN  +
Sbjct  145  TLSEMMRTEQDSRPRYHIPVMKQPVSGQGDSHCLFQEQVAEILG-------SCSPGNLFN  197

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILD  612
              GS  DVKLT+++RDG+  V++++HR++L   SRFFA KL       +RS  H VEI D
Sbjct  198  DLGSS-DVKLTLSSRDGF-SVTLNLHRQILVANSRFFASKLSERWSKQQRSLPHLVEISD  255

Query  613  CDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            CDDV VY++T+ LMYC+DLK+KL+ E VSK
Sbjct  256  CDDVGVYMETLRLMYCKDLKRKLMKEDVSK  285



>gb|EYU40075.1| hypothetical protein MIMGU_mgv1a002655mg [Erythranthe guttata]
Length=649

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 17/123 (14%)
 Frame = +1

Query  358  PEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRR  537
            P+ +  +Q+R++ +LA       SR+ GN  + + S  DVKLT++++DG   +S+ VHR 
Sbjct  216  PDKQALMQQRLTDILA-------SRSPGNQFNEAASS-DVKLTLSSKDG-VSISISVHRE  266

Query  538  VLAGRSRFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEG  693
            +L   SRFFA+          R  G H VEI DCDD+EVY++T+ LMYC+DL+KKL+ E 
Sbjct  267  ILVVHSRFFAQTFNEKWVKQQRNLGPHIVEIADCDDIEVYIETLRLMYCKDLRKKLMKED  326

Query  694  VSK  702
            VS+
Sbjct  327  VSR  329



>ref|XP_008783441.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
 ref|XP_008783443.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
 ref|XP_008783444.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
Length=640

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 35/158 (22%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR-------------------QSPEARHRVQERISRVLAHAPFQSPS  429
            TLFDMM+ EQ    R                   Q  + R  +QERI+ VL        S
Sbjct  160  TLFDMMTNEQDYQPRALPPPPPPPPPPAGRAAPVQVQDQRLLLQERIADVLG-------S  212

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSG  588
             + GN  +   S  DV+LT++++DG   VS++VHR +L   S+FFA KL       +RS 
Sbjct  213  CSPGNQFNDPDSS-DVRLTLSSKDG-LSVSLNVHRHILVAHSQFFAAKLSDRWSRQQRSL  270

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             H VEI DCDDVEVY++T+ LMYC+DL+++L+ E VSK
Sbjct  271  PHLVEISDCDDVEVYIETLCLMYCKDLRRRLMKEDVSK  308



>ref|XP_011080923.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Sesamum 
indicum]
Length=532

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 92/164 (56%), Gaps = 41/164 (25%)
 Frame = +1

Query  307  TLFDMMSKE---------------------QSRNFRQSPEARHR---VQERISRVLAHAP  414
            TLF+MM+ E                     QS     +P  + +   VQ+R+  +LA   
Sbjct  59   TLFEMMANEPDCHPRATTLVPNGVVFAQNHQSTKLAANPAPQDKQALVQQRLMDLLA---  115

Query  415  FQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------  576
                SR+ GN  + + SG DVKLT++++DG   VS+ VHR++L   SRFFA KL      
Sbjct  116  ----SRSPGNQFNDAISG-DVKLTLSSKDG-INVSISVHRQILVAHSRFFALKLNEKWVK  169

Query  577  --RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              R SG + VEI DCDD+EVY++T+ LMYC+DL++KL+ E V +
Sbjct  170  QQRSSGPYIVEIADCDDIEVYIETLRLMYCKDLRRKLMKEEVPR  213



>gb|KEH21112.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=595

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 88/152 (58%), Gaps = 22/152 (14%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQS-----------PEARHRVQERISRVLAHAPFQSPSRADGNFID  453
            TLF+MM  E     R +           P+ +   Q+R + ++        SR+ GN  +
Sbjct  127  TLFEMMVNEPDIQQRTNQIPINNATSSMPKPQIIAQDRETLMMNRISELLSSRSPGNHFN  186

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSGSHSVEI  606
             S S  D+KLT++++DG+  VSM+VHR++L   SRFF+ KL         R +  + VEI
Sbjct  187  DSSSS-DIKLTLSSKDGF-SVSMNVHRQILVAHSRFFSVKLSDRWTQSQQRSALPYLVEI  244

Query  607  LDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             DCDDVEVYV+T+ LMYC+DL+KKL+ E V K
Sbjct  245  ADCDDVEVYVETLRLMYCKDLRKKLMKEDVCK  276



>emb|CBI34370.3| unnamed protein product [Vitis vinifera]
Length=519

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 20/119 (17%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            + +RIS +LA       SR+ GN F D S S  D+KLT++++DG   +SM VHR++L   
Sbjct  95   MMQRISEILA-------SRSPGNQFNDMSSS--DIKLTLSSKDG-VSISMSVHRQILVAH  144

Query  553  SRFFAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFFA KL         R +  + VEI DCDDVE+Y++T+ LMYC+DL+KKL+ E VS+
Sbjct  145  SRFFAAKLSDRWTRQQQRSASPYIVEIADCDDVEIYIETLRLMYCKDLRKKLMKEDVSR  203



>ref|XP_002298385.2| hypothetical protein POPTR_0001s24050g [Populus trichocarpa]
 gb|EEE83190.2| hypothetical protein POPTR_0001s24050g [Populus trichocarpa]
Length=503

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 29/138 (21%)
 Frame = +1

Query  304  QTLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG-GDVK  480
            QTLF +MS+EQ+             Q +IS+++              F D +  G GDV+
Sbjct  67   QTLFQIMSEEQNH------------QSKISKIMKE------------FEDLNCYGRGDVR  102

Query  481  LTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS----HSVEILDCDDVEVYVKTVV  648
            LT+  +DG  ++SMDVH+RVL  +S FF + LR         SVEI DCDDVEVY++T+V
Sbjct  103  LTVIGKDGHTRISMDVHKRVLLEKSGFFRDTLRGRDQGVVMQSVEISDCDDVEVYLETLV  162

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMY  DLK++L+ E VS+
Sbjct  163  LMYSHDLKRRLMDEDVSR  180



>gb|KJB37507.1| hypothetical protein B456_006G208800 [Gossypium raimondii]
Length=613

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 90/162 (56%), Gaps = 39/162 (24%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQ----------------------ERISRVLAHAPFQ  420
            TLF+MM+ E   N R   + + ++Q                      +RIS +L+     
Sbjct  163  TLFEMMANEPDNNPRNRTQNQAQIQVPISSPRQNHPPPVIDKQALTMQRISDLLS-----  217

Query  421  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR------  582
              +R+ GN  +   S  D+KLT++++DG   V+M+VHR++L   SRFFA KL        
Sbjct  218  --TRSPGNQFNDPNSS-DMKLTLSSKDG-ISVTMNVHRQILVAHSRFFAVKLSDRSQETN  273

Query  583  --SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              +G +SVEI DCDDVEVY++ + LMYC+DL+K L+ E VSK
Sbjct  274  GPTGPYSVEIADCDDVEVYIEVLRLMYCKDLRKMLLREDVSK  315



>ref|XP_010069058.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW57276.1| hypothetical protein EUGRSUZ_H00077 [Eucalyptus grandis]
Length=529

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 92/158 (58%), Gaps = 36/158 (23%)
 Frame = +1

Query  307  TLFDMMSKE---QSRN-------------FRQSPEARHRV-QERISRVLAHAPFQSPSRA  435
            TL +MM+ E   QS N             F+ S E +  +  +R+S +LA       +R+
Sbjct  62   TLIEMMANEPDIQSSNHILPNPSVPVAPKFQISAEDKQVLAMQRLSDILA-------ARS  114

Query  436  DGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSG  588
             GN F D S S  D+KL + ++DG   VSM+VHR +L   SRFFA KL        R SG
Sbjct  115  PGNQFNDASSS--DIKLALTSKDG-ITVSMNVHRPILVAHSRFFAMKLSDRWIKQQRVSG  171

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E V++
Sbjct  172  PYIVEIADCDDVEVYIETLRLMYCKDLRKKLMKEDVTR  209



>ref|XP_002279382.2| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Vitis 
vinifera]
Length=667

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 20/119 (17%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            + +RIS +LA       SR+ GN F D S S  D+KLT++++DG   +SM VHR++L   
Sbjct  240  MMQRISEILA-------SRSPGNQFNDMSSS--DIKLTLSSKDG-VSISMSVHRQILVAH  289

Query  553  SRFFAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFFA KL         R +  + VEI DCDDVE+Y++T+ LMYC+DL+KKL+ E VS+
Sbjct  290  SRFFAAKLSDRWTRQQQRSASPYIVEIADCDDVEIYIETLRLMYCKDLRKKLMKEDVSR  348



>ref|XP_011073126.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Sesamum indicum]
Length=615

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 17/117 (15%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  555
            +Q+R+  +LA    +SP    GN  +  GS  DVKLT++++DG   VS+ VHR++L   S
Sbjct  189  MQQRLMDLLA---LRSP----GNQFNDEGSS-DVKLTLSSKDGL-SVSISVHRQILVAHS  239

Query  556  RFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            RFFA KL        R SG + VEI DCDD+EVY++T+ LMYC+DL+KKL+ E VS+
Sbjct  240  RFFALKLNEKWVKQQRSSGLYIVEIADCDDIEVYIETLRLMYCKDLRKKLMKEDVSR  296



>ref|XP_010069057.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Eucalyptus grandis]
Length=545

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 92/158 (58%), Gaps = 36/158 (23%)
 Frame = +1

Query  307  TLFDMMSKE---QSRN-------------FRQSPEARHRV-QERISRVLAHAPFQSPSRA  435
            TL +MM+ E   QS N             F+ S E +  +  +R+S +LA       +R+
Sbjct  78   TLIEMMANEPDIQSSNHILPNPSVPVAPKFQISAEDKQVLAMQRLSDILA-------ARS  130

Query  436  DGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRSG  588
             GN F D S S  D+KL + ++DG   VSM+VHR +L   SRFFA KL        R SG
Sbjct  131  PGNQFNDASSS--DIKLALTSKDG-ITVSMNVHRPILVAHSRFFAMKLSDRWIKQQRVSG  187

Query  589  SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E V++
Sbjct  188  PYIVEIADCDDVEVYIETLRLMYCKDLRKKLMKEDVTR  225



>ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Solanum tuberosum]
Length=642

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 93/159 (58%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQ---SRNFRQSP----------------EARHRVQERISRVLAHAPFQSPS  429
            TLF+MM+ E    +R+   +P                + +  +Q+R+  +LA        
Sbjct  174  TLFEMMANEPECITRSTINTPISNGCSNQKPASFVPLDKQALMQQRLLDLLA-------C  226

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  585
            R+ GN  + S S  DVKLT++++DG   V+M+VHR++L   SRFFA KL        R S
Sbjct  227  RSPGNQFNDSSSS-DVKLTLSSKDGL-SVAMNVHRQILVVHSRFFAVKLSEKWVKQQRNS  284

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            G + VEI DCDD+EVY++T+ LMYC+DL+++L+ E VSK
Sbjct  285  GPYIVEIADCDDIEVYIETLRLMYCKDLRRRLMKEDVSK  323



>ref|XP_010058250.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Eucalyptus grandis]
Length=523

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 10/101 (10%)
 Frame = +1

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  579
            SR+ G+    S S  D+KL ++++DG   VSM+VHR +LA  S+FFAEKL         R
Sbjct  105  SRSPGSLFXDSASS-DMKLILSSKDGAISVSMNVHREILAAHSQFFAEKLSDQWMRQQQR  163

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             + +  VEI DCDDVEVYV+T+ LMYCEDL+++L+ E VS+
Sbjct  164  TAAAPIVEIADCDDVEVYVETLRLMYCEDLRRRLMKEDVSR  204



>ref|XP_004503685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cicer 
arietinum]
Length=609

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 78/116 (67%), Gaps = 20/116 (17%)
 Frame = +1

Query  385  RISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRF  561
            RIS +LA       SR+ GN F D S S  D+KLT++++DG+  VSM+VHR++L   SRF
Sbjct  185  RISELLA-------SRSPGNHFNDPSSS--DIKLTLSSKDGF-SVSMNVHRQILVAHSRF  234

Query  562  FAEKL---------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            F+ KL         R +  + VEI DCDDVE+YV+T+ LMYC+DL+KKL+ E VS+
Sbjct  235  FSVKLSDRWTQQQQRTALPYLVEIADCDDVEIYVETLRLMYCKDLRKKLMREDVSR  290



>ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Solanum 
lycopersicum]
Length=638

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (66%), Gaps = 17/117 (15%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  555
            +Q+R+  +LA        R+ GN  + S S  DVKLT++++DG   V+M+VHR++L   S
Sbjct  212  MQQRLLDLLA-------CRSPGNQFNDSSSS-DVKLTLSSKDGL-SVAMNVHRQILVVHS  262

Query  556  RFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            RFFA KL        R SG + VEI DCDD+EVY++T+ LMYC+DL+K+L+ E V K
Sbjct  263  RFFAVKLSEKWVKQQRNSGPYIVEIADCDDIEVYIETLRLMYCKDLRKRLMKEDVPK  319



>gb|KHG15549.1| hypothetical protein F383_06896 [Gossypium arboreum]
Length=613

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 89/162 (55%), Gaps = 39/162 (24%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQ----------------------ERISRVLAHAPFQ  420
            TLF+MM+ E   N R   + + ++Q                      +RIS +L+     
Sbjct  163  TLFEMMANEPDNNPRNQTQDQAQIQVPISGPRQNQPPPVIDKQALTMQRISDLLS-----  217

