BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4445

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010321038.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    187   7e-53   
ref|XP_010321037.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    187   4e-52   Solanum lycopersicum
ref|XP_009784851.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    187   9e-52   Nicotiana sylvestris
ref|XP_004239253.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    186   2e-51   Solanum lycopersicum
ref|XP_009612398.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    186   2e-51   Nicotiana tomentosiformis
ref|XP_010093134.1|  Cytochrome P450                                    185   4e-51   Morus notabilis
ref|XP_010260624.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    183   4e-51   
ref|XP_010044825.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     185   5e-51   Eucalyptus grandis [rose gum]
ref|XP_009784850.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    185   5e-51   Nicotiana sylvestris
ref|XP_008342307.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     184   8e-51   
ref|XP_010260623.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    184   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006354415.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    183   2e-50   Solanum tuberosum [potatoes]
gb|KJB10651.1|  hypothetical protein B456_001G213800                    175   1e-49   Gossypium raimondii
ref|XP_006429775.1|  hypothetical protein CICLE_v10011353mg             181   1e-49   
ref|XP_006481375.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    181   2e-49   Citrus sinensis [apfelsine]
ref|XP_009347871.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     181   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_012066427.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     181   2e-49   Jatropha curcas
ref|XP_002266883.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     180   4e-49   Vitis vinifera
ref|XP_007049044.1|  Cytochrome P450 97B2, chloroplastic isoform 2      179   8e-49   
ref|XP_011100398.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     179   8e-49   Sesamum indicum [beniseed]
gb|KJB10649.1|  hypothetical protein B456_001G213800                    176   9e-49   Gossypium raimondii
ref|XP_007049043.1|  Cytochrome P450 97B2 isoform 1                     179   1e-48   
ref|XP_010914244.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     177   2e-48   Elaeis guineensis
ref|XP_008229650.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     177   3e-48   Prunus mume [ume]
ref|XP_004303949.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     176   5e-48   Fragaria vesca subsp. vesca
ref|XP_007215027.1|  hypothetical protein PRUPE_ppa003405mg             176   9e-48   
ref|XP_010532498.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     176   1e-47   Tarenaya hassleriana [spider flower]
gb|KHN35086.1|  Cytochrome P450 97B2, chloroplastic                     176   1e-47   Glycine soja [wild soybean]
ref|XP_006841947.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     175   2e-47   
gb|KJB10648.1|  hypothetical protein B456_001G213800                    174   3e-47   Gossypium raimondii
ref|XP_010313051.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    174   4e-47   
ref|XP_009412059.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    174   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008451892.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    174   5e-47   
ref|NP_001046036.1|  Os02g0173100                                       167   7e-47   
ref|XP_004147731.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     173   8e-47   Cucumis sativus [cucumbers]
ref|XP_007158591.1|  hypothetical protein PHAVU_002G165400g             173   1e-46   Phaseolus vulgaris [French bean]
ref|XP_008809593.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     172   2e-46   Phoenix dactylifera
gb|AFW66345.1|  putative cytochrome P450 superfamily protein            162   2e-46   
ref|NP_001235534.1|  cytochrome P450 97B2, chloroplastic                172   2e-46   
ref|XP_006414564.1|  hypothetical protein EUTSA_v10024764mg             172   3e-46   Eutrema salsugineum [saltwater cress]
ref|XP_011002376.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     172   4e-46   Populus euphratica
gb|AJD25227.1|  cytochrome P450 CYP97B34                                171   5e-46   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010495892.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    171   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010435019.1|  PREDICTED: cytochrome P450 97B3, chloroplast...    170   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010440341.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     170   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002308766.1|  hypothetical protein POPTR_0006s00800g             170   2e-45   Populus trichocarpa [western balsam poplar]
emb|CDP16026.1|  unnamed protein product                                170   2e-45   Coffea canephora [robusta coffee]
dbj|BAD26183.1|  putative cytochrome P450                               169   3e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84668.1|  hypothetical protein OsI_06039                          169   3e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_002520583.1|  cytochrome P450, putative                          168   5e-45   Ricinus communis
ref|XP_010680161.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     167   2e-44   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY09057.1|  BnaC08g10110D                                          166   2e-44   Brassica napus [oilseed rape]
emb|CDY22733.1|  BnaA08g05630D                                          166   3e-44   Brassica napus [oilseed rape]
gb|EAZ21913.1|  hypothetical protein OsJ_05566                          166   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EYU42831.1|  hypothetical protein MIMGU_mgv1a003489mg                166   4e-44   Erythranthe guttata [common monkey flower]
ref|XP_009107829.1|  PREDICTED: cytochrome P450 97B3, chloroplastic     164   1e-43   Brassica rapa
ref|XP_006648355.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    164   1e-43   
gb|KFK33561.1|  hypothetical protein AALP_AA5G029500                    164   1e-43   Arabis alpina [alpine rockcress]
gb|KEH27407.1|  cytochrome P450 family 97 protein                       162   3e-43   Medicago truncatula
ref|XP_006285060.1|  hypothetical protein CARUB_v10006369mg             163   3e-43   Capsella rubella
ref|XP_008679919.1|  PREDICTED: cytochrome P450 97B2, chloroplastic     163   5e-43   Zea mays [maize]
gb|AAT28222.1|  putative 97B2-like cytochrome P450                      162   8e-43   Ginkgo biloba [ginkgo]
ref|XP_003610974.1|  Cytochrome P450                                    161   2e-42   Medicago truncatula
sp|Q43078.1|C97B1_PEA  RecName: Full=Cytochrome P450 97B1, chloro...    161   2e-42   Pisum sativum [garden pea]
emb|CAB10290.1|  cytochrome P450 like protein                           161   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193247.2|  cytochrome P450 97B3                                  160   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004951757.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    160   4e-42   Setaria italica
ref|XP_002868224.1|  hypothetical protein ARALYDRAFT_493377             160   4e-42   
gb|EPS66221.1|  hypothetical protein M569_08554                         157   5e-42   Genlisea aurea
ref|XP_002451628.1|  hypothetical protein SORBIDRAFT_04g004850          159   1e-41   Sorghum bicolor [broomcorn]
dbj|BAR43285.1|  cytochrome P450 CYP97B                                 159   1e-41   Marchantia polymorpha
dbj|BAJ97821.1|  predicted protein                                      156   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87287.1|  predicted protein                                      156   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51606.1|  Cytochrome P450 97B2, chloroplastic                     156   1e-40   Triticum urartu
ref|XP_001769554.1|  predicted protein                                  155   3e-40   
ref|XP_003570274.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    155   4e-40   Brachypodium distachyon [annual false brome]
gb|EMT03024.1|  Cytochrome P450 97B2                                    150   1e-38   
gb|KHG14945.1|  Cytochrome P450, chloroplastic                          147   2e-37   Gossypium arboreum [tree cotton]
ref|XP_002976141.1|  hypothetical protein SELMODRAFT_175360             137   6e-34   
ref|XP_002968239.1|  hypothetical protein SELMODRAFT_145597             137   7e-34   
ref|XP_011620464.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    124   2e-29   
ref|XP_006854622.2|  PREDICTED: cytochrome P450 97B2, chloroplastic     122   1e-28   Amborella trichopoda
gb|KJB10650.1|  hypothetical protein B456_001G213800                    119   9e-28   Gossypium raimondii
ref|XP_009612399.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    118   3e-27   Nicotiana tomentosiformis
ref|XP_009784852.1|  PREDICTED: cytochrome P450 97B2, chloroplast...    117   7e-27   Nicotiana sylvestris
gb|AFK42094.1|  unknown                                                 101   8e-24   Medicago truncatula
gb|AGK38421.1|  CYP97B1                                               95.5    7e-19   Parachlorella kessleri
gb|AGK38423.1|  CYP97B1                                               95.1    7e-19   Parachlorella kessleri
gb|AGK38422.1|  CYP97B2                                               95.1    8e-19   Parachlorella kessleri
emb|CDY08069.1|  BnaA06g16570D                                        94.0    1e-18   Brassica napus [oilseed rape]
ref|XP_002955478.1|  hypothetical protein VOLCADRAFT_65884            94.7    1e-18   Volvox carteri f. nagariensis
ref|XP_006478583.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    1e-18   Citrus sinensis [apfelsine]
ref|XP_006478580.1|  PREDICTED: transmembrane 9 superfamily membe...  90.9    2e-18   Citrus sinensis [apfelsine]
ref|XP_006478581.1|  PREDICTED: transmembrane 9 superfamily membe...  90.5    3e-18   Citrus sinensis [apfelsine]
ref|XP_005650550.1|  cytochrome P450                                  92.0    7e-18   Coccomyxa subellipsoidea C-169
gb|AFR36909.1|  chloroplast CYP97B                                    91.3    1e-17   Haematococcus lacustris
ref|XP_005845008.1|  hypothetical protein CHLNCDRAFT_138471           88.2    2e-16   Chlorella variabilis
gb|AHA51695.1|  P450-type beta-carotene hydroxylase CYP97B29          82.8    1e-14   Porphyra umbilicalis
ref|XP_002506759.1|  predicted protein                                82.0    2e-14   Micromonas commoda
ref|XP_003062894.1|  predicted protein                                82.0    2e-14   Micromonas pusilla CCMP1545
ref|XP_003074608.1|  cytochrome P450 (ISS)                            81.6    3e-14   Ostreococcus tauri
ref|XP_006649172.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  80.9    4e-14   Oryza brachyantha
ref|XP_001415984.1|  predicted protein                                80.9    4e-14   Ostreococcus lucimarinus CCE9901
ref|XP_007509002.1|  predicted protein                                80.9    4e-14   Bathycoccus prasinos
gb|EMT31539.1|  Cytochrome P450 97B2                                  78.6    3e-13   
ref|NP_001048526.1|  Os02g0817900                                     77.8    5e-13   
gb|EEC74248.1|  hypothetical protein OsI_09455                        77.8    5e-13   Oryza sativa Indica Group [Indian rice]
gb|EEE58048.1|  hypothetical protein OsJ_08883                        77.8    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008646433.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  77.4    7e-13   
ref|XP_005826161.1|  cytochrome P450                                  75.9    2e-12   Guillardia theta CCMP2712
gb|EYU39507.1|  hypothetical protein MIMGU_mgv1a003045mg              75.5    3e-12   Erythranthe guttata [common monkey flower]
gb|EYU39508.1|  hypothetical protein MIMGU_mgv1a003045mg              75.1    4e-12   Erythranthe guttata [common monkey flower]
gb|AJD25226.1|  cytochrome P450 CYP97A41                              75.1    4e-12   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004954387.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  75.1    5e-12   
ref|XP_003570402.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  74.7    5e-12   Brachypodium distachyon [annual false brome]
ref|XP_008355900.1|  PREDICTED: uncharacterized protein LOC103419579  74.3    9e-12   
gb|AFU10537.1|  chloroplast cytochrome P450 monooxygenase 97A3        73.2    1e-11   Daucus carota [carrots]
gb|KHN25634.1|  Cytochrome P450 97B2, chloroplastic                   72.4    1e-11   Glycine soja [wild soybean]
gb|EMS64313.1|  Cytochrome P450 97B2, chloroplastic                   73.2    1e-11   Triticum urartu
ref|XP_002454784.1|  hypothetical protein SORBIDRAFT_04g037300        73.2    2e-11   
gb|AFU10536.1|  chloroplast cytochrome P450 monooxygenase 97A3        73.2    2e-11   Daucus carota [carrots]
gb|AIX87527.1|  P450 carotenoid beta-ring hydroxylase                 73.2    2e-11   Lycium ruthenicum
gb|AIX87503.1|  P450 carotenoid beta-ring hydroxylase                 72.8    2e-11   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010245679.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  72.8    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002319296.2|  hypothetical protein POPTR_0013s08610g           72.4    2e-11   
ref|XP_009346816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  72.8    2e-11   
ref|XP_009346815.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  72.8    2e-11   
ref|XP_001783943.1|  predicted protein                                72.4    3e-11   
ref|XP_009114070.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.7    3e-11   
ref|XP_010264030.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  72.8    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008370918.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  72.0    3e-11   
ref|XP_004302135.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  72.0    4e-11   Fragaria vesca subsp. vesca
gb|EPS59936.1|  hypothetical protein M569_14868                       71.6    4e-11   Genlisea aurea
ref|NP_001234049.1|  cytochrome P450-type monooxygenase 97A29         71.6    5e-11   Solanum lycopersicum
ref|XP_006340502.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.6    5e-11   Solanum tuberosum [potatoes]
ref|XP_010940645.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.6    6e-11   Elaeis guineensis
ref|XP_011013175.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.6    6e-11   Populus euphratica
emb|CDY71050.1|  BnaAnng35900D                                        69.7    6e-11   Brassica napus [oilseed rape]
ref|XP_009337974.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.2    7e-11   Pyrus x bretschneideri [bai li]
ref|XP_003552430.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.2    7e-11   Glycine max [soybeans]
ref|XP_005715216.1|  cytochrome P450 family 97G-CYP97G1               71.2    7e-11   Chondrus crispus [carageen]
ref|XP_009337972.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.2    7e-11   Pyrus x bretschneideri [bai li]
ref|XP_008218412.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  71.2    8e-11   Prunus mume [ume]
ref|XP_007204988.1|  hypothetical protein PRUPE_ppa003455mg           70.9    8e-11   
ref|XP_008789534.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.9    9e-11   Phoenix dactylifera
ref|XP_008218411.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.9    1e-10   Prunus mume [ume]
ref|XP_001700492.1|  cytochrome P450, carotenoid hydroxylase          70.9    1e-10   Chlamydomonas reinhardtii
ref|XP_008388781.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.9    1e-10   
ref|XP_002958826.1|  hypothetical protein VOLCADRAFT_100143           70.9    1e-10   Volvox carteri f. nagariensis
ref|XP_002512609.1|  cytochrome P450, putative                        70.9    1e-10   
ref|XP_009386597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.9    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008388780.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.9    1e-10   
gb|AFR31786.1|  cytochrome P450                                       70.1    1e-10   Haematococcus lacustris
dbj|BAR43284.1|  cytochrome P450 CYP97A                               70.5    1e-10   Marchantia polymorpha
ref|XP_011077088.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.5    1e-10   Sesamum indicum [beniseed]
emb|CDP04239.1|  unnamed protein product                              70.1    2e-10   Coffea canephora [robusta coffee]
ref|XP_003534527.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  70.1    2e-10   Glycine max [soybeans]
ref|XP_009802494.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.7    2e-10   Nicotiana sylvestris
ref|XP_006304811.1|  hypothetical protein CARUB_v10012441mg           69.7    2e-10   Capsella rubella
ref|XP_009627106.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.7    2e-10   Nicotiana tomentosiformis
gb|KFK44941.1|  hypothetical protein AALP_AA1G322700                  69.7    2e-10   Arabis alpina [alpine rockcress]
ref|XP_012088784.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.3    3e-10   Jatropha curcas
ref|XP_010674674.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.3    3e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012088785.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.3    3e-10   
gb|ERM98304.1|  hypothetical protein AMTR_s00094p00103220             63.9    3e-10   Amborella trichopoda