Query  421  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR------  582
              +R+ GN  +   S  D+KLT++++DG   V M+VHR++L   SRFFA KL        
Sbjct  218  --TRSPGNQFNDPNSS-DMKLTLSSKDG-ISVLMNVHRQILVAHSRFFAVKLSDRSQETN  273

Query  583  --SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              +G +SVEI DCDDVEVY++ + LMYC+DL+K L+ E VSK
Sbjct  274  GPTGPYSVEIADCDDVEVYIEVLRLMYCKDLRKMLMREDVSK  315



>ref|XP_010933990.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=639

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 90/153 (59%), Gaps = 30/153 (20%)
 Frame = +1

Query  307  TLFDMMSKEQSRNF------------RQSP--EARHRVQERISRVLAHAPFQSPSRADGN  444
            TLFDMM+ E   +             R +P  + +  +QER++ +L      SP      
Sbjct  164  TLFDMMTNEHDYHPRPPLPQHPPPAGRAAPVLDRQLLLQERVADILGSC---SPG---SQ  217

Query  445  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVE  603
            F D   S  DV+LT++++DG+  VS++VHR +L   SRFFA KL       +RS  H VE
Sbjct  218  FNDPDSS--DVRLTLSSKDGF-SVSLNVHRHILVTHSRFFAAKLSDRWSRQQRSLPHLVE  274

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDDVEVY++T+ LMYC+D++++L+ E VSK
Sbjct  275  ISDCDDVEVYIETLRLMYCKDIRRRLMKEDVSK  307



>ref|XP_008437316.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
 ref|XP_008437317.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
Length=678

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 89/159 (56%), Gaps = 37/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQS---PEAR----HRVQ-----------ERISRVLAHAPFQSPSR  432
            TLF+MM+ E   + R S   P+      H+ Q           +RIS +L        SR
Sbjct  211  TLFEMMASEPDIHPRTSQIPPQVASVSVHKNQVPIQDKQALMMQRISEILG-------SR  263

Query  433  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  585
            + GN F D S S  D+KLT+++RDG   VSM VHR++L   SRFFA KL        R  
Sbjct  264  SPGNQFNDASSS--DIKLTLSSRDG-ISVSMSVHRQILVAHSRFFALKLSERWAKQQRSP  320

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              + VEI DCDDVEVY++T+ LMYC DL+K+L+ E V +
Sbjct  321  SPYIVEIADCDDVEVYIETLKLMYCRDLRKRLMKEDVPR  359



>ref|XP_009400477.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=643

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 43/164 (26%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEA-------------------------RHRVQERISRVLAHA  411
            TLFDMM+ EQ  ++   P A                         +  +QER++ ++   
Sbjct  150  TLFDMMANEQ--DYHPLPAAHAGPLQMHLPGRAADAPTAASAQDRQLLLQERVADIIG--  205

Query  412  PFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-----  576
                 S + GN ++ + S GDV+LT+++ DG   VS++VHR +L   SRFFA KL     
Sbjct  206  -----SCSPGNQLNDAES-GDVRLTLSSNDGL-TVSLNVHRHILVAHSRFFAAKLSDRWS  258

Query  577  --RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              +RS  H VEI DCDDVE+YV+T+ LMYC+DL+++L+ E VS 
Sbjct  259  KQQRSLPHIVEISDCDDVEIYVETLRLMYCKDLRRRLMREDVSN  302



>ref|XP_010089067.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB37314.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=437

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 25/123 (20%)
 Frame = +1

Query  382  ERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRF  561
            +RIS +L+       SR+ GN  + S S  D+KLT+++RDG   VSM+VHR++L   SRF
Sbjct  4    QRISEILS-------SRSPGNQFNDSSSS-DIKLTLSSRDG-ISVSMNVHRQILVAHSRF  54

Query  562  FAEKLR------------RSGS----HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEG  693
            FA KL              +GS    H VEI DC+DVEVY++T+ LMYC+DLKKKL+ E 
Sbjct  55   FAVKLSDRWAKQQRWAAGNTGSSASPHIVEIADCEDVEVYIETLRLMYCKDLKKKLMKED  114

Query  694  VSK  702
            V K
Sbjct  115  VPK  117



>ref|XP_004143891.2| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
sativus]
 ref|XP_011654731.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
sativus]
 gb|KGN50074.1| hypothetical protein Csa_5G152890 [Cucumis sativus]
Length=676

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 90/159 (57%), Gaps = 37/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQS---PE----ARHRVQ-----------ERISRVLAHAPFQSPSR  432
            TLF+MM+ E   + R S   P+    + H+ Q           +RIS +L        SR
Sbjct  209  TLFEMMASEPDIHPRTSQIPPQIASVSVHKNQVPVQDKQALMMQRISEILG-------SR  261

Query  433  ADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--------RRS  585
            + GN F D S S  D+KLT+++RDG   VSM VHR++L   SRFFA KL        R  
Sbjct  262  SPGNQFNDASSS--DIKLTLSSRDG-ISVSMSVHRQILVAHSRFFALKLSERWAKQQRSP  318

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              + VEI DCDDVEVY++T+ LMYC DL+K+L+ E V +
Sbjct  319  SPYIVEIADCDDVEVYIETLKLMYCRDLRKRLMKEDVPR  357



>gb|KJB52168.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52169.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52170.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
Length=643

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 39/162 (24%)
 Frame = +1

Query  307  TLFDMMSKE-------QSRNFRQSPEARHR-------------VQERISRVLAHAPFQSP  426
            TLF+MM+ E       Q++   Q+P +  R               +RIS +L+       
Sbjct  172  TLFEMMASEPDIHQRTQNQAQIQAPISAPRQNQPPPVMDKQVLTMQRISDLLS-------  224

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            +R+ GN  +  G   D+KLT++++DG   VSM+VHR++L   SRFFA +L       +R+
Sbjct  225  TRSPGNQFNDPGLS-DIKLTLSSKDG-ISVSMNVHRQILVAHSRFFAVRLSDRWTKQQRN  282

Query  586  GS---HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            GS   + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VSK
Sbjct  283  GSTGPYIVEISDCDDVEVYIETLRLMYCKDLRKKLMREDVSK  324



>ref|XP_007160095.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
 gb|ESW32089.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
Length=610

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 21/120 (18%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            + +RIS +L        SR+ GN F DG  S  D+KLT++++DG   VSM+VHR++L   
Sbjct  181  MMQRISDLLG-------SRSPGNQFNDGVSS--DIKLTLSSKDGI-SVSMNVHRQILVAH  230

Query  553  SRFFAEKL----------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFF+ KL          R    + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VS+
Sbjct  231  SRFFSVKLSDRWTKQQQQRSPVPYEVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSR  290



>ref|XP_003532421.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
 ref|XP_006584729.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Glycine max]
Length=538

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 89/159 (56%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR--------QSPEARHRVQ---------ERISRVLAHAPFQSPSRA  435
            TLF+MM+ E   + R         +  A H+ Q         +RIS +L        SR+
Sbjct  70   TLFEMMASEPDVHHRPTTHIPNPTTTNANHKPQILDRQALMMQRISELLG-------SRS  122

Query  436  DGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL----------RRS  585
             GN  +   S  D+KLT++++DG   VSM+VHR++L   SRFF+ KL          R  
Sbjct  123  PGNQFNDPLSS-DIKLTLSSKDG-ISVSMNVHRQILVAHSRFFSVKLSDRWTNLQQQRSP  180

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VS+
Sbjct  181  VPYEVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSR  219



>gb|KHG02986.1| hypothetical protein F383_23864 [Gossypium arboreum]
Length=646

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 39/162 (24%)
 Frame = +1

Query  307  TLFDMMSKE-------QSRNFRQSPEARHR-------------VQERISRVLAHAPFQSP  426
            TLF+MM+ E       Q++   Q+P +  R               +RIS +L+       
Sbjct  175  TLFEMMASEPDIHQRTQNQAQIQAPISAPRQNQPPPVMDKQVLTMQRISDLLS-------  227

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            +R+ GN  +  G   D+KLT++++DG   VSM+VHR++L   SRFFA +L       +R+
Sbjct  228  TRSPGNQFNDPGLS-DIKLTLSSKDG-ISVSMNVHRQILMAHSRFFAVRLSDRWTKQQRN  285

Query  586  GS---HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            GS   + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VSK
Sbjct  286  GSTGPYIVEISDCDDVEVYIETLRLMYCKDLRKKLMREDVSK  327



>ref|XP_006476518.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Citrus 
sinensis]
Length=656

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 70/101 (69%), Gaps = 11/101 (11%)
 Frame = +1

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  579
            +R+ GN  + S S  D+KLT++++DG   VS++VHR++L   SRFFA KL         +
Sbjct  239  TRSPGNQFNESTSS-DIKLTLSSKDG-ISVSLNVHRQILVAHSRFFAVKLSDRWTKQQQK  296

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             +  + VEI DCDDVEVY++T+ LMYC+DLKKKL+ E VSK
Sbjct  297  TTHPYIVEIADCDDVEVYIETLRLMYCKDLKKKLMREDVSK  337



>gb|AIB05883.1| TRAF transcription factor, partial [Zea mays]
Length=606

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR---------------QSPEARHR-----VQERISRVLAHAPFQSP  426
            TLFDMM+ EQ  + R               Q P AR       +Q+RI+ ++        
Sbjct  120  TLFDMMANEQDYHPRTAAGIHSIPAPPQPHQLPPARSMDRQMLLQDRIADLIG-------  172

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            S + GN  + + S  DV+LT++++DG   V++ VHR +L   SRFFA KL       +R+
Sbjct  173  SCSPGNQFNDADSS-DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQRT  230

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              H VEI DCDDVEVY +T+ LMYC+DL+++L+ E V+K
Sbjct  231  LPHIVEISDCDDVEVYAETLRLMYCKDLRRRLMREDVNK  269



>ref|NP_001053645.1| Os04g0579700 [Oryza sativa Japonica Group]
 emb|CAE03270.1| OSJNBa0011J08.25 [Oryza sativa Japonica Group]
 emb|CAD41158.2| OSJNBa0064M23.3 [Oryza sativa Japonica Group]
 dbj|BAF15559.1| Os04g0579700 [Oryza sativa Japonica Group]
 gb|EAY95268.1| hypothetical protein OsI_17091 [Oryza sativa Indica Group]
 gb|EAZ31736.1| hypothetical protein OsJ_15888 [Oryza sativa Japonica Group]
Length=533

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 90/160 (56%), Gaps = 37/160 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQS---------PEARH------------RVQERISRVLAHAPFQS  423
            TLFDMM+ EQ  + R +         P+  H             +Q+R++ ++       
Sbjct  45   TLFDMMANEQDYHPRTAAAIHSIPAPPQQAHPLQPARSMDRQVLLQDRVAELIG------  98

Query  424  PSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RR  582
             S + GN  + + S  DV+LT+ ++DG   V++ VHR +L   SRFFA KL       +R
Sbjct  99   -SCSPGNQFNDADSS-DVRLTLTSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQR  155

Query  583  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            +  H VEI DCDDVEVYV+T+ LMYC+DL+++L+ E VSK
Sbjct  156  TLPHIVEISDCDDVEVYVETLRLMYCKDLRRRLMREDVSK  195



>gb|AFW59116.1| hypothetical protein ZEAMMB73_743291 [Zea mays]
Length=606

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR---------------QSPEARHR-----VQERISRVLAHAPFQSP  426
            TLFDMM+ EQ  + R               Q P AR       +Q+RI+ ++        
Sbjct  120  TLFDMMANEQDYHPRTAAGIHSIPAPPQPHQLPPARSMDRQMLLQDRIADLIG-------  172

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            S + GN  + + S  DV+LT++++DG   V++ VHR +L   SRFFA KL       +R+
Sbjct  173  SCSPGNQFNDADSS-DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQRT  230

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              H VEI DCDDVEVY +T+ LMYC+DL+++L+ E V+K
Sbjct  231  LPHIVEISDCDDVEVYAETLRLMYCKDLRRRLMREDVNK  269



>ref|NP_001169621.1| uncharacterized protein LOC100383502 [Zea mays]
 gb|ACN34307.1| unknown [Zea mays]
Length=546

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR---------------QSPEARHR-----VQERISRVLAHAPFQSP  426
            TLFDMM+ EQ  + R               Q P AR       +Q+RI+ ++        
Sbjct  60   TLFDMMANEQDYHPRTAAGIHSIPAPPQPHQLPPARSMDRQMLLQDRIADLIG-------  112

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            S + GN  + + S  DV+LT++++DG   V++ VHR +L   SRFFA KL       +R+
Sbjct  113  SCSPGNQFNDADSS-DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQRT  170

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              H VEI DCDDVEVY +T+ LMYC+DL+++L+ E V+K
Sbjct  171  LPHIVEISDCDDVEVYAETLRLMYCKDLRRRLMREDVNK  209



>ref|XP_008238939.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Prunus 
mume]
Length=643

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 15/104 (14%)
 Frame = +1

Query  427  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--------  579
            SR+ GN F D S S  D+KLT++A+DG+  VSM+VHR++L   SRFFA KL         
Sbjct  224  SRSPGNQFNDPSSS--DIKLTLSAKDGF-SVSMNVHRQILVAHSRFFAVKLSDRWVKQQR  280

Query  580  ---RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
                S  ++VEI DCDDVEVY++ + LMYC+DL+K+L+ E V K
Sbjct  281  TTSSSSPYNVEIADCDDVEVYIEALRLMYCKDLRKRLMKEDVPK  324



>ref|XP_001751363.1| predicted protein [Physcomitrella patens]
 gb|EDQ83680.1| predicted protein, partial [Physcomitrella patens]
Length=440