ref|XP_010499724.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.3    3e-10   Camelina sativa [gold-of-pleasure]
emb|CBJ27248.1|  Cytochrome P450                                      69.3    3e-10   Ectocarpus siliculosus
ref|XP_010461000.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.3    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002965693.1|  hypothetical protein SELMODRAFT_407294           69.3    3e-10   
ref|XP_010478597.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  69.3    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_003542540.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.9    3e-10   Glycine max [soybeans]
ref|XP_006291026.1|  hypothetical protein CARUB_v10017141mg           68.9    3e-10   
emb|CDY27131.1|  BnaA08g07690D                                        68.9    3e-10   Brassica napus [oilseed rape]
ref|XP_006415302.1|  hypothetical protein EUTSA_v10007138mg           68.9    4e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010504071.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.9    4e-10   Camelina sativa [gold-of-pleasure]
gb|KIY93092.1|  hypothetical protein MNEG_14870                       65.9    4e-10   Monoraphidium neglectum
gb|AAG50718.1|AC079041_11  cytochrome P450, putative                  68.9    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540722.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  68.9    4e-10   Tarenaya hassleriana [spider flower]
emb|CDY12360.1|  BnaC08g08450D                                        68.9    4e-10   Brassica napus [oilseed rape]
ref|NP_564384.1|  protein LUTEIN DEFICIENT 5                          68.9    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EWM30289.1|  cytochrome p450                                       68.9    4e-10   Nannochloropsis gaditana
gb|KDO54883.1|  hypothetical protein CISIN_1g0072311mg                67.8    4e-10   Citrus sinensis [apfelsine]
ref|XP_002890950.1|  hypothetical protein ARALYDRAFT_473366           68.9    4e-10   
gb|KDO54885.1|  hypothetical protein CISIN_1g0072311mg                67.8    4e-10   Citrus sinensis [apfelsine]
gb|KDO54884.1|  hypothetical protein CISIN_1g0072311mg                67.8    5e-10   Citrus sinensis [apfelsine]
ref|XP_010515801.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.6    5e-10   Camelina sativa [gold-of-pleasure]
gb|KEH23385.1|  cytochrome P450 family monooxygenase                  68.6    5e-10   Medicago truncatula
ref|XP_010907644.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.6    5e-10   Elaeis guineensis
ref|XP_003624119.1|  Cytochrome P450                                  68.2    5e-10   
ref|XP_010070132.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  68.6    6e-10   Eucalyptus grandis [rose gum]
ref|XP_010907643.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.2    6e-10   Elaeis guineensis
gb|KJB82186.1|  hypothetical protein B456_013G180200                  68.2    6e-10   Gossypium raimondii
ref|XP_010907645.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.2    6e-10   Elaeis guineensis
gb|KHF99465.1|  Cytochrome P450, chloroplastic                        68.2    7e-10   Gossypium arboreum [tree cotton]
ref|XP_010907646.1|  PREDICTED: carotene epsilon-monooxygenase, c...  68.2    7e-10   
ref|XP_007139751.1|  hypothetical protein PHAVU_008G056400g           68.2    7e-10   Phaseolus vulgaris [French bean]
tpg|DAA46176.1|  TPA: putative cytochrome P450 superfamily protein    65.5    7e-10   
gb|KJB82185.1|  hypothetical protein B456_013G180200                  68.2    7e-10   Gossypium raimondii
gb|KJB82188.1|  hypothetical protein B456_013G180200                  68.2    7e-10   Gossypium raimondii
gb|KJB82184.1|  hypothetical protein B456_013G180200                  68.2    7e-10   Gossypium raimondii
gb|KJB82187.1|  hypothetical protein B456_013G180200                  67.8    8e-10   Gossypium raimondii
gb|KJB82189.1|  hypothetical protein B456_013G180200                  67.8    8e-10   Gossypium raimondii
ref|XP_010426945.1|  PREDICTED: carotene epsilon-monooxygenase, c...  67.8    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006428548.1|  hypothetical protein CICLE_v10011312mg           67.8    8e-10   
ref|NP_190881.2|  carotene epsilon-monooxygenase                      67.8    9e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AES80336.2|  cytochrome P450 family monooxygenase                  67.8    9e-10   Medicago truncatula
gb|AES80337.2|  cytochrome P450 family monooxygenase                  67.8    9e-10   Medicago truncatula
ref|XP_008807069.1|  PREDICTED: LOW QUALITY PROTEIN: carotene eps...  67.8    9e-10   Phoenix dactylifera
gb|AAM13903.1|  putative cytochrome P450                              67.8    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029434.1|  Cytochrome P450, family 97, subfamily A, pol...  67.8    9e-10   
ref|XP_004133753.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  67.8    9e-10   Cucumis sativus [cucumbers]
ref|XP_007029435.1|  Cytochrome P450 97B2 isoform 2                   67.8    9e-10   
ref|XP_007029436.1|  Cytochrome P450, family 97, subfamily A, pol...  67.8    9e-10   
ref|XP_003624118.1|  Cytochrome P450                                  67.8    1e-09   
ref|XP_006428547.1|  hypothetical protein CICLE_v10011312mg           67.8    1e-09   Citrus clementina [clementine]
ref|XP_003058421.1|  cytochrome P450 superfamily protein              67.8    1e-09   Micromonas pusilla CCMP1545
ref|XP_005652354.1|  cytochrome P450                                  67.4    1e-09   Coccomyxa subellipsoidea C-169
ref|XP_006428546.1|  hypothetical protein CICLE_v10011312mg           67.4    1e-09   Citrus clementina [clementine]
ref|XP_008658121.1|  PREDICTED: carotene epsilon-monooxygenase, c...  67.4    1e-09   Zea mays [maize]
gb|AGI61105.1|  carotenoid hydroxylase                                67.4    1e-09   Parachlorella kessleri
tpg|DAA46175.1|  TPA: putative cytochrome P450 superfamily protein    67.0    1e-09   
ref|XP_004492816.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  67.4    1e-09   Cicer arietinum [garbanzo]
emb|CAB64216.1|  Cytochrom P450-like protein                          67.4    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ERM98042.1|  hypothetical protein AMTR_s00120p00092320             67.4    1e-09   Amborella trichopoda
ref|XP_008450166.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  67.0    2e-09   Cucumis melo [Oriental melon]
gb|EPS64627.1|  hypothetical protein M569_10150                       67.0    2e-09   Genlisea aurea
ref|XP_010546518.1|  PREDICTED: carotene epsilon-monooxygenase, c...  67.0    2e-09   Tarenaya hassleriana [spider flower]
emb|CBI17673.3|  unnamed protein product                              67.0    2e-09   Vitis vinifera
ref|XP_002876190.1|  hypothetical protein ARALYDRAFT_485688           67.0    2e-09   
ref|XP_002279984.3|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  67.0    2e-09   Vitis vinifera
ref|XP_010546517.1|  PREDICTED: carotene epsilon-monooxygenase, c...  66.6    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_007145288.1|  hypothetical protein PHAVU_007G2265001g          66.2    2e-09   Phaseolus vulgaris [French bean]
ref|XP_006830626.2|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  66.6    2e-09   
ref|XP_010050328.1|  PREDICTED: carotene epsilon-monooxygenase, c...  66.6    2e-09   Eucalyptus grandis [rose gum]
gb|KCW89308.1|  hypothetical protein EUGRSUZ_A01599                   66.2    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010111039.1|  Protein LUTEIN DEFICIENT 5                       66.2    3e-09   Morus notabilis
ref|XP_003537025.1|  PREDICTED: carotene epsilon-monooxygenase, c...  66.2    3e-09   Glycine max [soybeans]
gb|KFK34549.1|  hypothetical protein AALP_AA5G160700                  66.2    3e-09   Arabis alpina [alpine rockcress]
ref|XP_010241652.1|  PREDICTED: carotene epsilon-monooxygenase, c...  66.2    3e-09   Nelumbo nucifera [Indian lotus]
dbj|BAJ91518.1|  predicted protein                                    65.9    3e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC67393.1|  hypothetical protein OsI_34547                        65.9    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006403722.1|  hypothetical protein EUTSA_v10010267mg           65.9    3e-09   Eutrema salsugineum [saltwater cress]
ref|NP_001065217.1|  Os10g0546600                                     65.9    3e-09   
ref|XP_002185035.1|  lut1-1                                           65.9    4e-09   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002185034.1|  lutein deficient 1-like protein                  65.9    4e-09   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010241651.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.5    4e-09   Nelumbo nucifera [Indian lotus]
gb|AAK20054.1|AC025783_14  putative cytochrome P450 monooxygenase     65.5    5e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AGN27239.1|  CYP97A1                                               65.5    5e-09   Parachlorella kessleri