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 87/147 (59%), Gaps = 28/147 (19%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRV--------QERISRVLAHAPFQSPSRADGNFIDGSG  462
            TLF+MM+ EQ       P+A H +        QE++  +L+     SP    GN  + + 
Sbjct  10   TLFEMMTHEQELG----PKAVHTISLSQQLTFQEKMKSILSGT---SP----GNQFNATN  58

Query  463  SGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILDCDD  621
            +  D+KL +  R+G+  V+++VHR +L   SRFFA KL       +R+ S+ +EI D DD
Sbjct  59   TS-DLKLILNNREGYS-VTVNVHRHILVTHSRFFAAKLSDRWSKQQRTNSNLIEITDIDD  116

Query  622  VEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            VE+Y++T+ LMYCED+KK L+ E VS+
Sbjct  117  VEIYLETLRLMYCEDVKKSLMKENVSR  143



>ref|XP_007210316.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
 gb|EMJ11515.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
Length=700

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 15/104 (14%)
 Frame = +1

Query  427  SRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR--------  579
            SR+ GN F D S S  D+KLT++A+DG+  VSM+VHR++L   SRFFA KL         
Sbjct  281  SRSPGNQFNDPSSS--DIKLTLSAKDGF-SVSMNVHRQILVAHSRFFAVKLSDRWVKQQR  337

Query  580  ---RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
                S  ++VEI DCDDVEVY++ + LMYC+DL+K+L+ E V K
Sbjct  338  TTSSSSPYNVEIADCDDVEVYIEALRLMYCKDLRKRLMKEDVPK  381



>gb|KHG01374.1| hypothetical protein F383_23678 [Gossypium arboreum]
Length=640

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 92/160 (58%), Gaps = 37/160 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFR-----QSPEARHR-------------VQERISRVLAHAPFQSPSR  432
            TLF+MM+ E   + R     Q P +  R               +RIS +L+       +R
Sbjct  170  TLFEMMASEPDVHPRTQTQIQVPISGPRQNQPPPVIDKQALTMQRISNLLS-------TR  222

Query  433  ADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGS  591
            + GN  +   S  D+KLT++++DG   VSM+VHR+++   SRFFA KL       +R+GS
Sbjct  223  SPGNQFNDPDSS-DIKLTLSSKDG-ISVSMNVHRQIVVAHSRFFAVKLSDRWAKQQRNGS  280

Query  592  ---HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
               + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E V K
Sbjct  281  AGPYIVEIADCDDVEVYIETLKLMYCKDLRKKLMREDVPK  320



>gb|KCW72192.1| hypothetical protein EUGRSUZ_E00642 [Eucalyptus grandis]
Length=404

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 9/85 (11%)
 Frame = +1

Query  475  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------RRSGSHSVEILDCDDVE  627
            +KL ++++DG   VSM+VHR +LA  S+FFAEKL         R + +  VEI DCDDVE
Sbjct  1    MKLILSSKDGAISVSMNVHREILAAHSQFFAEKLSDQWMRQQQRTAAAPIVEIADCDDVE  60

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            VYV+T+ LMYCEDL+++L+ E VS+
Sbjct  61   VYVETLRLMYCEDLRRRLMKEDVSR  85



>ref|XP_006652685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Oryza 
brachyantha]
Length=532

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 89/159 (56%), Gaps = 36/159 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQS--------PEARH------------RVQERISRVLAHAPFQSP  426
            TLFDMM+ EQ  + R +        P   H             +Q+R++ ++        
Sbjct  50   TLFDMMANEQDYHPRTAAAIHSIPAPPQPHPLQPARSMDRQVLLQDRVAELIG-------  102

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            S + GN  + + S  DV+LT+ ++DG   V++ VHR +L   SRFFA KL       +R+
Sbjct  103  SCSPGNQFNDADSS-DVRLTLTSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSKQQRT  160

Query  586  GSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              H VEI DCDDVEVYV+T+ LMYC+DL+++L+ E V+K
Sbjct  161  LPHIVEISDCDDVEVYVETLRLMYCKDLRRRLMREDVNK  199



>ref|XP_010233737.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brachypodium 
distachyon]
Length=550

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 88/163 (54%), Gaps = 41/163 (25%)
 Frame = +1

Query  307  TLFDMMSKEQ--------SRNFRQSPEARHR---------------VQERISRVLAH-AP  414
            TLFDMM+ EQ        S     +P   H                +Q+R++ + A  +P
Sbjct  61   TLFDMMANEQDYHPRTHPSTTLPSAPPQHHHHLAPARSSSMDRQLLLQDRLADLAASCSP  120

Query  415  FQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------  576
                +RAD +         DV+LT+A++DG   +++ +HR +L   SRFFA KL      
Sbjct  121  GSQFNRADSS---------DVRLTLASKDGL-SLTLSLHRHILVAHSRFFAAKLSDRWSR  170

Query  577  -RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             +R+  H VEI DCDDVEVYV+T+ LMYC DL+++L+ E V+K
Sbjct  171  QQRTLPHVVEISDCDDVEVYVETLRLMYCNDLRRRLMREDVAK  213



>ref|XP_003524451.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
Length=564

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 87/160 (54%), Gaps = 37/160 (23%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSP----------------EARHRVQERISRVLAHAPFQSPSRAD  438
            TLF++M+ E     R +P                +    + +RIS +L        SR+ 
Sbjct  95   TLFEIMASEPDVPHRPTPLIPPTPNPYPNKPLILDPHALLMQRISELLV-------SRSP  147

Query  439  GNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------------RR  582
            GN  + + S  D+KLT+ ++DG   VSM++HR++L   SRFF+ KL            R 
Sbjct  148  GNQFNDAVSS-DIKLTLTSKDG-TCVSMNLHRQILVAHSRFFSVKLSDRWTKHQQELQRS  205

Query  583  SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
               + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VS+
Sbjct  206  PVPYEVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSR  245



>ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum 
tuberosum]
Length=644

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 17/117 (15%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  555
            +Q+R+  +LA        R+ GN  + S S  DVKLT++++DG   V+M+VHR++L   S
Sbjct  218  MQQRLLDLLA-------CRSPGNQFNDSSSS-DVKLTLSSKDGL-SVAMNVHRQILVVHS  268

Query  556  RFFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            RFFA KL        R S  + VEI DCDD+EVY++T+ LMYC+DL+++L+   VSK
Sbjct  269  RFFAVKLSEKWVKQQRNSSPYIVEIADCDDIEVYIETLRLMYCKDLRRRLMKVDVSK  325



>ref|XP_010919095.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=637

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 83/153 (54%), Gaps = 30/153 (20%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHR--------------VQERISRVLAHAPFQSPSRADGN  444
            TLFDMM+ EQ    R S                    + ERI+ +L        S + GN
Sbjct  162  TLFDMMANEQEYQPRASLPPPPPPPPADRAAPFQELMLHERIAEILG-------SCSPGN  214

Query  445  FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVE  603
              +   S  DV+LT++++DG   VS++VH  +L   SRFFA KL       + S  H VE
Sbjct  215  QFNDPDSS-DVRLTLSSKDGL-SVSLNVHHHILVAHSRFFAAKLSDRWSRQQHSLPHIVE  272

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDDVEVY++T+ LMYC DL+++L+ E VSK
Sbjct  273  ISDCDDVEVYIETLRLMYCNDLRRRLMREDVSK  305



>ref|XP_002531214.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31191.1| protein binding protein, putative [Ricinus communis]
Length=474

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 78/120 (65%), Gaps = 20/120 (17%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  555
            + +RIS +L +   +SP    GN  + S +  DVKLT++++DG   VSM+VHR++L   S
Sbjct  45   IMQRISDILGN---KSP----GNQFNDSLTS-DVKLTLSSKDG-ITVSMNVHRQILVAHS  95

Query  556  RFFAEKL---------RRSG--SHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            RFFA KL         +RS    + VEI DCDDVEVY++T+ LMYC+DL++KL+ E V K
Sbjct  96   RFFAVKLSDRWAKQQQQRSSLLPYVVEIADCDDVEVYIETLRLMYCKDLRRKLMKEDVCK  155



>ref|XP_009112778.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brassica 
rapa]
Length=534

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 87/165 (53%), Gaps = 42/165 (25%)
 Frame = +1

Query  307  TLFDMMSKE-----QSRNFRQSPEARHRV-----------------QERISRVLAHAPFQ  420
            TLF+MMS E     Q +N      +R R                   +RIS +L      
Sbjct  63   TLFEMMSSEAGSPVQIQNLALPSSSRTRTTNGSHLVISAQDKQALAMQRISNLLM-----  117

Query  421  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-------  579
              +R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL        
Sbjct  118  --TRSPGNQFNDPASS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAVKLSDRWSKQQ  173

Query  580  ----RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
                 S  + VEI DCDDVEVY++T++LMYC DL+KK++ + VS+
Sbjct  174  QMAPSSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRQDVSR  218



>emb|CDY38217.1| BnaA09g11720D [Brassica napus]
Length=533

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 87/165 (53%), Gaps = 42/165 (25%)
 Frame = +1

Query  307  TLFDMMSKE-----QSRNFRQSPEARHRV-----------------QERISRVLAHAPFQ  420
            TLF+MMS E     Q +N      +R R                   +RIS +L      
Sbjct  62   TLFEMMSSEAGSPVQIQNLALPSSSRTRTTNGSHLVISAQDKQALAMQRISNLLM-----  116

Query  421  SPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-------  579
              +R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL        
Sbjct  117  --TRSPGNQFNDPASS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAVKLSDRWSKQQ  172

Query  580  ----RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
                 S  + VEI DCDDVEVY++T++LMYC DL+KK++ + VS+
Sbjct  173  QMAPSSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRQDVSR  217



>gb|KHN16799.1| BTB/POZ domain-containing protein [Glycine soja]
Length=429

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 19/119 (16%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  555
            + +RIS +L        SR+ GN  +   S  D+KLT++++DG   VSM+VHR++L   S
Sbjct  1    MMQRISELLG-------SRSPGNQFNDPLSS-DIKLTLSSKDG-ISVSMNVHRQILVAHS  51

Query  556  RFFAEKL----------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            RFF+ KL          R    + VEI DCDDVEVY++T+ LMYC+DL+KKL+ E VS+
Sbjct  52   RFFSVKLSDRWTNLQQQRSPVPYEVEIADCDDVEVYIETLRLMYCKDLRKKLMREDVSR  110



>ref|XP_004976580.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Setaria 
italica]
Length=549

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 40/163 (25%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRV------------------------QERISRVLAHAP  414
            TLFDMM+ EQ  + R +    H +                        Q+RI+ ++    
Sbjct  58   TLFDMMANEQDYHPRTAAAGVHSIPAPPPQHPHHQLQPARSMDRQVMLQDRIADLIGSC-  116

Query  415  FQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL------  576
              SP    GN  + + S  DV+LT+ ++DG   V++ VHR +L   SRFFA KL      
Sbjct  117  --SP----GNQFNDADSS-DVRLTLTSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWSK  168

Query  577  -RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             +R+  H VEI DCDD+EVY +T+ LMYC+DL+++L+ E V+K
Sbjct  169  QQRTLPHIVEISDCDDIEVYAETLRLMYCKDLRRRLMREDVNK  211



>dbj|BAJ96039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 84/154 (55%), Gaps = 24/154 (16%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSR---------------ADG  441
            TLFDMM+ EQ    R +  A              AP +S  R               + G
Sbjct  64   TLFDMMANEQDYQPRSAAAAHSAPPHPHQHHNPLAPARSMDRQALLQDRVAELIGSCSPG  123

Query  442  NFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSV  600
            N  + + S  DV+LT++++DG   +++ VHR +L   SRFFA KL       +R+  H V
Sbjct  124  NQFNDADSS-DVRLTLSSKDGL-SLTLCVHRHILVAHSRFFAAKLSDRWSKQQRTLPHIV  181

Query  601  EILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            EI DCDDVEVYV+T+ LMYC+DL+++L+ E V+K
Sbjct  182  EISDCDDVEVYVETLRLMYCKDLRRRLMREDVAK  215



>emb|CDY08328.1| BnaC09g12680D [Brassica napus]
Length=532

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 86/157 (55%), Gaps = 27/157 (17%)
 Frame = +1

Query  307  TLFDMMSKE-----QSRNFRQSPEARHRVQERISRVLAHAPFQS----------PSRADG  441
            TLF+MMS E     Q +N      +R     R   V++    Q+           +R+ G
Sbjct  62   TLFEMMSSEAGSPVQIQNLALPSSSRTTNANRSHLVISAQDKQALAMQRISNLLMTRSPG  121

Query  442  NFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------RSGS  591
            N  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL            S  
Sbjct  122  NQFNDPASS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAVKLSDRWSKQQMAPSSSP  179

Query  592  HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            + VEI DCDDVEVY++T++LMYC DL+KK++ + VS+
Sbjct  180  YIVEISDCDDVEVYIETLMLMYCRDLRKKMMRQDVSR  216



>gb|KDO76298.1| hypothetical protein CISIN_1g006210mg [Citrus sinensis]
Length=656

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 11/101 (11%)
 Frame = +1

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  579
            +R+ GN  +   S  D+KLT++++DG   +S++VHR++L   SRFFA KL         +
Sbjct  239  TRSPGNQFNELTSS-DIKLTLSSKDG-ISLSLNVHRQILVAHSRFFAVKLSDRWTKQQQK  296

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             +  + VEI DCDDVEVY++T+ LMYC+DLKKKL+ E VSK
Sbjct  297  TTLPYIVEIADCDDVEVYIETLRLMYCKDLKKKLMREDVSK  337



>ref|XP_010922477.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Elaeis 
guineensis]
Length=544