ref|XP_001781608.1|  predicted protein                                65.5    5e-09   
gb|AJB84623.1|  carotene epsilon-monooxygenase                        65.5    5e-09   Camellia sinensis [black tea]
ref|XP_002293604.1|  cytochrome P450                                  65.1    6e-09   Thalassiosira pseudonana CCMP1335
ref|XP_011397501.1|  Cytochrome P450 97B2, chloroplastic              65.1    6e-09   Auxenochlorella protothecoides
ref|XP_009382396.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.1    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382394.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.1    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011468004.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.1    6e-09   Fragaria vesca subsp. vesca
ref|XP_009382395.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.1    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004306170.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.1    6e-09   Fragaria vesca subsp. vesca
ref|XP_011094564.1|  PREDICTED: carotene epsilon-monooxygenase, c...  65.1    7e-09   Sesamum indicum [beniseed]
emb|CDY13314.1|  BnaC06g14430D                                        64.7    8e-09   Brassica napus [oilseed rape]
ref|XP_007027523.1|  Cytochrome P450 superfamily protein isoform 1    64.7    8e-09   
emb|CDX67558.1|  BnaA07g15980D                                        64.7    8e-09   
ref|XP_009125249.1|  PREDICTED: carotene epsilon-monooxygenase, c...  64.7    8e-09   Brassica rapa
ref|XP_010098846.1|  Carotene epsilon-monooxygenase                   64.7    9e-09   
gb|AJD25228.1|  cytochrome P450 CYP97C28                              64.7    9e-09   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004143287.1|  PREDICTED: carotene epsilon-monooxygenase, c...  64.7    1e-08   Cucumis sativus [cucumbers]
ref|XP_006339097.1|  PREDICTED: carotene epsilon-monooxygenase, c...  64.7    1e-08   Solanum tuberosum [potatoes]
ref|XP_002519427.1|  cytochrome P450, putative                        64.7    1e-08   
ref|XP_003082726.1|  probable cytochrome P450 (ISS)                   64.7    1e-08   
ref|XP_005779653.1|  hypothetical protein EMIHUDRAFT_463287           64.3    1e-08   Emiliania huxleyi CCMP1516
ref|XP_002178724.1|  lutein deficient 1-like protein                  64.3    1e-08   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009032928.1|  hypothetical protein AURANDRAFT_19592            63.9    1e-08   Aureococcus anophagefferens
ref|XP_008462512.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.9    2e-08   Cucumis melo [Oriental melon]
ref|XP_011018829.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.9    2e-08   Populus euphratica
ref|XP_004983761.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.9    2e-08   Setaria italica
ref|XP_002467549.1|  hypothetical protein SORBIDRAFT_01g030050        63.9    2e-08   
ref|XP_004983762.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.9    2e-08   Setaria italica
ref|XP_008392557.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.5    2e-08   Malus domestica [apple tree]
ref|XP_011018826.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.5    2e-08   Populus euphratica
ref|XP_011018827.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.5    2e-08   Populus euphratica
dbj|BAJ87296.1|  predicted protein                                    63.5    2e-08   
ref|XP_003590442.1|  Cytochrome P450 monooxygenase CYP97C10           63.5    2e-08   
ref|XP_006491796.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.2    2e-08   
gb|KDO54333.1|  hypothetical protein CISIN_1g008564mg                 63.2    2e-08   
gb|ABC59096.1|  cytochrome P450 monooxygenase CYP97C10                63.2    3e-08   
ref|XP_004516959.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.2    3e-08   
gb|KDO54334.1|  hypothetical protein CISIN_1g008564mg                 63.2    3e-08   
ref|XP_006428525.1|  hypothetical protein CICLE_v10011420mg           63.2    3e-08   
ref|XP_007204192.1|  hypothetical protein PRUPE_ppa003701mg           63.2    3e-08   
gb|KDO54336.1|  hypothetical protein CISIN_1g008564mg                 63.2    3e-08   
gb|KDO54335.1|  hypothetical protein CISIN_1g008564mg                 63.2    3e-08   
ref|XP_003061074.1|  predicted protein                                63.2    3e-08   
ref|XP_008241353.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.2    3e-08   
gb|KDO54337.1|  hypothetical protein CISIN_1g008564mg                 63.2    3e-08   
ref|XP_004516958.1|  PREDICTED: carotene epsilon-monooxygenase, c...  63.2    3e-08   
gb|KJB46497.1|  hypothetical protein B456_007G372200                  62.8    3e-08   
gb|KJB46498.1|  hypothetical protein B456_007G372200                  63.2    3e-08   
ref|XP_003574294.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.8    3e-08   
ref|XP_012082505.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.8    3e-08   
ref|XP_006829190.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.8    3e-08   
ref|XP_002503315.1|  predicted protein                                62.8    4e-08   
gb|EYU41579.1|  hypothetical protein MIMGU_mgv1a004062mg              62.8    4e-08   
ref|XP_007513609.1|  predicted protein                                62.8    4e-08   
emb|CEG00185.1|  Cytochrome P450, conserved site                      62.4    5e-08   
dbj|BAR43286.1|  cytochrome P450 CYP97C                               62.4    5e-08   
ref|XP_006381359.1|  hypothetical protein POPTR_0006s12150g           62.4    5e-08   
gb|ABB52076.1|  putative epsilon-ring carotene hydroxylase            62.4    5e-08   
emb|CBJ27249.1|  Cytochrome P450                                      62.0    6e-08   
ref|XP_009757367.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.0    6e-08   
ref|XP_009375781.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.0    6e-08   
ref|XP_002265015.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.0    6e-08   
ref|XP_009623193.1|  PREDICTED: carotene epsilon-monooxygenase, c...  62.0    6e-08   
ref|XP_001420992.1|  predicted protein                                62.0    7e-08   
emb|CAN65775.1|  hypothetical protein VITISV_030413                   62.0    7e-08   
ref|XP_001422903.1|  predicted protein                                61.6    8e-08   
emb|CBI30186.3|  unnamed protein product                              61.6    8e-08   
gb|KHG23674.1|  Cytochrome P450, chloroplastic                        61.6    8e-08   
ref|XP_009108103.1|  PREDICTED: protein LUTEIN DEFICIENT 5, chlor...  61.6    1e-07   
gb|EMS57747.1|  Cytochrome P450 97B2, chloroplastic                   61.6    1e-07   
ref|XP_002292287.1|  predicted protein                                61.2    1e-07   
ref|NP_001234058.1|  cytochrome P450-type monooxygenase 97C11         61.2    1e-07   
ref|XP_006662027.1|  PREDICTED: carotene epsilon-monooxygenase, c...  60.8    2e-07   
gb|AIX87528.1|  P450 carotenoid epsilon-ring hydroxylase              60.8    2e-07   
gb|AIX87504.1|  P450 carotenoid epsilon-ring hydroxylase              60.8    2e-07   
emb|CDP15310.1|  unnamed protein product                              60.1    3e-07   
ref|XP_010683980.1|  PREDICTED: carotene epsilon-monooxygenase, c...  59.7    4e-07   
ref|XP_009042317.1|  hypothetical protein AURANDRAFT_34662            59.3    5e-07   
gb|AAL73435.1|AF459441_1  cytochrome P450                             59.3    6e-07   
gb|EJK63850.1|  hypothetical protein THAOC_15469                      58.2    2e-06   
ref|XP_001421212.1|  predicted protein                                57.4    3e-06   
gb|EMT09072.1|  hypothetical protein F775_42841                       53.5    3e-06   
ref|XP_007514506.1|  predicted protein                                56.6    4e-06   
gb|KIZ06747.1|  hypothetical protein MNEG_1212                        56.2    5e-06   
ref|XP_002178328.1|  predicted protein                                55.8    6e-06   
gb|AFQ31612.1|  CYP97C                                                55.8    9e-06   
gb|AGT63110.1|  plastid carotenoid epsilon-ring hydroxylase           55.5    9e-06   
emb|CEG01697.1|  Cytochrome P450, conserved site                      55.5    1e-05   
ref|XP_002955547.1|  hypothetical protein VOLCADRAFT_83281            55.1    1e-05   
ref|XP_002186497.1|  predicted protein                                54.3    2e-05   
gb|ABQ59243.1|  CYP97C3                                               53.1    7e-05   
ref|XP_005648231.1|  CYP97C3                                          52.0    2e-04   
ref|XP_005849069.1|  hypothetical protein CHLNCDRAFT_51247            52.0    2e-04   
ref|XP_002506798.1|  predicted protein                                50.4    6e-04   
ref|XP_011396817.1|  Cytochrome P450 97B3, chloroplastic              49.7    0.001   