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 27/134 (20%)
 Frame = +1

Query  307  TLFDMMSKEQ-SRNFRQS-----PEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG  468
            TLF+M+S+E  SR           + R R++ERIS+VL+               +G+  G
Sbjct  97   TLFEMISQEDLSRRVPPPPPSSSEQKRRRLEERISKVLS--------------TEGTRWG  142

Query  469  -GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----RSGS-HSVEILDCDDVEV  630
              DV+L++++ DG+ + SM VHRRVLA RSRFFAEKL       GS   VEI +CDDVEV
Sbjct  143  PADVELSVSSSDGF-RFSMAVHRRVLASRSRFFAEKLEGIVGTLGSPVVVEICECDDVEV  201

Query  631  YVKTVVLMYCEDLK  672
            YV+ V +MYC DL+
Sbjct  202  YVEAVAMMYCRDLR  215



>gb|KJB20610.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
 gb|KJB20611.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
Length=638

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 89/162 (55%), Gaps = 41/162 (25%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQS--------------------P  426
            TLF+MM+ E        P+   R Q +I +V    P Q+                     
Sbjct  168  TLFEMMASE--------PDVHPRTQTQI-QVPISGPGQNQPPPVIDKQVLTMQRISNLLS  218

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRS  585
            +R+ GN  +   S  D+KLT++++DG   VSM+VHR+++   SRFFA KL       +R+
Sbjct  219  TRSPGNQFNDPDSS-DIKLTLSSKDG-ISVSMNVHRQIVVAHSRFFAVKLSDRWAKQQRN  276

Query  586  GS---HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            GS   + VEI DCDDVEVY++T+ LMYC+DL+K L+ E V K
Sbjct  277  GSAGPYIVEIADCDDVEVYIETLKLMYCKDLRKTLMREDVPK  318



>ref|XP_006439497.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
 gb|ESR52737.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
Length=653

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 69/101 (68%), Gaps = 11/101 (11%)
 Frame = +1

Query  427  SRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---------R  579
            +R+ GN  +   S  D+KLT++++DG   +S++VHR++L   SRFFA KL         +
Sbjct  236  TRSPGNQFNELTSS-DIKLTLSSKDG-ISLSLNVHRQILVAHSRFFAVKLSDRWTKQQQK  293

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             +  + VEI DCDDVEVY++T+ LMYC+DLKKKL+ E VSK
Sbjct  294  TTLPYIVEIADCDDVEVYIETLRLMYCKDLKKKLMREDVSK  334



>ref|XP_004300808.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Fragaria 
vesca subsp. vesca]
Length=616

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 25/154 (16%)
 Frame = +1

Query  307  TLFDMMSKEQS----------RNFRQSPEARHRVQERISRVLAHAPFQSPSRADGN-FID  453
            TLF+MMS E            +N   +P     VQ++ + ++        SR+ G+ F D
Sbjct  148  TLFEMMSSEPEMANPKPAQIHQNGVVAPPRTGLVQDKQALMMQRVSDLLGSRSPGSQFND  207

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR-----------SGSHSV  600
             + S  D+KLT+ A+DG+  VSM +HR +L   SRFFA KL             S  ++V
Sbjct  208  PTNS--DIKLTLGAKDGF-SVSMSLHRPILIAHSRFFAVKLSERWVKQQRTAASSPPYNV  264

Query  601  EILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            EI DCDDVEVY++ + LMYC+DL+K+L+ E V++
Sbjct  265  EIADCDDVEVYIEALRLMYCKDLRKRLMKEDVTR  298



>ref|XP_002446981.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
 gb|EES11309.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
Length=552

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 90/164 (55%), Gaps = 41/164 (25%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQS---------PEARHR----------------VQERISRVLAHA  411
            TLFDMM+ EQ  + R +         P   H+                +Q+RI+ ++   
Sbjct  61   TLFDMMANEQDYHPRSAAAAAGVHSIPAPPHQPHHQLQPVRSMDRQMLLQDRIADLIG--  118

Query  412  PFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-----  576
                 S + GN  + + S  DV+LT++++DG   V++ VHR +L   SRFFA KL     
Sbjct  119  -----SCSPGNQFNDADSS-DVRLTLSSKDGL-SVTLCVHRHILVAHSRFFAAKLSDRWS  171

Query  577  --RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              +R+  H VEI DCDDVEVY +T+ LMYC+DL+++L+ E V+K
Sbjct  172  KQQRTLPHIVEISDCDDVEVYAETLRLMYCKDLRRRLMREDVNK  215



>ref|XP_008783774.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Phoenix 
dactylifera]
Length=517

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 27/134 (20%)
 Frame = +1

Query  307  TLFDMMSKEQ------SRNFRQSPEARHRVQERISRVLA-HAPFQSPSRADGNFIDGSGS  465
            TLF+M+S+E               + R R++E I+++L+   P   P+            
Sbjct  70   TLFEMISQEDLSRRGPPPPPSSGDQKRRRLEEMITKILSTEGPRWGPA------------  117

Query  466  GGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCDDVEV  630
              DV+L++++ DG+ + SM VHRRVLAGRSRFFAEKL   G        VEI +CDDVEV
Sbjct  118  --DVELSVSSGDGF-RFSMAVHRRVLAGRSRFFAEKLEGIGVALGSPVVVEICECDDVEV  174

Query  631  YVKTVVLMYCEDLK  672
            Y + V LMYC DL+
Sbjct  175  YAEAVGLMYCRDLR  188



>ref|XP_009341340.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus 
x bretschneideri]
Length=653

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 78/122 (64%), Gaps = 22/122 (18%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            + +R+S +L      + +R+ GN F D S S  D+KLT++++DG+  VSM+VHR++L   
Sbjct  222  MMQRVSHLL------TGNRSPGNQFNDPSSS--DIKLTLSSKDGF-SVSMNVHRQILVAH  272

Query  553  SRFFAEKLRR------------SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGV  696
            SRFFA KL              S  ++VEI DCDDVEVY++ + LMYC+DL+++L+ E V
Sbjct  273  SRFFAVKLSERWVKQQRTAPSSSPPYNVEIADCDDVEVYIEALRLMYCKDLRRRLMKEDV  332

Query  697  SK  702
             K
Sbjct  333  PK  334



>ref|XP_010555851.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Tarenaya 
hassleriana]
Length=539

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 74/116 (64%), Gaps = 21/116 (18%)
 Frame = +1

Query  382  ERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSR  558
            ++IS +LA       SR+ GN F D + S  DVKLT++++DG   ++M VHR++L   SR
Sbjct  108  QKISDLLA-------SRSPGNQFNDPTSS--DVKLTLSSKDG-ISITMSVHRQILVAHSR  157

Query  559  FFAEKLR----------RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGV  696
            FFA KL            S  + VEI DCDDVEVY++T++LMYC DL+KKL+ + V
Sbjct  158  FFAMKLSDRWSKQQRPPSSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKLMRQDV  213



>ref|XP_009419272.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 79/143 (55%), Gaps = 29/143 (20%)
 Frame = +1

Query  307  TLFDMMSKEQ------SRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSG  468
            TLF+M++ E       SR      + R R+ ERI+ ++A    + P              
Sbjct  59   TLFEMITHEDLARRVSSRTHPSGDQKRLRLLERIAAMIAK---EGP--------------  101

Query  469  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCDDVEVY  633
            GDV+L++++ DG+ +V M VHRRVLA  SRFFAEKL   G        VEI DCDD EVY
Sbjct  102  GDVELSVSSGDGF-RVPMAVHRRVLAAGSRFFAEKLAGIGGGPGRPVMVEICDCDDAEVY  160

Query  634  VKTVVLMYCEDLKKKLIGEGVSK  702
            V+ V LMY  DL++ L GE V +
Sbjct  161  VEVVGLMYSTDLRRSLAGEDVER  183



>gb|EPS69450.1| hypothetical protein M569_05314, partial [Genlisea aurea]
Length=512

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 74/116 (64%), Gaps = 17/116 (15%)
 Frame = +1

Query  379  QERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSR  558
            Q+R++ +LA       SR+ GN  +   SG DVKLT++++DG   +S++VHR +L   SR
Sbjct  86   QQRLTDLLA-------SRSPGNQFNDPVSG-DVKLTLSSKDG-VDISINVHRHILVAHSR  136

Query  559  FFAEKL--------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            FFA KL        R SG   VEI DCDD+EVY++T+ LMY +DL +KL+ E V +
Sbjct  137  FFALKLNEKWAQQQRSSGPFLVEIADCDDIEVYIETLRLMYSKDLGRKLMKEDVPR  192



>gb|KFK38021.1| hypothetical protein AALP_AA3G059800 [Arabis alpina]
Length=537

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 11/100 (11%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS------  591
            R+ GN  + S S  DVKLT++++DG   ++M VHR++L   SRFFA KL    S      
Sbjct  119  RSPGNQFNDSNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQSSSS  176

Query  592  ---HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
               + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  177  SSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  216



>gb|AAZ68003.1| At5g63850-like protein [Arabidopsis lyrata]
Length=233

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 66/101 (65%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDGIS-ITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++ + VS+
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRQDVSR  107



>ref|XP_001762013.1| predicted protein [Physcomitrella patens]
 gb|EDQ73117.1| predicted protein, partial [Physcomitrella patens]
Length=439

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 87/148 (59%), Gaps = 30/148 (20%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRV--------QERISRVLAHAPFQSPSRADGN-FIDGS  459
            TLF+MM+ EQ       P+A H +        QE++  +L+     SP    GN F D +
Sbjct  10   TLFEMMTHEQEL----GPKAVHSISLSQQLTFQEKMKSILSGT---SP----GNQFNDTT  58

Query  460  GSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSGSHSVEILDCD  618
             S  D+KL++  R+G   V+++VHR +L   SRFFA KL       +R+  + +EI D D
Sbjct  59   TS--DLKLSLNNREG-CSVTVNVHRHILVTHSRFFAAKLSDRWLKQQRANPNLIEITDID  115

Query  619  DVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            DVE+Y++T+ LMYCED+KK L+ E V++
Sbjct  116  DVEIYLETLRLMYCEDVKKSLLKENVNR  143



>ref|XP_002974611.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
 gb|EFJ24131.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
Length=450

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 73/117 (62%), Gaps = 18/117 (15%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            VQE++  +L         R+ GN F D S S  DVKLTI  RDG+  VS++VHR +L  +
Sbjct  27   VQEKVDAILLL-------RSPGNQFNDPSSS--DVKLTITGRDGF-SVSINVHRHILTAQ  76

Query  553  SRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFFA K         R   ++VEI DC+DV++Y++T+ LMYC DL++ LI E V++
Sbjct  77   SRFFAAKFSDWWSKQHRMPLNAVEISDCEDVDLYLQTIRLMYCRDLRRSLIKESVTR  133



>ref|XP_009397488.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 81/144 (56%), Gaps = 30/144 (21%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSP-------EARHRVQERISRVLAHAPFQSPSRADGNFIDGSGS  465
            TLF+MMS+E   +    P       + R R+QE+I+ +LA    + P             
Sbjct  58   TLFEMMSQEGVPHRTYPPPRQPSGDQNRLRLQEKIAAILAR---EGP-------------  101

Query  466  GGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCDDVEV  630
             GD++L++++ DG+ +V++  HRRVLA RSRFFAEKL   G       +VEI +CDD E 
Sbjct  102  -GDMELSVSSSDGF-RVTVTAHRRVLAARSRFFAEKLAGVGGRPGRPVAVEICECDDAEA  159

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+ V LMY  D ++ L GE V K
Sbjct  160  YVEAVGLMYSGDPRRSLAGEDVDK  183



>ref|XP_002963321.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
 gb|EFJ35192.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
Length=450

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 73/117 (62%), Gaps = 18/117 (15%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            VQE++  +L         R+ GN F D S S  DVKLTI  RDG+  +S++VHR +L  +
Sbjct  27   VQEKVDAILLL-------RSPGNQFNDPSSS--DVKLTITGRDGF-SISINVHRHILTAQ  76

Query  553  SRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFFA K         R   ++VEI DC+DV++Y++T+ LMYC DL++ LI E V++
Sbjct  77   SRFFAAKFSDWWSKQHRMPLNAVEISDCEDVDLYLQTIRLMYCRDLRRSLIKESVTR  133



>ref|XP_002887934.1| hypothetical protein ARALYDRAFT_315042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64193.1| hypothetical protein ARALYDRAFT_315042 [Arabidopsis lyrata subsp. 
lyrata]
Length=548

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 66/101 (65%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++ + VS+
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRQDVSR  227



>gb|AAZ67992.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  107



>gb|AAZ67986.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67987.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67988.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67989.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67990.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67991.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67993.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67994.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67995.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67996.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67997.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ68002.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  107



>ref|XP_009363413.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus 
x bretschneideri]
Length=651

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 76/122 (62%), Gaps = 22/122 (18%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            + +R+S +L        +R+ GN F D S S  D+KLT++++DG+  VSM+VHR++L   
Sbjct  220  MMQRVSDLLTE------NRSPGNQFNDPSSS--DIKLTLSSKDGF-SVSMNVHRQILVAH  270

Query  553  SRFFAEKLRR------------SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGV  696
            SRFFA KL              S  ++VEI DCDDVEVY++ + LMYC+DL++ L+ E V
Sbjct  271  SRFFAVKLSERWVKQQRMTLSSSPPYNVEIADCDDVEVYIEALRLMYCKDLRRWLMKEDV  330

Query  697  SK  702
             K
Sbjct  331  PK  332



>gb|AAZ67998.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ67999.1| At5g63850, partial [Arabidopsis thaliana]
 gb|AAZ68000.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  107



>gb|KJB24321.1| hypothetical protein B456_004G139400 [Gossypium raimondii]
Length=518