>ref|XP_010321038.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Solanum 
lycopersicum]
Length=436

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 110/152 (72%), Gaps = 17/152 (11%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRH---SHGSSFKMKPSGGCRI---RCQ  391
            MATG C + T         C+ L   S      RH   S+ +S+  +     R    RCQ
Sbjct  1    MATGFCSSIT---------CLVLNRRSDSIF--RHFPSSYPTSWSTQKRSSIRTMKCRCQ  49

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYG  571
            ST TDE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RPLFFSLYDWFLKYG
Sbjct  50   STGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYG  109

Query  572  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  110  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  141



>ref|XP_010321037.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=573

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 109/148 (74%), Gaps = 14/148 (9%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCR--IRCQSTST  403
            MATG C + T         C+ L   + R+        SS+    S   R  IRCQST T
Sbjct  1    MATGFCSSIT---------CLVL---NRRSDSIFRHFPSSYPTSWSTQKRSSIRCQSTGT  48

Query  404  DERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYK  583
            DE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RPLFFSLYDWFLKYGSVYK
Sbjct  49   DEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYGSVYK  108

Query  584  LAFGPKAFVVVSDPIVARHILRENAFSY  667
            LAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  109  LAFGPKAFVVVSDPIVARHILRENAFSY  136



>ref|XP_009784851.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 107/152 (70%), Gaps = 20/152 (13%)
 Frame = +2

Query  230  MATG------CCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQ  391
            MATG      C V    +DC   R C    S  + +   R S              IRCQ
Sbjct  1    MATGFVSSNTCLVLNRRSDCCSSRFCHFPSSYPTLSTPKRAS--------------IRCQ  46

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYG  571
            STSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RPLFFSLYDWF+KYG
Sbjct  47   STSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWFIKYG  106

Query  572  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SVYKLAFGPKAFVVVSDPIVAR+ILRENAFSY
Sbjct  107  SVYKLAFGPKAFVVVSDPIVARYILRENAFSY  138



>ref|XP_004239253.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=578

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 110/152 (72%), Gaps = 17/152 (11%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRH---SHGSSFKMKPSGGCRI---RCQ  391
            MATG C + T         C+ L   S      RH   S+ +S+  +     R    RCQ
Sbjct  1    MATGFCSSIT---------CLVLNRRSDSIF--RHFPSSYPTSWSTQKRSSIRTMKCRCQ  49

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYG  571
            ST TDE KTKMNL DNASNLLTNLLSGG+IGSMP AEGAV+DLF RPLFFSLYDWFLKYG
Sbjct  50   STGTDEPKTKMNLFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDWFLKYG  109

Query  572  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  110  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  141



>ref|XP_009612398.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=582

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 113/152 (74%), Gaps = 12/152 (8%)
 Frame = +2

Query  230  MATG------CCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQ  391
            MATG      C V    +DC   R C   PS SS ++ +  S  S+ K        IRCQ
Sbjct  1    MATGSVSSNTCLVLNRRSDCCSSRFC-HFPSSSSSSSSSSKSTLSTPKR-----TSIRCQ  54

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYG  571
            STSTDE KTKMNL DNASNLLTNLLSGG IGSMP AEGAVSDLF RPLFFSLYDWF+KYG
Sbjct  55   STSTDEPKTKMNLFDNASNLLTNLLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWFIKYG  114

Query  572  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SVYKLAFGPKAFVVVSDPIVAR+ILRENAFSY
Sbjct  115  SVYKLAFGPKAFVVVSDPIVARYILRENAFSY  146



>ref|XP_010093134.1| Cytochrome P450 [Morus notabilis]
 gb|EXB53586.1| Cytochrome P450 [Morus notabilis]
Length=581

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 103/119 (87%), Gaps = 7/119 (6%)
 Frame = +2

Query  323  GTRHSHGSS----FKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSM  490
            G+ HS  +S    FK K S   R+RCQSTSTDE KTK NLLDNASNLLTNLLSGG++GSM
Sbjct  28   GSFHSSSASNLLYFKPKRS---RVRCQSTSTDELKTKRNLLDNASNLLTNLLSGGRLGSM  84

Query  491  PTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            P AEGAVSDLF RPLFFSLYDWFL++G+VYKLAFGPKAFVVVSDP+VARHILRENAFSY
Sbjct  85   PVAEGAVSDLFDRPLFFSLYDWFLEHGAVYKLAFGPKAFVVVSDPVVARHILRENAFSY  143



>ref|XP_010260624.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  371  GCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLY  550
            G RIRCQSTST+E KT+ NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFGRPLFFSLY
Sbjct  46   GSRIRCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLFFSLY  105

Query  551  DWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            DWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAFSY
Sbjct  106  DWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFSY  144



>ref|XP_010044825.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Eucalyptus grandis]
 gb|KCW88536.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88537.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
 gb|KCW88538.1| hypothetical protein EUGRSUZ_A00911 [Eucalyptus grandis]
Length=584

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            P G C IRCQSTSTDE KTK NLLDNASNLLTNLLSGG +GSMP AEGAV+DLFG+PLFF
Sbjct  44   PRGPC-IRCQSTSTDEPKTKRNLLDNASNLLTNLLSGGSLGSMPIAEGAVTDLFGKPLFF  102

Query  542  SLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SLYDWFL++G+VYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  103  SLYDWFLEHGAVYKLAFGPKAFVVVSDPIVARHILRENAFSY  144



>ref|XP_009784850.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=584

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RPLFFSLYDWF
Sbjct  53   IRCQSTSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWF  112

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +KYGSVYKLAFGPKAFVVVSDPIVAR+ILRENAFSY
Sbjct  113  IKYGSVYKLAFGPKAFVVVSDPIVARYILRENAFSY  148



>ref|XP_008342307.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Malus domestica]
Length=577

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = +2

Query  374  CRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYD  553
            C +RCQSTST+E KTK NLLDNASNLLTN LSGGKIGSMPTAEGAV+DLF RPLFFSLYD
Sbjct  43   CPLRCQSTSTEEPKTKRNLLDNASNLLTNFLSGGKIGSMPTAEGAVTDLFDRPLFFSLYD  102

Query  554  WFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            WF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  103  WFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  140



>ref|XP_010260623.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=587

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  371  GCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLY  550
            G RIRCQSTST+E KT+ NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFGRPLFFSLY
Sbjct  46   GSRIRCQSTSTEEPKTRRNLLDNASNLLTNLLSGGSMGTMPIAEGAVSDLFGRPLFFSLY  105

Query  551  DWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            DWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAFSY
Sbjct  106  DWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFSY  144



>ref|XP_006354415.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Solanum 
tuberosum]
Length=573

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 109/150 (73%), Gaps = 18/150 (12%)
 Frame = +2

Query  230  MATGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCR----IRCQST  397
            MATG C + T         C+ L   + R+        SS+    SG  R    IRCQST
Sbjct  1    MATGFCSSNT---------CLVL---NRRSDSIFRHFPSSYPT--SGSTRKRSSIRCQST  46