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-------RRSG  588
            R+ GN  +  GS  D+KLT++++DG   VSM+VH+++L   SRFF  KL       + +G
Sbjct  101  RSPGNKFNDPGSS-DIKLTLSSKDG-ISVSMNVHKQILVAHSRFFEVKLSDKLAKYQWNG  158

Query  589  S---HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            S   + VEI DCDDVEVY++T+ LMYC+ L+K+L+  G+SK
Sbjct  159  SAEVYMVEITDCDDVEVYIETLRLMYCKYLRKELMRNGISK  199



>ref|XP_010676445.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Beta 
vulgaris subsp. vulgaris]
Length=585

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 76/123 (62%), Gaps = 23/123 (19%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRS  555
            +Q RI+ +LA+    SP    GN  +  GS  D++LT++++DG+  V + VHR +L G S
Sbjct  151  LQLRINEILANT---SP----GNQFNDLGSS-DIRLTLSSKDGF-SVDLCVHRHILVGHS  201

Query  556  RFFAEKL---RRSGSH-----------SVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEG  693
            RFFA K       GS+           SVEI DCDDVEVY++T+ LMYC+DL++KL+ E 
Sbjct  202  RFFAGKFGFKNHRGSNGNGNGVETTPFSVEISDCDDVEVYIETLRLMYCKDLRRKLMRED  261

Query  694  VSK  702
            V K
Sbjct  262  VLK  264



>gb|EMT26347.1| hypothetical protein F775_16772 [Aegilops tauschii]
Length=451

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 18/117 (15%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGR  552
            +Q+R++ ++      SP    GN F D   S  DV+LT++++DG   +++ VHR +L   
Sbjct  7    LQDRVAELIGSC---SP----GNQFNDADSS--DVRLTLSSKDG-LSLTLCVHRHILVAH  56

Query  553  SRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            SRFFA KL       +R+  H VEI DCDDVEVYV+T+ LMYC+DL+++L+ E V+K
Sbjct  57   SRFFAAKLSDRWSKQQRTLPHIVEISDCDDVEVYVETLRLMYCKDLRRRLMREDVAK  113



>ref|XP_010430498.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Camelina 
sativa]
Length=549

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  130  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  187

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  188  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRNDVSR  228



>ref|XP_010418426.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Camelina 
sativa]
Length=548

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  227



>ref|NP_176570.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q9CAJ9.1|Y1385_ARATH RecName: Full=BTB/POZ domain-containing protein At1g63850 [Arabidopsis 
thaliana]
 gb|AAG52452.1|AC010852_9 hypothetical protein; 43750-42004 [Arabidopsis thaliana]
 gb|AEE34156.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=548

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  227



>ref|XP_006302105.1| hypothetical protein CARUB_v10020096mg [Capsella rubella]
 gb|EOA35003.1| hypothetical protein CARUB_v10020096mg [Capsella rubella]
Length=548

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  129  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  186

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  187  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  227



>ref|XP_010473631.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Camelina 
sativa]
Length=547

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 65/101 (64%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DVKLT++++DG   ++M VHR++L   SRFFA KL           
Sbjct  128  RSPGNQFNDPNSS-DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAIKLSDRWSKQQLPP  185

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  186  SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  226



>ref|XP_006828235.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Amborella 
trichopoda]
 gb|ERM95651.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
Length=489

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 17/134 (13%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHRVQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLT  486
            TL +MMS       +      H++QER+ ++++                     GDVKL 
Sbjct  45   TLLEMMSNNHEDPPKLPENPHHKLQERVDKIISGFTL--------------SESGDVKLK  90

Query  487  IAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVVLMY-C  660
            + +++G+  VSM V RRVL G+S FF  KL  +   H VEI DCDDVE YV+T+VLM+  
Sbjct  91   LRSKEGF-SVSMRVQRRVLVGKSGFFVGKLPDKKAGHLVEIEDCDDVEAYVETLVLMHSS  149

Query  661  EDLKKKLIGEGVSK  702
            EDL+K+L+ E + +
Sbjct  150  EDLRKRLMKEELQR  163



>ref|XP_002875751.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52010.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=128

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 11/80 (14%)
 Frame = +1

Query  469  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL---RRSG-SHS--VEILDCDDVEV  630
            GDVKLT+  RDG+ +V+MDVH++VL+ +S+FF EK+   R +G SHS  VEI +C DVE 
Sbjct  13   GDVKLTLVGRDGY-RVTMDVHKKVLSEKSKFFREKMKYRRENGVSHSQMVEISECGDVE-  70

Query  631  YVKTVVLMYCEDLKKKLIGE  690
               TVVL YC+DL+ KL G+
Sbjct  71   ---TVVLKYCDDLQNKLFGQ  87



>gb|AAZ68001.1| At5g63850, partial [Arabidopsis thaliana]
Length=236

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 62/101 (61%), Gaps = 12/101 (12%)
 Frame = +1

Query  430  RADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR----------  579
            R+ GN  +   S  DV  T+++ DG   ++M VHR++L   SRFFA KL           
Sbjct  9    RSPGNQFNDPNSS-DVXXTLSSXDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLPP  66

Query  580  RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             S  + VEI DCDDVEVY++T++LMYC DL+KK++   VS+
Sbjct  67   SSSPYIVEISDCDDVEVYIETLMLMYCRDLRKKMMRHDVSR  107



>ref|XP_008665486.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Zea mays]
 ref|XP_008665487.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Zea mays]
 tpg|DAA51621.1| TPA: hypothetical protein ZEAMMB73_771347 [Zea mays]
Length=534

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  630
            G     D+K+ +  +DG   V M VH+  LAG S FFA+KL  +S + S+E+ DC+DVE+
Sbjct  130  GQLETSDLKVVLYGKDG-VAVKMSVHKNTLAGNSTFFADKLSGQSPASSIEVTDCEDVEI  188

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC D+K++LI + V +
Sbjct  189  YVETVGLMYCSDVKQRLIKQTVPR  212



>ref|XP_002522395.1| protein binding protein, putative [Ricinus communis]
 gb|EEF40079.1| protein binding protein, putative [Ricinus communis]
Length=532

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G     D+K+ +  + G+  V + VHR VL G S FFA+KL +  S+   +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHRNVLVGNSSFFADKLSKEESNISCLEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++LI + VS+
Sbjct  182  IYVETMGLMYCKDMKQRLIKQSVSR  206



>dbj|BAK06120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+++ +  +DG   V M VH+ +LA  S FFA+KL R+S   S+E+ DC+DVE+
Sbjct  121  GQIEMSDLRIVLYGKDG-VAVKMSVHKNILAENSSFFADKLSRQSPVSSIEVPDCEDVEI  179

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC D+K++LI + V +
Sbjct  180  YVETVGLMYCNDVKQRLIKQSVPR  203



>ref|XP_006391703.1| hypothetical protein EUTSA_v10023392mg [Eutrema salsugineum]
 gb|ESQ28989.1| hypothetical protein EUTSA_v10023392mg [Eutrema salsugineum]
Length=554

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 14/102 (14%)
 Frame = +1

Query  430  RADGN-FIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR---------  579
            R+ GN F D + S  DVKLT++++DG   ++M VHR++L   SRFFA KL          
Sbjct  135  RSPGNQFNDPTSS--DVKLTLSSKDG-ISITMCVHRQILVAHSRFFAMKLSDRWSKQQLP  191

Query  580  -RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
              S  + VEI DCDDVEVY++T++LMY  D +KK++ + VS+
Sbjct  192  PSSSPYIVEISDCDDVEVYIETLMLMYSRDPRKKMMRQDVSR  233



>ref|XP_004981619.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Setaria italica]
 ref|XP_004981620.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Setaria italica]
 ref|XP_004981621.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X3 [Setaria italica]
Length=526

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  648
            D+K+ +  +DG   V M VH+ +LA  S FFA+KL R++   S+E+ DC+DVE+YV+TV 
Sbjct  129  DLKVVLYGKDG-VAVKMSVHKNILAENSTFFADKLSRQTPVSSLEVTDCEDVEIYVETVG  187

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC D+K++LI + V +
Sbjct  188  LMYCSDVKQRLIKQTVPR  205



>ref|XP_007203630.1| hypothetical protein PRUPE_ppa003965mg [Prunus persica]
 gb|EMJ04829.1| hypothetical protein PRUPE_ppa003965mg [Prunus persica]
Length=537

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  +EI +CDDVE
Sbjct  128  GEPGSSDMKVVLLGKQGFC-VKLSVHKNVLVEHSNFFADKLSEQQSGSSCLEIEECDDVE  186

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D++++L+ + VS+
Sbjct  187  IYVETVGLMYCKDMRQRLMKQSVSR  211



>ref|XP_008241873.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Prunus 
mume]
Length=529

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  +EI +CDDVE
Sbjct  120  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVEHSNFFADKLSEQQSGSSCLEIEECDDVE  178

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D++++L+ + VS+
Sbjct  179  IYVETVGLMYCKDMRQRLMKQSVSR  203



>gb|EAY91984.1| hypothetical protein OsI_13674 [Oryza sativa Indica Group]
Length=522

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  648
            D+K+ +  +DG   V M VHR +LA  S +FA+KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  127  DLKVVLYGKDG-VAVKMSVHRNILAENSTWFADKLSRQSPMSSMEVPDCEDVEIYVETVG  185

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC D K++LI + V +
Sbjct  186  LMYCNDAKQRLIKQSVPR  203



>ref|NP_001051395.1| Os03g0769400 [Oryza sativa Japonica Group]
 gb|AAR87334.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAT85043.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99073.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99074.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99075.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13309.1| Os03g0769400 [Oryza sativa Japonica Group]
 gb|EAZ28713.1| hypothetical protein OsJ_12730 [Oryza sativa Japonica Group]
Length=522

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  648
            D+K+ +  +DG   V M VHR +LA  S +FA+KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  127  DLKVVLYGKDG-VAVKMSVHRNILAENSTWFADKLSRQSPMSSMEVPDCEDVEIYVETVG  185

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC D K++LI + V +
Sbjct  186  LMYCNDAKQRLIKQSVPR  203



>ref|XP_008808898.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808899.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808900.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=528

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VHR ++A  SRFFA+KL R+S    +EI++C+DVE+
Sbjct  124  GQPETSDLKVLLFGKEG-IAVKMSVHRNIIAEHSRFFADKLSRQSPVPYIEIMNCEDVEI  182

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K +LI + V +
Sbjct  183  YVETVGLMYCKEMKHRLIKQSVPR  206



>ref|XP_008338977.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At3g50780-like [Malus domestica]
Length=531

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  + I DCDDVE
Sbjct  129  GEPGTSDMKVVLLGKQGFC-VKLSVHKNVLVEHSNFFADKLSEQQSGSXCLNIEDCDDVE  187

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D++++L+ + VS+
Sbjct  188  IYVETVGLMYCKDMRQRLMKQSVSR  212



>ref|XP_002990647.1| hypothetical protein SELMODRAFT_185507 [Selaginella moellendorffii]
 gb|EFJ08279.1| hypothetical protein SELMODRAFT_185507 [Selaginella moellendorffii]
Length=551

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 19/118 (16%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARD--GWPKVSMDVHRRVLAG  549
            +QER++ +L+  P  +       F D S S  DVKLT+ +RD  G   V++ VH RVL  
Sbjct  89   LQERVNAILS-CPLNT-------FNDASTS--DVKLTLISRDVVGGLTVTVHVHTRVLVA  138

Query  550  RSRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             SR+FA KL         +  +SVEI DC+DVE+Y+ T+ LMY  D K+ L+ E V +
Sbjct  139  SSRYFAAKLAYRQQQVHTAAPYSVEISDCEDVEIYLLTIRLMYSSDFKRMLLHENVQR  196



>ref|XP_010941741.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941747.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941755.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VHR +LA  S FFA+KL R+S    +EI+DC+DVE+
Sbjct  124  GQPETSDLKVILFGKEG-IAVRMSVHRNILAEHSIFFADKLSRQSPVPYIEIMDCEDVEI  182

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K +LI + V +
Sbjct  183  YVETVGLMYCKEMKHRLIKQSVPR  206



>ref|XP_002968764.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
 gb|EFJ29880.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
Length=464

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 19/118 (16%)
 Frame = +1

Query  376  VQERISRVLAHAPFQSPSRADGNFIDGSGSGGDVKLTIAARD--GWPKVSMDVHRRVLAG  549
            +QER++ +L+  P  +       F D S S  DVKLT+ +RD  G   V++ VH RVL  
Sbjct  16   LQERVNAILS-CPLNT-------FNDASTS--DVKLTLISRDVVGGLTVTVHVHTRVLVA  65

Query  550  RSRFFAEKL-------RRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
             SR+FA KL         +  +SVEI DC+DVE+Y+ T+ LMY  D K+ L+ E V +
Sbjct  66   SSRYFAAKLAYRQQQVHTAAPYSVEISDCEDVEIYLLTIRLMYSSDFKRMLLHENVQR  123



>gb|EMT31851.1| hypothetical protein F775_21356 [Aegilops tauschii]
Length=559

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  648
            D+++ +  +DG   V M VH+ +LA  S FF++KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  162  DLRVVLYGKDG-VAVKMSVHKNILAENSTFFSDKLARQSPVSSIEVPDCEDVEIYVETVG  220

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC D+K++LI + V +
Sbjct  221  LMYCNDVKQRLIKKSVPR  238



>ref|NP_001058798.2| Os07g0123500 [Oryza sativa Japonica Group]
 dbj|BAC83795.1| PRLI-interacting factor G-like protein [Oryza sativa Japonica 
Group]
 dbj|BAH00971.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81446.1| hypothetical protein OsI_24731 [Oryza sativa Indica Group]
 gb|EEE66492.1| hypothetical protein OsJ_22937 [Oryza sativa Japonica Group]
 dbj|BAF20712.2| Os07g0123500 [Oryza sativa Japonica Group]
Length=527