Query  398  STDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSV  577
             TDE KTKM+L DNASNLLTNLLSGGKIGSMP AEGAV+DLF RPLFFSLYDW LKYGSV
Sbjct  47   GTDEPKTKMSLFDNASNLLTNLLSGGKIGSMPIAEGAVTDLFDRPLFFSLYDWSLKYGSV  106

Query  578  YKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            YKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  107  YKLAFGPKAFVVVSDPIVARHILRENAFSY  136



>gb|KJB10651.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=287

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRPLFFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIV +HILRENAFS+
Sbjct  106  LEHGSVYKLAFGPKAFVVVSDPIVVKHILRENAFSF  141



>ref|XP_006429775.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
 gb|ESR43015.1| hypothetical protein CICLE_v10011353mg [Citrus clementina]
Length=582

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 108/146 (74%), Gaps = 7/146 (5%)
 Frame = +2

Query  236  TGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM--KPSGGCRIRCQSTSTDE  409
            T  C++  H       S +G  S  +R  G   S+  +  +  KP     IRCQST T+E
Sbjct  4    TTTCISHHHLS-----SAVGYGSFHAREFGFVGSNSRTHLVNSKPKESPSIRCQSTGTNE  58

Query  410  RKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLA  589
             KT+ NLLDNASNLLTNLLSGG +GS P AEGAVSDLFGRPLFFSLYDWF+++GSVYKLA
Sbjct  59   PKTRRNLLDNASNLLTNLLSGGNLGSTPVAEGAVSDLFGRPLFFSLYDWFIEHGSVYKLA  118

Query  590  FGPKAFVVVSDPIVARHILRENAFSY  667
            FGPKAFVVVSDPI+ARHILRENAFSY
Sbjct  119  FGPKAFVVVSDPIIARHILRENAFSY  144



>ref|XP_006481375.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Citrus sinensis]
Length=619

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 108/146 (74%), Gaps = 7/146 (5%)
 Frame = +2

Query  236  TGCCVAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM--KPSGGCRIRCQSTSTDE  409
            T  C++  H       S +G  S  +R  G   S+  +  +  KP     IRCQST T+E
Sbjct  41   TTTCISHHHLS-----SAVGYGSFHAREFGFVGSNSRTHLVNSKPKESPSIRCQSTGTNE  95

Query  410  RKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLA  589
             KT+ NLLDNASNLLTNLLSGG +GS P AEGAVSDLFGRPLFFSLYDWF+++GSVYKLA
Sbjct  96   PKTRRNLLDNASNLLTNLLSGGNLGSTPVAEGAVSDLFGRPLFFSLYDWFIEHGSVYKLA  155

Query  590  FGPKAFVVVSDPIVARHILRENAFSY  667
            FGPKAFVVVSDPI+ARHILRENAFSY
Sbjct  156  FGPKAFVVVSDPIIARHILRENAFSY  181



>ref|XP_009347871.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Pyrus x bretschneideri]
Length=577

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = +2

Query  374  CRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYD  553
            C +R QSTST+E KTK NLLDNASNLLTN LSGGKIGSMPTAEGAV+DLF RPLFFSLYD
Sbjct  43   CPLRSQSTSTEEPKTKRNLLDNASNLLTNFLSGGKIGSMPTAEGAVTDLFDRPLFFSLYD  102

Query  554  WFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            WF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  103  WFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  140



>ref|XP_012066427.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Jatropha curcas]
 gb|KDP42786.1| hypothetical protein JCGZ_00485 [Jatropha curcas]
Length=583

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAV  511
            H H  + K K  G   IRCQSTSTD+ KT+ NLLDNASNLLTNLLSGG +GSMPTAEGAV
Sbjct  40   HYHFLNSKAK-KGFPAIRCQSTSTDKPKTR-NLLDNASNLLTNLLSGGNLGSMPTAEGAV  97

Query  512  SDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SDLFGRPLFFSLYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  98   SDLFGRPLFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  149



>ref|XP_002266883.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Vitis vinifera]
 emb|CBI34117.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 102/120 (85%), Gaps = 3/120 (3%)
 Frame = +2

Query  311  SRTAGTRHSHGSSF-KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGS  487
            SRT   + S  S   K++P GG  IRCQSTSTD++K++ NLLDNASNLLTN LSGG IGS
Sbjct  18   SRTPYLQSSRTSQLSKLRP-GGSSIRCQSTSTDKQKSR-NLLDNASNLLTNFLSGGSIGS  75

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP AEGAVSDLFGRPLFFSLYDWF+++GSVYKLAFGPKAFVVVSDPIVARHILREN F Y
Sbjct  76   MPVAEGAVSDLFGRPLFFSLYDWFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENIFGY  135



>ref|XP_007049044.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOX93201.1| Cytochrome P450 97B2, chloroplastic isoform 2 [Theobroma cacao]
Length=582

 Score =   179 bits (454),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = +2

Query  353  KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRP  532
            K+K S    IRCQSTSTDE K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFG+P
Sbjct  41   KLKTSAA--IRCQSTSTDEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGQP  98

Query  533  LFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LFFSLYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFS+
Sbjct  99   LFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSF  143



>ref|XP_011100398.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Sesamum indicum]
Length=577

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 4/106 (4%)
 Frame = +2

Query  359  KPSGGCRIRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGR  529
            KP G   +RCQS TSTDE KT   MNLLDNASNLLTN LSGGKIGSMPTAEGAVSDLFG+
Sbjct  36   KPKGSS-VRCQSSTSTDENKTTKSMNLLDNASNLLTNFLSGGKIGSMPTAEGAVSDLFGK  94

Query  530  PLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            PLFFSLYDWF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAF+Y
Sbjct  95   PLFFSLYDWFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFAY  140



>gb|KJB10649.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=408

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRPLFFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIV +HILRENAFS+
Sbjct  106  LEHGSVYKLAFGPKAFVVVSDPIVVKHILRENAFSF  141



>ref|XP_007049043.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
 gb|EOX93200.1| Cytochrome P450 97B2 isoform 1 [Theobroma cacao]
Length=622

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = +2

Query  353  KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRP  532
            K+K S    IRCQSTSTDE K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFG+P
Sbjct  41   KLKTSAA--IRCQSTSTDEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGQP  98

Query  533  LFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LFFSLYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFS+
Sbjct  99   LFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSF  143



>ref|XP_010914244.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Elaeis guineensis]
Length=574

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            P    RIRCQSTS ++ K K NLLDNASNLLTNLLSGG +G+MP AEGAVSDLFG+PLFF
Sbjct  35   PKKRSRIRCQSTSIEKPKMKRNLLDNASNLLTNLLSGGSLGTMPVAEGAVSDLFGQPLFF  94

Query  542  SLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SLYDWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAFSY
Sbjct  95   SLYDWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFSY  136



>ref|XP_008229650.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Prunus mume]
Length=577

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTSTDE KT+  LLDNASNLLTN LSGG +GSMP AEGAVSDLF RPLFF+LYDWF
Sbjct  47   IRCQSTSTDEPKTRRKLLDNASNLLTNFLSGGSLGSMPIAEGAVSDLFARPLFFALYDWF  106

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  107  LEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  142



>ref|XP_004303949.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011467680.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=572

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  323  GTRHSHGSSFKMKPS-GGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTA  499
            G  HS  ++  + P      IRCQSTST++ KTK NLLDNASNLLTNLLSGG +GSMP A
Sbjct  20   GYLHSSTTTNLLNPKLKRSSIRCQSTSTEDPKTKRNLLDNASNLLTNLLSGGNLGSMPIA  79

Query  500  EGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            EGAV+DLF RPLFFSLYDWF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAF Y
Sbjct  80   EGAVTDLFDRPLFFSLYDWFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFGY  135



>ref|XP_007215027.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
 gb|EMJ16226.1| hypothetical protein PRUPE_ppa003405mg [Prunus persica]
Length=577

 Score =   176 bits (446),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTSTDE KT+  LLDNASNLLTN LSGG +GSMP AEGAVSDLF RPLFF+LYDWF
Sbjct  45   IRCQSTSTDEPKTRRKLLDNASNLLTNFLSGGSLGSMPIAEGAVSDLFVRPLFFALYDWF  104

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  105  LEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  140



>ref|XP_010532498.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Tarenaya hassleriana]
Length=585

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 100/125 (80%), Gaps = 9/125 (7%)
 Frame = +2

Query  293  GLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSG  472
            GL   SSR+    +S         SG  RIRCQSTST E KT+ N+ DNASNLLTNLLSG
Sbjct  31   GLLGFSSRSISVGYSR--------SGSARIRCQSTSTKEPKTR-NIFDNASNLLTNLLSG  81

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G +GSMP A+GAVSDLFG+PLFFSLYDWFL++G VYKLAFGPKAFVVVSDPI+ARHILRE
Sbjct  82   GSLGSMPIAQGAVSDLFGKPLFFSLYDWFLEHGGVYKLAFGPKAFVVVSDPIIARHILRE  141

Query  653  NAFSY  667
            NAFSY
Sbjct  142  NAFSY  146



>gb|KHN35086.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=576

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLF  538
            +P     IRCQS +TD++K+  NLLDNASNLLT+LLSGG IGSMP AEGAVSDL GRPLF
Sbjct  36   QPKRISSIRCQSINTDKKKSSRNLLDNASNLLTDLLSGGSIGSMPIAEGAVSDLLGRPLF  95

Query  539  FSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FSLYDWFL++G+VYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  96   FSLYDWFLEHGAVYKLAFGPKAFVVVSDPIVARHILRENAFSY  138



>ref|XP_006841947.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Amborella trichopoda]
 gb|ERN03622.1| hypothetical protein AMTR_s00042p00221280 [Amborella trichopoda]
Length=589

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  341  GSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDL  520
            G   K + + G  +RCQSTS +E K + NLLDNASNLLTNLLSGG+IG MP AEGAVSDL
Sbjct  37   GKYQKKRRNNGFMLRCQSTSKNETKFEKNLLDNASNLLTNLLSGGRIGRMPVAEGAVSDL  96

Query  521  FGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FGRPLFFSLYDWFL++G+VYKLAFGPK+F+VVSDPIVARHILRENAF+Y
Sbjct  97   FGRPLFFSLYDWFLEHGAVYKLAFGPKSFIVVSDPIVARHILRENAFNY  145



>gb|KJB10648.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=579

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTST E K K NLLDNASNLLTN LSGG +GSMP AEGAVSDLFGRPLFFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNASNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIV +HILRENAFS+
Sbjct  106  LEHGSVYKLAFGPKAFVVVSDPIVVKHILRENAFSF  141



>ref|XP_010313051.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic-like 
[Solanum lycopersicum]
Length=585

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDW  556
            + RCQST TDE KTK++  DNASNLLTNLLSGG+IGSMP AEGAV+DLF RPLFFSLYDW
Sbjct  52   KCRCQSTGTDEPKTKVHSFDNASNLLTNLLSGGRIGSMPIAEGAVTDLFDRPLFFSLYDW  111

Query  557  FLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FLKYGSVYKLAFGPKAFVVVSDPIVARHIL ENAFSY
Sbjct  112  FLKYGSVYKLAFGPKAFVVVSDPIVARHILCENAFSY  148



>ref|XP_009412059.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=574

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +2

Query  380  IRCQSTSTDERKT-KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDW  556
            IRCQSTS ++ KT K NLLDNASNLLTN LSGG++G MPTAEGAVSDLFGRPLFFSLYDW
Sbjct  44   IRCQSTSMEKPKTSKRNLLDNASNLLTNFLSGGRLGDMPTAEGAVSDLFGRPLFFSLYDW  103

Query  557  FLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FL++GSVYKLAFGPKAFVVVSDP+VARHILRENAFSY
Sbjct  104  FLEHGSVYKLAFGPKAFVVVSDPVVARHILRENAFSY  140



>ref|XP_008451892.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Cucumis melo]
Length=580

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFGRPLFF+LYDWF
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGRPLFFALYDWF  106

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIVAR+ILRENAF+Y
Sbjct  107  LEHGSVYKLAFGPKAFVVVSDPIVARYILRENAFAY  142



>ref|NP_001046036.1| Os02g0173100 [Oryza sativa Japonica Group]
 dbj|BAF07950.1| Os02g0173100, partial [Oryza sativa Japonica Group]
Length=286

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRPLFFSLYDWF
Sbjct  1    RCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWF  60

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIVARHILRENAF Y
Sbjct  61   LEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFCY  96



>ref|XP_004147731.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Cucumis sativus]
 ref|XP_011653252.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Cucumis sativus]
 gb|KGN53488.1| hypothetical protein Csa_4G056760 [Cucumis sativus]
Length=580

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            +RCQST   E KTK NLLDNASNLLTNLLSGG +GSMP AEGAVSDLFGRPLFF+LYDWF
Sbjct  47   VRCQSTDVGEPKTKRNLLDNASNLLTNLLSGGNLGSMPIAEGAVSDLFGRPLFFALYDWF  106

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIVA++ILRENAFSY
Sbjct  107  LEHGSVYKLAFGPKAFVVVSDPIVAKYILRENAFSY  142



>ref|XP_007158591.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
 gb|ESW30585.1| hypothetical protein PHAVU_002G165400g [Phaseolus vulgaris]
Length=576

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            P     IRCQS +TD++K+  N+LDNASNLLT+LLSGG IGSMP AEGAVSDLF RPLFF
Sbjct  37   PQQISSIRCQSINTDKKKSSRNILDNASNLLTDLLSGGSIGSMPIAEGAVSDLFNRPLFF  96

Query  542  SLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SLYDWFL++G VYKLAFGPKAFVVVSDPI+ARHILRENAFSY
Sbjct  97   SLYDWFLEHGGVYKLAFGPKAFVVVSDPIIARHILRENAFSY  138



>ref|XP_008809593.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Phoenix dactylifera]
Length=572

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +2

Query  362  PSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            P    + RCQSTS ++ KTK NLLDNASNLLTNLLSGG + +MP A+GAVSDLFGRPLFF
Sbjct  33   PKKRSQTRCQSTSIEKPKTKRNLLDNASNLLTNLLSGGILETMPVADGAVSDLFGRPLFF  92

Query  542  SLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SLYDWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAFSY
Sbjct  93   SLYDWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFSY  134



>gb|AFW66345.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=169

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 6/101 (6%)
 Frame = +2

Query  383  RCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFS  544
            RCQSTS D+++ +       NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+PLFFS
Sbjct  38   RCQSTSVDKQQERPPKPKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFFS  97

Query  545  LYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LYDWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAF Y
Sbjct  98   LYDWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFYY  138



>ref|NP_001235534.1| cytochrome P450 97B2, chloroplastic [Glycine max]
 sp|O48921.1|C97B2_SOYBN RecName: Full=Cytochrome P450 97B2, chloroplastic; Flags: Precursor 
[Glycine max]
 gb|AAB94586.1| CYP97B2p [Glycine max]
Length=576

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLF  538
            +P     IRCQS +TD++K+  NLL NASNLLT+LLSGG IGSMP AEGAVSDL GRPLF
Sbjct  36   QPKRISSIRCQSINTDKKKSSRNLLGNASNLLTDLLSGGSIGSMPIAEGAVSDLLGRPLF  95

Query  539  FSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FSLYDWFL++G+VYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  96   FSLYDWFLEHGAVYKLAFGPKAFVVVSDPIVARHILRENAFSY  138



>ref|XP_006414564.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
 gb|ESQ56017.1| hypothetical protein EUTSA_v10024764mg [Eutrema salsugineum]
Length=581

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 101/136 (74%), Gaps = 11/136 (8%)
 Frame = +2

Query  260  HTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDN  439
            H    +GRS   L  +  +T  +R +  S           IRCQST+T E KT  N+LDN
Sbjct  20   HGGLHVGRSDYCLFGLYPQTENSRRASVS-----------IRCQSTNTKEPKTNGNILDN  68