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  R+G   V M VH+ +LA  S FFA+KL R+S    +E+ DC+DVE+
Sbjct  124  GQLHTSDLKVMLYGREG-VAVKMIVHKNILAENSTFFADKLSRQSPVSCIEVSDCEDVEI  182

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            +V+TV LMYC+D+K++LI + V++
Sbjct  183  FVETVGLMYCKDVKQRLIKQAVAR  206



>ref|XP_009376454.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
Length=536

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++SGS  + I DCDDVE
Sbjct  127  GEPGTSDMKVVLLGKKGFC-VKLSVHKNVLVEHSNFFADKLSEQQSGSTCLNIEDCDDVE  185

Query  628  VYVKTVVLMYCEDLKKKLIGEGVS  699
            +YV+TV LMYC+D++++L+ + VS
Sbjct  186  IYVETVGLMYCKDMRQRLMKQSVS  209



>ref|XP_010243288.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
 ref|XP_010243289.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=538

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G  +  D+K+ ++ + G+  V M VH+ VL   S FFAEKL +  S    +E+ DC+DVE
Sbjct  122  GEPATSDLKVVLSGKQGF-SVKMSVHKNVLVENSSFFAEKLSQQESPLTCLELGDCEDVE  180

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+++K++LI + VS+
Sbjct  181  IYVETVGLMYCKEMKQRLIKQSVSR  205



>ref|XP_009419041.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419043.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=526

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  633
            G     D+K+T+  + G   V M VH+ +LA  S FFA+KL       +E+ DC+DVE++
Sbjct  125  GQLETSDLKVTLHGKGG-TSVRMSVHKNILAENSSFFADKLSGLSVPQIEMADCEDVEIF  183

Query  634  VKTVVLMYCEDLKKKLIGEGVSK  702
            V+TV LMYC+D+K +LI + VS+
Sbjct  184  VETVGLMYCKDIKHRLIKQSVSR  206



>ref|XP_006650658.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=521

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVV  648
            D+K+ +  +DG   V M VHR  LA  S +FA+KL R+S   S+E+ DC+DVE+YV+TV 
Sbjct  127  DLKVVLYGKDG-VAVKMSVHRNTLAENSTWFADKLSRQSPISSMEVPDCEDVEIYVETVG  185

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC D K++LI + V +
Sbjct  186  LMYCNDAKQRLIKQSVPR  203



>ref|XP_008338182.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Malus 
domestica]
Length=536

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  +++GS  + I DCDDVE
Sbjct  127  GEPGTSDMKVVLLGKKGFC-VKLSVHKNVLVEHSNFFADKLSEQQTGSTCLNIZDCDDVE  185

Query  628  VYVKTVVLMYCEDLKKKLIGEGVS  699
            +YV+TV LMYC+D++++L+ + VS
Sbjct  186  IYVETVGLMYCKDMRQRLMKQSVS  209



>ref|XP_008797004.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=526

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V + VHR +LA  S FFA+KL R+S    +EI+DC+DVE+
Sbjct  124  GQPETSDLKVILFGKEGI-AVRIGVHRNILAEHSSFFADKLSRQSPVPYIEIMDCEDVEI  182

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K +LI + V +
Sbjct  183  YVETVGLMYCKEVKHRLIKQSVPR  206



>ref|XP_003548003.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Glycine 
max]
Length=543

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I DC+DVE+
Sbjct  133  GEPGTCDMKVVLLGKQGFC-VKLSVHRDVLTQKSGFFSEKLSEQSGLSCLQIADCEDVEI  191

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  192  YVETVGLMYCKEMKQRLMKQSVSR  215



>ref|XP_012079112.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Jatropha 
curcas]
 gb|KDP31825.1| hypothetical protein JCGZ_12286 [Jatropha curcas]
Length=534

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S+   +EI DC+D+E
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVENSSFFADKLSEEESNLSCLEIDDCEDIE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D+K++LI + VS+
Sbjct  182  IYVETVGLMYCKDMKQRLIKQSVSR  206



>ref|XP_002307226.1| hypothetical protein POPTR_0005s13800g [Populus trichocarpa]
 gb|EEE94222.1| hypothetical protein POPTR_0005s13800g [Populus trichocarpa]
Length=518

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH++VL   SRFFA KL    S+   +EI DC+D+E
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKKVLEENSRFFANKLSEEESNLSCLEIDDCEDIE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+++K++LI + VS+
Sbjct  182  IYVETMGLMYCKEMKQRLIKQSVSR  206



>ref|XP_003517262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Glycine max]
 ref|XP_006573610.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Glycine max]
Length=522

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+KL +  + G+  V + VHR VL  +S FFA+KL  +SG   +++ DC+DVE+
Sbjct  123  GEPGTCDMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSGLSCLQVDDCEDVEI  181

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  182  YVETVGLMYCKEMKQRLMKQSVSR  205



>gb|KHN36167.1| BTB/POZ domain-containing protein [Glycine soja]
Length=522

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+KL +  + G+  V + VHR VL  +S FFA+KL  +SG   +++ DC+DVE+
Sbjct  123  GEPGTCDMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSGLSCLQVDDCEDVEI  181

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  182  YVETVGLMYCKEMKQRLMKQSVSR  205



>ref|XP_009407677.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407678.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407679.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=528

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VHR +LA  S FFA+K  R+S    VEI+DC+DVE+
Sbjct  130  GQPDTSDLKVVLFGKEGI-YVRMSVHRNILAEHSSFFADKFSRQSPVPCVEIVDCEDVEI  188

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC++ K +LI + V +
Sbjct  189  YVETVGLMYCKEPKHRLIKQCVPR  212



>ref|XP_002310195.1| hypothetical protein POPTR_0007s12160g [Populus trichocarpa]
 gb|EEE90645.1| hypothetical protein POPTR_0007s12160g [Populus trichocarpa]
Length=536

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S+   +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVENSSFFADKLSEEESNLSCLEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+++K++LI + VS+
Sbjct  182  IYVETVGLMYCKEMKQRLIKQSVSR  206



>ref|XP_009379165.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
 ref|XP_009379166.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
Length=531

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++ GS  + + DCDDVE
Sbjct  129  GEPGTSDMKVVLLGKQGFC-VKLSVHKNVLVEHSNFFADKLSEQQPGSTCLNMEDCDDVE  187

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D++++L+ + VS+
Sbjct  188  IYVETVGLMYCKDMRQRLMKQSVSR  212



>ref|XP_007156873.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 ref|XP_007156874.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 gb|ESW28867.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 gb|ESW28868.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
Length=521

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+KL +  + G+  V + VHR VL  +S FFA+KL  +SG   +++ DC+DVE+
Sbjct  123  GEPGSCDMKLLLLGKQGF-CVKLSVHRDVLKEKSSFFADKLSEQSGLSCLQVDDCEDVEI  181

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  182  YVETVGLMYCKEMKQRLMKQSVSR  205



>ref|XP_009407431.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407432.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407433.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=538

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRR-SGSHSVEILDCDDVEV  630
            G     D+K+T+  ++G   + M VHR +LA  S FFA+KL R S +  VEI DC+DVE+
Sbjct  125  GRPETSDMKVTLHGKEG-SSMRMSVHRNILAEHSSFFADKLSRLSPASQVEIADCEDVEI  183

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            +++ V LMYCE++K +LI   +S+
Sbjct  184  FLEVVGLMYCEEIKCRLIKRSLSR  207



>ref|XP_011025688.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Populus 
euphratica]
Length=536

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S+   +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKNVLVENSSFFADKLPEEESNLSCLEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+++K++LI + VS+
Sbjct  182  IYVETVGLMYCKEMKQRLIKQSVSR  206



>ref|XP_002461387.1| hypothetical protein SORBIDRAFT_02g001910 [Sorghum bicolor]
 gb|EER97908.1| hypothetical protein SORBIDRAFT_02g001910 [Sorghum bicolor]
Length=543

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VH+ +LA  S FFA+++ R+S    +E+ DC+DVE+
Sbjct  126  GQLGTSDLKVVLHGKEG-VAVKMIVHKNILAENSTFFADRISRQSPVACIEVPDCEDVEI  184

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+D+K++LI + V +
Sbjct  185  YVETVGLMYCKDVKQRLIKQNVPR  208



>ref|XP_007156002.1| hypothetical protein PHAVU_003G250400g [Phaseolus vulgaris]
 gb|ESW27996.1| hypothetical protein PHAVU_003G250400g [Phaseolus vulgaris]
Length=546

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I +C+DVE+
Sbjct  130  GEPGTCDMKVILLGKQGFC-VKLSVHRNVLTEKSSFFSEKLSEQSGLSCLQIGECEDVEI  188

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  189  YVETVGLMYCKEMKQRLMKQSVSR  212



>ref|XP_009388509.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388510.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388511.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388512.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388513.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=532

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VH  +LA  SRFFA+KL  +S    +E+ DC+DVE+
Sbjct  132  GQPETSDLKVILFGKEG-ICVRMSVHWNILAENSRFFADKLAGQSPVPCLEVADCEDVEI  190

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC++LK KLI + V +
Sbjct  191  YVETVGLMYCKELKHKLIKQSVPR  214



>ref|XP_007047072.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 ref|XP_007047073.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOX91229.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOX91230.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=534

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH++VL   S FF +KL  + SG   +E+ DC+DVE
Sbjct  123  GEPGTSDMKVILLGKQGF-CVKLSVHKKVLLEHSSFFTDKLSEQESGLSCLELDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+++K++LI + VS+
Sbjct  182  IYVETVGLMYCKEMKQRLIKQSVSR  206



>ref|XP_006657417.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=524

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  R+G   V M VH+ +L+  S FFA+KL R+S    +E+ DC+DVE+
Sbjct  123  GQLHTSDLKVMLYGREG-VAVKMIVHKNILSENSTFFADKLSRQSPVSCIEVSDCEDVEI  181

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+ +K++LI + V++
Sbjct  182  YVETVGLMYCKHVKQRLIKQTVAR  205



>ref|XP_004955396.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=543

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VH+ +LA  S FFA ++ R+S    +E+ DC+DVE+
Sbjct  130  GQLGTSDLKVVLYGKEG-VAVKMIVHKNILAENSTFFANRISRQSPVSCIEVPDCEDVEI  188

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+D+K++LI + V +
Sbjct  189  YVETVGLMYCKDVKQRLIRQNVPR  212



>ref|XP_003558813.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brachypodium 
distachyon]
Length=524

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  630
            G     D+++ +  +DG   V M VH+ +LA  S  FA+KL  +S   S+E+ DC+DVE+
Sbjct  121  GQIEMSDLRVVLHGKDG-VAVKMSVHKNILAENSTLFADKLSSQSPMSSIEVSDCEDVEI  179

Query  631  YVKTVVLMYCEDLKKKLIGEGV  696
            YV+TV LMYC D++++LI + V
Sbjct  180  YVETVGLMYCSDVRQRLIKQSV  201



>gb|KHN44517.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = +1

Query  475  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVVL  651
            +K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I DC+DVE+YV+TV L
Sbjct  1    MKVVLLGKQGFC-VKLSVHRDVLTQKSGFFSEKLSEQSGMSCLQIADCEDVEIYVETVGL  59

Query  652  MYCEDLKKKLIGEGVSK  702
            MYC+++K++L+ + VS+
Sbjct  60   MYCKEMKQRLMKQSVSR  76



>ref|XP_010547478.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547479.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547480.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Tarenaya hassleriana]
Length=512

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH++VL   S FF  KL  + SG   +EI  C+DVE
Sbjct  121  GEPGTSDMKVVLLGKQGFC-VKLSVHKKVLVDNSSFFVNKLADKDSGFSCIEIDSCEDVE  179

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D+K +L+ + VS+
Sbjct  180  IYVETVGLMYCKDMKNRLMKQSVSR  204



>gb|AAX19868.1| unknown, partial [Doryanthes excelsa]
Length=194

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ ++ ++G   V M VHR +L   S FFA+KL R+S    VEI DC+DVE+
Sbjct  120  GQSETSDLKVILSGKEGI-SVRMSVHRNILLEHSSFFADKLSRQSPVSCVEIGDCEDVEI  178

Query  631  YVKTVVLMYCEDL  669
            YV+TV LMYC+++
Sbjct  179  YVETVGLMYCKEV  191



>emb|CDP02424.1| unnamed protein product [Coffea canephora]
Length=538

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+++L   SRFFA K+         +EI DCDDVE
Sbjct  125  GEPGTSDLKVILLGKQGF-AVKLSVHKKILVEHSRFFANKISEQQLVFPCLEIDDCDDVE  183

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC++LK++LI + V +
Sbjct  184  IYVETVGLMYCKELKQRLIKQSVPR  208



>ref|XP_008440171.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
melo]
 ref|XP_008440172.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
melo]
Length=534

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  633
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL      S+EI DC+DVE+Y
Sbjct  123  GEPGTSNIKVVLLGKQGF-SVKLSVHKNVLMDNSSFFANKLADQEGPSMEIGDCEDVEIY  181

Query  634  VKTVVLMYCEDLKKKLIGEGVSK  702
            V+TV LMYC+++K+ L+ + VS+
Sbjct  182  VETVGLMYCKEMKQWLMKQNVSR  204



>ref|XP_002275454.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Vitis 
vinifera]
 emb|CBI17589.3| unnamed protein product [Vitis vinifera]
Length=524

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL    S+   +EI DC+D+E
Sbjct  123  GEPGTSDMKVILMGKQGF-YVKLSVHKNVLMENSSFFADKLSEEQSNLSCLEIEDCEDIE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC++ K++LI + VS+
Sbjct  182  IYVETVGLMYCKETKQRLIKQSVSR  206



>ref|XP_004300583.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465450.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Fragaria 
vesca subsp. vesca]
Length=538

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FFA+KL  ++S S  +EI +C+DVE
Sbjct  128  GEPGTSDMKVILLGKQGFC-VKLSVHKNVLVENSNFFADKLAEQQSNSSCLEIEECEDVE  186

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC++++++L+ + VS+
Sbjct  187  IYVETVGLMYCKEMRQRLMKQSVSR  211



>ref|XP_003557600.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brachypodium 
distachyon]
Length=534

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  630
            G     D+K+ +  R+G   V M VH+ +LA  S FFA+KL  +S    +E+ DC+DVE+
Sbjct  123  GQLQTSDLKVVLYGREG-VAVKMIVHKNILAENSTFFADKLSSQSPVPFIEVPDCEDVEI  181

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            +V+TV LMYC+D+K++LI + V +
Sbjct  182  FVETVGLMYCKDVKQRLIKQNVPR  205



>ref|XP_011657811.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
sativus]
 gb|KGN48457.1| hypothetical protein Csa_6G487780 [Cucumis sativus]
Length=534

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVY  633
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL      S+EI DC+DVE+Y
Sbjct  123  GEPGTSNIKVVLLGKQGF-SVKLSVHKNVLIDNSSFFANKLADQEGPSMEIGDCEDVEIY  181

Query  634  VKTVVLMYCEDLKKKLIGEGVSK  702
            V+TV LMYC+++K+ L+ + VS+
Sbjct  182  VETVGLMYCKEMKQWLMKQNVSR  204



>ref|NP_001168062.1| hypothetical protein [Zea mays]
 ref|XP_008671020.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 gb|ACN26975.1| unknown [Zea mays]
 tpg|DAA42716.1| TPA: hypothetical protein ZEAMMB73_494397 [Zea mays]
 tpg|DAA53077.1| TPA: hypothetical protein ZEAMMB73_512829 [Zea mays]
Length=545

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +   +G   V M VH+ +LA  S FFA+++ R+S    +E+ DC+DVE+
Sbjct  126  GQLGTSDLKVVLHGMEG-VAVKMIVHKSILAENSTFFADRISRQSPVSCIEVPDCEDVEI  184

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+D+K++LI + V +
Sbjct  185  YVETVGLMYCKDVKQRLIKQNVPR  208



>gb|KHN42029.1| BTB/POZ domain-containing protein [Glycine soja]
Length=515

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS-VEILDCDDVEVYVKTVV  648
            D+KL +  + G+  V + VHR VL  +S FFA+KL    S S +++ DC+DVE+YV+TV 
Sbjct  121  DMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSSLSCLQVDDCEDVEIYVETVG  179

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC+++K++L+ + VS+
Sbjct  180  LMYCKEMKQQLMKQSVSR  197



>ref|XP_003537445.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Glycine max]
 ref|XP_006590671.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Glycine max]
Length=515

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS-VEILDCDDVEVYVKTVV  648
            D+KL +  + G+  V + VHR VL  +S FFA+KL    S S +++ DC+DVE+YV+TV 
Sbjct  121  DMKLLLLGKQGF-CVKLSVHRDVLIEKSSFFADKLSEQSSLSCLQVDDCEDVEIYVETVG  179

Query  649  LMYCEDLKKKLIGEGVSK  702
            LMYC+++K++L+ + VS+
Sbjct  180  LMYCKEMKQQLMKQSVSR  197



>dbj|BAJ95813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-----RSGSH--SVEILD  612
            G     D+ + +  ++G   V M VHR VL+G S FFAEKL        GS    VEI D
Sbjct  131  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLSGSSAFFAEKLSDGDNGHGGSPVPCVEIHD  189

Query  613  CDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            CDD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  190  CDDAEIYVETVGLMYCDEAKHKLLKQNVSR  219



>gb|EMT14102.1| hypothetical protein F775_07870 [Aegilops tauschii]
Length=518

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 9/89 (10%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH------SVEILDC  615
            G     D+ + +  ++G   V M VHR VL G S FF EKL  S  H       VEI DC
Sbjct  128  GQPETSDLTVMLYGKEGI-AVRMSVHRDVLCGSSAFFTEKL--SDGHVGSPVPCVEIHDC  184

Query  616  DDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            DD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  185  DDAEIYVETVGLMYCDEAKHKLLKQNVSR  213



>gb|KHN00573.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = +1

Query  475  VKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEVYVKTVVL  651
            +K+ +  + G+  V + VHR VL  +S FF+EKL  +SG   ++I DC+DVE+YV+TV L
Sbjct  1    MKVVLLGKQGFC-VKLSVHRDVLTQKSGFFSEKLSEQSGLSCLQIGDCEDVEIYVETVGL  59

Query  652  MYCEDLKKKLIGEGVSK  702
            MYC+++K++L+ + VS+
Sbjct  60   MYCKEMKQRLMKQSVSR  76



>ref|XP_010254985.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=539

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH--SVEILDCDDVE  627
            G  +  D+K+ ++ + G   V+M  H+ VL   S FFA++L +  S    +EI DC+DVE
Sbjct  122  GEPATSDLKVVLSGKQG-VSVTMSAHKDVLVENSSFFADRLSQQDSSLPCLEIGDCEDVE  180

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC++LK+ +I + +S+
Sbjct  181  IYVETVGLMYCKELKQIIIKQSISR  205



>gb|KEH20448.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=542

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  + G+  V + VHR VL  +S FF+EK+  +S    ++I DC+DVE+
Sbjct  131  GEPGTCDMKVVLLGKQGF-SVKLSVHRDVLIEKSSFFSEKISEQSDMSCLQIGDCEDVEI  189

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  190  YVETVGLMYCKEMKQRLMKQNVSR  213



>ref|XP_004509225.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509226.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Cicer arietinum]
Length=545

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  + G+  V + VHR VL  +S FF+EKL  +S    +++ DC+DVE+
Sbjct  134  GEPGTCDMKVVLLGKQGF-SVKLSVHRDVLIEKSSFFSEKLSEQSDLSCLQVGDCEDVEI  192

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC+++K++L+ + VS+
Sbjct  193  YVETVGLMYCKEMKQRLMKQNVSR  216



>ref|XP_009115752.1| PREDICTED: BTB/POZ domain-containing protein At3g50780, partial 
[Brassica rapa]
Length=352

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  128  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLSDKDSVFACLEIESCEDAE  186

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D+K++L+ + VS+
Sbjct  187  IYVETVGLMYCKDMKQRLMKQNVSR  211



>ref|XP_011099262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099263.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099264.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099265.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099268.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=534

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G   V + VHR +L   S FFA K+  ++     +EI DC+DVE
Sbjct  122  GEPGTSDLKVILLGKQG-VAVKLSVHRSILVENSSFFANKILSQQPFFPCIEIDDCEDVE  180

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            VYV+TV LMYC++LK++LI + VS+
Sbjct  181  VYVETVGLMYCKELKQQLIKQNVSR  205



>gb|KFK34324.1| hypothetical protein AALP_AA5G130100 [Arabis alpina]
Length=529

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = +1

Query  307  TLFDMMSKEQSRNFRQSPEARHR------VQERISRVLAHAPFQSPSRADGNFIDGSGSG  468
            T+  +++ ++  ++  +PE  H       VQER  R         P +    F  G    
Sbjct  80   TIRSVIASDEQLHYSGNPETHHSIAVPVTVQERPQRQKVET---LPRKVAIEF--GEPGS  134

Query  469  GDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVEVYVKT  642
             D K+ +  + G+  V + VH+++L   S FFA+KL    S    +EI  C+D E+YV+T
Sbjct  135  SDAKVILVGKQGFC-VKLSVHKKLLVDHSSFFAKKLAEKDSVFACLEIESCEDAEIYVET  193

Query  643  VVLMYCEDLKKKLIGEGVSK  702
            + LMYC+D+K++L+ + VS+
Sbjct  194  IGLMYCKDMKQRLMKQNVSR  213



>gb|EMS65337.1| hypothetical protein TRIUR3_32744 [Triticum urartu]
Length=559

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-----RSGSH--SVEILD  612
            G     D+ + +  ++G   V M VHR VL G S FFAEKL        GS    VEI D
Sbjct  166  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLCGSSGFFAEKLSDGDNGHGGSLVPCVEIHD  224

Query  613  CDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            CDD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  225  CDDAEIYVETVGLMYCDEAKHKLLKQNVSR  254



>gb|EYU39382.1| hypothetical protein MIMGU_mgv1a003833mg [Erythranthe guttata]
Length=561

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 7/87 (8%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSV----EILDCDD  621
            G     D+K+ +  + G   V + VHR VL   S FFA K+  SG   +    EI +C+D
Sbjct  129  GEAKTSDLKVILLGKQGL-AVKLSVHRSVLVENSDFFARKI--SGQQPIFPCLEIDNCED  185

Query  622  VEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            VE+YV+T+ LMYC++LK++LI + VS+
Sbjct  186  VEIYVETIGLMYCKELKQRLIKQSVSR  212



>ref|XP_011009912.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Populus 
euphratica]
Length=518

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRS--GSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH++VL   S FFA KL         +EI DC+DVE
Sbjct  123  GEPGTSDMKVVLLGKQGF-CVKLSVHKKVLEENSSFFANKLSEEEFSLSCLEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+++K++LI + VS+
Sbjct  182  IYVETMGLMYCKEMKQRLIKQSVSR  206



>ref|XP_006466699.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Citrus 
sinensis]
Length=535

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRS--GSHSVEILDCDDVE  627
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL     G   +EI DC+DVE
Sbjct  124  GEPGTSNIKVVLLGKQGF-CVKLSVHKNVLLENSSFFANKLSEEQFGLSCLEIDDCEDVE  182

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
             YV+TV LMYC+D+K++L+ + VS+
Sbjct  183  SYVETVGLMYCKDMKQRLMKQSVSR  207



>ref|XP_006290909.1| hypothetical protein CARUB_v10017022mg [Capsella rubella]
 gb|EOA23807.1| hypothetical protein CARUB_v10017022mg [Capsella rubella]
Length=520

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  121  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKNSVFACLEIESCEDAE  179

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++L+ + VS+
Sbjct  180  IYVETIGLMYCKDMKQRLMKQNVSR  204



>gb|KJB17837.1| hypothetical protein B456_003G018200 [Gossypium raimondii]
Length=536

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH++VL   S FF +KL  +  G   +EI DC+DVE
Sbjct  123  GEPGTSDMKVILLGKQGF-CVKLSVHKKVLMEHSCFFTDKLSGQEPGLSCLEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
             YV+TV LMYC+++K++LI + VS+
Sbjct  182  SYVETVGLMYCKEMKQRLIKQSVSR  206



>ref|XP_010941924.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941925.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLR-RSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VHR +LA  S FFA+KL   S    +EI+DC+DVE+
Sbjct  124  GQPETSDLKVILFGKEGI-VVRMSVHRNILAEHSSFFADKLSTESPVPYIEIMDCEDVEI  182

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMY +++K +LI + V +
Sbjct  183  YVETVGLMYSKEVKHRLIKQSVPR  206



>gb|KDO79424.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79425.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79426.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79427.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79428.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
Length=421

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRS--GSHSVEILDCDDVE  627
            G     ++K+ +  + G+  V + VH+ VL   S FFA KL     G   +EI DC+DVE
Sbjct  10   GEPGTSNIKVVLLGKQGFC-VKLSVHKNVLLENSSFFANKLSEEQFGLSCLEIDDCEDVE  68

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
             YV+TV LMYC+D+K++L+ + VS+
Sbjct  69   SYVETVGLMYCKDMKQRLMKQSVSR  93



>ref|XP_010558026.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Tarenaya 
hassleriana]
Length=533

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL+  S FFA KL  +  G   +EI  C+DVE
Sbjct  127  GEPGTSDMKVILLGKQGFC-VKLSVHKNVLSDNSSFFANKLAEKDPGISCLEIERCEDVE  185

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +Y++TV LMYC+D+K +L+ + VS+
Sbjct  186  IYIETVGLMYCKDMKHRLMKQSVSR  210



>ref|XP_010426621.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Camelina 
sativa]
Length=521

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  122  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  180

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++L+ + VS+
Sbjct  181  IYVETIGLMYCKDMKQRLMKQNVSR  205



>ref|XP_010503746.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Camelina 
sativa]
Length=524

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  125  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  183

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++L+ + VS+
Sbjct  184  IYVETIGLMYCKDMKQRLMKQNVSR  208



>ref|XP_006419030.1| hypothetical protein EUTSA_v10003115mg [Eutrema salsugineum]
 gb|ESQ37466.1| hypothetical protein EUTSA_v10003115mg [Eutrema salsugineum]
Length=380

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +1

Query  559  FFAEKLR-RSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGV  696
             F EK++ +S SH++EI +CDDVEV+V+TVVLM+CEDLK KLIGE V
Sbjct  82   IFMEKMKSQSQSHTLEISECDDVEVFVETVVLMHCEDLKNKLIGENV  128



>ref|XP_010515449.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Camelina 
sativa]
Length=522

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  123  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++L+ + VS+
Sbjct  182  IYVETIGLMYCKDMKQRLMKQNVSR  206



>ref|XP_008661718.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 tpg|DAA47352.1| TPA: hypothetical protein ZEAMMB73_722672 [Zea mays]
Length=530

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVL  651
            D+ + +  ++G   VSM VHR VLA  S FFA +L   G   VEI DC+D E+YV+TV L
Sbjct  127  DLTVVLYGKEG-VAVSMSVHRDVLAQSSAFFARRLAADGQPCVEIHDCEDAEIYVETVGL  185

Query  652  MYCEDLKKK  678
            MYC+D   K
Sbjct  186  MYCDDGANK  194



>ref|XP_010680938.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Beta 
vulgaris subsp. vulgaris]
Length=532

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V ++VH+ VL   S FFAEKL  +     S++I DC+DVE
Sbjct  123  GESGTSDMKVLLFGKHGF-SVKLNVHKSVLVDNSIFFAEKLDEQEPDVSSLQIFDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMY +D+K++L+ + V +
Sbjct  182  IYVETIGLMYSKDMKQRLLKQSVQR  206



>ref|XP_006404002.1| hypothetical protein EUTSA_v10010286mg [Eutrema salsugineum]
 gb|ESQ45455.1| hypothetical protein EUTSA_v10010286mg [Eutrema salsugineum]
Length=527

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  126  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLAEKDSVFACLEIESCEDAE  184

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ +MYC+D+K++L+ + VS+
Sbjct  185  IYVETIGIMYCKDMKQRLMKQNVSR  209



>ref|XP_002877770.1| hypothetical protein ARALYDRAFT_323639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54029.1| hypothetical protein ARALYDRAFT_323639 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  119  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSCFFAKKLAEKDSVFACLEIESCEDAE  177

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++L+ + VS+
Sbjct  178  IYVETIGLMYCKDMKQRLMKQNVSR  202



>emb|CDX77944.1| BnaA09g31390D [Brassica napus]
Length=512

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  117  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSSFFAKKLSDKDSVFACLEIESCEDAE  175

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D+K++L+ + VS+
Sbjct  176  IYVETVGLMYCKDMKQRLMKQSVSR  200



>ref|XP_010029862.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029863.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029864.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 gb|KCW56822.1| hypothetical protein EUGRSUZ_I02489 [Eucalyptus grandis]
Length=526

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VHR VL   S FFA+KL         +EI DC+D E
Sbjct  122  GEPGTSDMKVILLGKQGF-CVKLSVHRNVLVENSSFFAKKLLEEEDALPCLEIDDCEDAE  180

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC+D+K+++I + V +
Sbjct  181  IYVETVGLMYCKDMKQRMIKQTVPR  205



>ref|XP_009397738.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397739.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397740.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL-RRSGSHSVEILDCDDVEV  630
            G     D+K+ +  ++G   V M VH+ +L   S FFA+K  R+S     EI DC+DVE+
Sbjct  125  GQPETSDLKIILFGKEG-IAVEMSVHKAILTEHSSFFADKFSRQSPVPFFEISDCEDVEI  183

Query  631  YVKTVVLMYCEDLKKKLIGEGVSK  702
            YV+TV LMYC ++K ++I + VS+
Sbjct  184  YVETVGLMYCGEVKHRVIKQSVSR  207



>ref|NP_190647.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SVM0.1|Y3078_ARATH RecName: Full=BTB/POZ domain-containing protein At3g50780 [Arabidopsis 
thaliana]
 emb|CAB42907.1| putative protein [Arabidopsis thaliana]
 gb|AAO22779.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50646.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78709.1| uncharacterized protein AT3G50780 [Arabidopsis thaliana]
Length=520

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D K+ +  + G+  V + VH++VL   S FFA+KL    S    +EI  C+D E
Sbjct  120  GEPGSSDAKVILVGKQGFC-VKLSVHKKVLVDHSCFFAKKLAEKDSVFACLEIESCEDAE  178

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+T+ LMYC+D+K++L+ + VS+
Sbjct  179  LYVETIGLMYCKDMKQRLMKQNVSR  203



>gb|KHG25971.1| hypothetical protein F383_06642 [Gossypium arboreum]
Length=536

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+K+ +  + G+  V + VH+ VL   S FF +KL  +  G   +EI DC+DVE
Sbjct  123  GEPGTSDMKVILLGKQGF-CVKLSVHKIVLMEHSCFFTDKLSGQEPGLSCLEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
             YV+TV LMYC+++K++LI + VS+
Sbjct  182  SYVETVGLMYCKEMKQRLIKQSVSR  206



>ref|XP_009776607.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
sylvestris]
 ref|XP_009776608.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
sylvestris]
Length=536

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D+++ +  + G+  V ++VH+ +L   S +FA K+         +EI DC+DVE
Sbjct  123  GEPGTSDLRVILLGKQGF-TVKLNVHKNILVENSSYFANKISEQQPVFPCIEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC++ K++LI + VS+
Sbjct  182  IYVETVGLMYCKEFKQRLIKQSVSR  206



>ref|XP_009629328.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
tomentosiformis]
 ref|XP_009629329.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
tomentosiformis]
Length=538

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS--HSVEILDCDDVE  627
            G     D+++ +  + G+  V ++VH+ +L   S +FA K+         +EI DC+DVE
Sbjct  125  GEPGTSDLRVILLGKQGF-TVKLNVHKSILVENSSYFANKISEQQPVFPCIEIDDCEDVE  183

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            +YV+TV LMYC++ K++LI + VS+
Sbjct  184  IYVETVGLMYCKEFKQRLIKQSVSR  208



>ref|XP_006338266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Solanum 
tuberosum]
Length=536

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+++ +  + G+  V ++VH+ +L   S FFA K+  R+     +EI DC+DVE
Sbjct  123  GEPGTSDLRVILLGKQGF-TVKLNVHKNILVENSSFFANKISVRQPVFPCIEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            + V+T+ LMYC+++K++LI + VS+
Sbjct  182  ICVETIGLMYCKEMKQRLIKQSVSR  206



>ref|XP_004232086.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Solanum 
lycopersicum]
Length=536

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKL--RRSGSHSVEILDCDDVE  627
            G     D+++ +  + G+  V ++VH+ +L   S FFA K+  ++     +EI DC+DVE
Sbjct  123  GEPGTSDLRVILLGKQGF-TVKLNVHKNILVANSSFFANKISVQQPVFPCIEIDDCEDVE  181

Query  628  VYVKTVVLMYCEDLKKKLIGEGVSK  702
            + V+T+ LMYC+++K++LI + VS+
Sbjct  182  ICVETIGLMYCKEMKQRLIKQSVSR  206



>ref|XP_011085536.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085537.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085538.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=525

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 56/99 (57%), Gaps = 5/99 (5%)
 Frame = +1

Query  412  PFQSPSRADGNFIDGSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS  591
            P   P +    F  G     D+++ +  + G   V + +HR +L   S FFA K+     
Sbjct  111  PENVPRKVTIEF--GEPGTSDLRVILLGKHGL-AVKLSIHRSILVENSSFFASKISEQQP  167

Query  592  --HSVEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
                +EI +CDDVE+YV+T+ LMYC++LK++L+ + VS+
Sbjct  168  VFPCLEIDNCDDVEIYVETIGLMYCKELKQRLMKQSVSR  206



>ref|XP_006664162.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=516

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 12/94 (13%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGS-----------HSV  600
            G     D+ + +  ++G   V M VHR VL   S FFAEKL  +               V
Sbjct  119  GQPETSDLTVMLYGKEG-IAVRMSVHRDVLCRSSGFFAEKLAAASGGGGGHGSPAVPSCV  177

Query  601  EILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            EI DCDD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  178  EIHDCDDAEIYVETVGLMYCDEAKHKLLKQNVSR  211



>gb|ACR38622.1| unknown [Zea mays]
Length=389

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  520  MDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMYCEDLKKK  678
            M VHR VLA  S FFA +L   G   VEI DC+D E+YV+TV LMYC+D   K
Sbjct  1    MSVHRDVLAQSSAFFARRLAADGQPCVEIHDCEDAEIYVETVGLMYCDDGANK  53



>ref|XP_006856144.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Amborella 
trichopoda]
 gb|ERN17611.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
Length=618

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = +1

Query  514  VSMDVHRRVLAGRSRFFAEKLRR--SGSHSVEILDCDDVEVYVKTVVLMYCEDLKKKLIG  687
            V M VHR +LA  S +FAEKL +       VEI +C+DVE +V+TV LMYC+D+K++L+ 
Sbjct  145  VRMRVHRNILAINSTYFAEKLSQLLGPPFCVEIGECEDVESFVETVGLMYCKDVKQRLVK  204

Query  688  EGVSK  702
            + + +
Sbjct  205  QSIPR  209



>ref|XP_004963062.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=526

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 8/88 (9%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH-----SVEILDCD  618
            G     D+ + +  ++G   V + VHR VL   S FFA +L  +G H      VEI DCD
Sbjct  125  GRPETSDLTVMLYGKEGI-AVKIGVHRDVLCRSSAFFAARL--AGGHGLPPPCVEIHDCD  181

Query  619  DVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            D E+YV+TV LMYC++ K +L+ + V +
Sbjct  182  DAEIYVETVGLMYCDEAKHRLLKQSVPR  209



>gb|KFK27540.1| hypothetical protein AALP_AA8G396600 [Arabis alpina]
Length=360

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  598  VEILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            VEI +CDD+E+YV+TVVLMYC+DLKKKLIGE V K
Sbjct  2    VEISECDDLEIYVETVVLMYCDDLKKKLIGESVIK  36



>gb|ABG22069.1| expressed protein [Oryza sativa Japonica Group]
Length=510

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 11/93 (12%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH----------SVE  603
            G     DV + +  ++G   V M VH  VL   S FFAEKL  S S            +E
Sbjct  114  GQPETSDVTVVLYGKEG-IAVRMSVHGDVLRRSSAFFAEKLSSSSSSSGSGGHGHGSCLE  172

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  173  IHDCDDAEIYVETVGLMYCDEAKHKLLKQNVSR  205



>gb|EEE53535.1| hypothetical protein OsJ_36742 [Oryza sativa Japonica Group]
Length=1123

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 11/93 (12%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH----------SVE  603
            G     DV + +  ++G   V M VH  VL   S FFAEKL  S S            +E
Sbjct  114  GQPETSDVTVVLYGKEGI-AVRMSVHGDVLRRSSAFFAEKLSSSSSSSGSGGHGHGSCLE  172

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  173  IHDCDDAEIYVETVGLMYCDEAKHKLLKQNVSR  205



>gb|ABA99196.2| expressed protein [Oryza sativa Japonica Group]
Length=513

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 51/93 (55%), Gaps = 11/93 (12%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSH----------SVE  603
            G     DV + +  ++G   V M VH  VL   S FFAEKL  S S            +E
Sbjct  114  GQPETSDVTVVLYGKEG-IAVRMSVHGDVLRRSSAFFAEKLSSSSSSSGSGGHGHGSCLE  172

Query  604  ILDCDDVEVYVKTVVLMYCEDLKKKLIGEGVSK  702
            I DCDD E+YV+TV LMYC++ K KL+ + VS+
Sbjct  173  IHDCDDAEIYVETVGLMYCDEAKHKLLKQNVSR  205



>emb|CDY31013.1| BnaC04g24110D [Brassica napus]
Length=582

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 21/75 (28%)
 Frame = +1

Query  478  KLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVEILDCDDVEVYVKTVVLMY  657
            K+T+  +D + +V+MDVHR+VL  RSRFF EK+                    KTVVLMY
Sbjct  458  KVTVEGKDRY-RVTMDVHRKVLLERSRFFMEKM--------------------KTVVLMY  496

Query  658  CEDLKKKLIGEGVSK  702
             +DLKKKL+GE V K
Sbjct  497  YDDLKKKLVGENVIK  511



>ref|XP_010097900.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB72727.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=532

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +1

Query  454  GSGSGGDVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHSVE---ILDCDDV  624
            G     D+K+ +  + G+  V + VH+ VL     FFA+KL            I DC+DV
Sbjct  126  GEPGTSDMKVILLGKQGF-CVKLSVHKNVLVEHCSFFADKLSEQQQSGSSSLEIDDCEDV  184

Query  625  EVYVKTVVLMYCEDLKKKLIGEGVSK  702
            E+YV+TV LMYC++++++LI + VS+
Sbjct  185  EIYVETVGLMYCKEMRQRLIKQSVSR  210



>ref|XP_002452861.1| hypothetical protein SORBIDRAFT_04g033760 [Sorghum bicolor]
 gb|EES05837.1| hypothetical protein SORBIDRAFT_04g033760 [Sorghum bicolor]
Length=216

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 11/81 (14%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS----------VEILDCDD  621
            D+ + +  ++G   V M VH  +L+  S FFA +L  + +            VEI DCDD
Sbjct  70   DLTVMLYGKEGI-AVRMSVHSDILSQSSAFFAHRLSAAAAAVGGSAPNQPCVVEIHDCDD  128

Query  622  VEVYVKTVVLMYCEDLKKKLI  684
             E+YV+TV LMYC++ K +L+
Sbjct  129  AEMYVETVGLMYCDEAKHRLL  149



>ref|XP_002442447.1| hypothetical protein SORBIDRAFT_08g020150 [Sorghum bicolor]
 gb|EES16285.1| hypothetical protein SORBIDRAFT_08g020150 [Sorghum bicolor]
Length=524

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 10/80 (13%)
 Frame = +1

Query  472  DVKLTIAARDGWPKVSMDVHRRVLAGRSRFFAEKLRRSGSHS---------VEILDCDDV  624
            D+ + +  ++G   V M VH  VL+  S FFA +L  +G            VEI DCDD 
Sbjct  146  DLTVMLYGKEGI-AVRMSVHSDVLSQSSAFFAHRLSAAGGGGGPAPNQPCVVEIDDCDDA  204

Query  625  EVYVKTVVLMYCEDLKKKLI  684
            E+YV+TV LMYC++ K +L+
Sbjct  205  EMYVETVGLMYCDEAKHRLL  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394