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            ASNL TNLLSGG +GSMPTAEGAVSDLFG+PLF SLYDWFL++G VYKLAFGPKAFVV+S
Sbjct  69   ASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWFLEHGGVYKLAFGPKAFVVIS  128

Query  620  DPIVARHILRENAFSY  667
            DPIVARH+LRENAFSY
Sbjct  129  DPIVARHVLRENAFSY  144



>ref|XP_011002376.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Populus euphratica]
Length=585

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  326  TRHSHGSSF-KMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAE  502
            +R  H   F   K  G   IRCQSTST+E KT+ N LD ASNLLTNLLSGG +GSMP AE
Sbjct  34   SRFPHKYHFLSSKTKGSPLIRCQSTSTEEPKTR-NPLDKASNLLTNLLSGGNLGSMPIAE  92

Query  503  GAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            GAVSDLF RPLFFSLYDWF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  93   GAVSDLFSRPLFFSLYDWFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  147



>gb|AJD25227.1| cytochrome P450 CYP97B34 [Salvia miltiorrhiza]
Length=582

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 91/99 (92%), Gaps = 3/99 (3%)
 Frame = +2

Query  380  IRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLY  550
            IRCQS TSTDE K   KMNLLDNASNLLTN LSGGKI SMPTAEGAVSDLFG+PLF SL+
Sbjct  46   IRCQSSTSTDETKATKKMNLLDNASNLLTNFLSGGKILSMPTAEGAVSDLFGKPLFLSLF  105

Query  551  DWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            DWF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  106  DWFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  144



>ref|XP_010495892.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST T E KT  N LDNASNLLTN LSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  47   IRCQSTDTKEPKTNGNFLDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  106

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++G VYKLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  107  LEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFSY  142



>ref|XP_010435019.1| PREDICTED: cytochrome P450 97B3, chloroplastic-like [Camelina 
sativa]
Length=579

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST T E KT  NLLDNASNLLTN LSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  47   IRCQSTDTKEPKTNGNLLDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  106

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +++G V+KLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  107  MEHGGVFKLAFGPKAFVVISDPIVARHVLRENAFSY  142



>ref|XP_010440341.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Camelina sativa]
Length=578

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQS+ T E KT  N+LDNASNLLTN LSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  46   IRCQSSDTKEPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  105

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++G VYKLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  106  LEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFSY  141



>ref|XP_002308766.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
 gb|EEE92289.1| hypothetical protein POPTR_0006s00800g [Populus trichocarpa]
Length=579

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLF  538
            K  G   IRCQSTST+E KT+ N LD ASNLLTNLLSGG +GSMP AEGAVSDLF RPLF
Sbjct  40   KTKGSPLIRCQSTSTEEPKTR-NPLDKASNLLTNLLSGGNLGSMPIAEGAVSDLFSRPLF  98

Query  539  FSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FSL+DWF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  99   FSLFDWFIEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  141



>emb|CDP16026.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRC S  T+  K KMNLLDNASNLLTN LSGG++GSMP AEGAVSDLFGRPLFF+LYDWF
Sbjct  64   IRCHSAKTNAPKPKMNLLDNASNLLTNFLSGGRMGSMPMAEGAVSDLFGRPLFFALYDWF  123

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIV+RHILRENA SY
Sbjct  124  LEHGSVYKLAFGPKAFVVVSDPIVSRHILRENALSY  159



>dbj|BAD26183.1| putative cytochrome P450 [Oryza sativa Japonica Group]
Length=571

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  380  IRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDW  556
            +RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRPLFFSLYDW
Sbjct  41   VRCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDW  100

Query  557  FLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FL++GSVYKLAFGPKAFVVVSDPIVARHILRENAF Y
Sbjct  101  FLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFCY  137



>gb|EAY84668.1| hypothetical protein OsI_06039 [Oryza sativa Indica Group]
Length=571

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  380  IRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDW  556
            +RCQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRPLFFSLYDW
Sbjct  41   VRCQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDW  100

Query  557  FLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FL++GSVYKLAFGPKAFVVVSDPIVARHILRENAF Y
Sbjct  101  FLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFCY  137



>ref|XP_002520583.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41816.1| cytochrome P450, putative [Ricinus communis]
Length=555

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  335  SHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVS  514
            SH      K  G   IRCQ   TDE KT+  LLDNASNLLT+ LSGG +GSMP AEGAVS
Sbjct  8    SHYPLLNSKAKGSPVIRCQPKITDEPKTR-TLLDNASNLLTSFLSGGSLGSMPIAEGAVS  66

Query  515  DLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            DLF RPLFFSLYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  67   DLFNRPLFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  117



>ref|XP_010680161.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDW  556
            R  CQST+T++ K++ NLLDNASNLLTN LSGG +GSMPTAEGAVSDLFGRPLF SLYDW
Sbjct  43   RFICQSTNTEKPKSR-NLLDNASNLLTNFLSGGNLGSMPTAEGAVSDLFGRPLFLSLYDW  101

Query  557  FLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FL++GSVYKLAFGPKAFVVVSDPIVAR+ILRENAFSY
Sbjct  102  FLEHGSVYKLAFGPKAFVVVSDPIVARYILRENAFSY  138



>emb|CDY09057.1| BnaC08g10110D [Brassica napus]
Length=565

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST+T E K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  45   IRCQSTNTKEPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +++G VYKLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  104  MEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFSY  139



>emb|CDY22733.1| BnaA08g05630D [Brassica napus]
Length=566

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST+T E K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  45   IRCQSTNTKEPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +++G VYKLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  104  MEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFSY  139



>gb|EAZ21913.1| hypothetical protein OsJ_05566 [Oryza sativa Japonica Group]
Length=557

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  386  CQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFL  562
            CQS+S D++ K+K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRPLFFSLYDWFL
Sbjct  29   CQSSSVDDKPKSKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWFL  88

Query  563  KYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            ++GSVYKLAFGPKAFVVVSDPIVARHILRENAF Y
Sbjct  89   EHGSVYKLAFGPKAFVVVSDPIVARHILRENAFCY  123



>gb|EYU42831.1| hypothetical protein MIMGU_mgv1a003489mg [Erythranthe guttata]
Length=582

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 91/109 (83%), Gaps = 8/109 (7%)
 Frame = +2

Query  365  SGGCR-----IRCQS-TSTDERKT--KMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDL  520
            SG C      IRCQS TSTDE K   KM LLDNASN LTN LSGG IG MP AEGAVSDL
Sbjct  36   SGRCNPRFSSIRCQSSTSTDETKAAKKMTLLDNASNFLTNFLSGGNIGPMPIAEGAVSDL  95

Query  521  FGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            FG+PLFFSLYDWF+++GSVYKLAFGPKAF+VVSDPIVAR+ILRENAFSY
Sbjct  96   FGKPLFFSLYDWFIEHGSVYKLAFGPKAFIVVSDPIVARYILRENAFSY  144



>ref|XP_009107829.1| PREDICTED: cytochrome P450 97B3, chloroplastic [Brassica rapa]
Length=578

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 88/96 (92%), Gaps = 1/96 (1%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST+T + K+  N+LDNASNL TNLLSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  45   IRCQSTNTKDPKSS-NILDNASNLFTNLLSGGSLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +++G VYKLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  104  MEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFSY  139



>ref|XP_006648355.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Oryza brachyantha]
Length=543

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
             CQSTS D++ K K  LLDNASNLLTNLLSGG +G+MP AEGAV+DLFGRPLFFSLYDWF
Sbjct  14   ECQSTSVDDKPKPKRGLLDNASNLLTNLLSGGSLGAMPVAEGAVTDLFGRPLFFSLYDWF  73

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +++GSVYKLAFGPK+FVVVSDPIVARHILRENAF Y
Sbjct  74   IEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFCY  109



>gb|KFK33561.1| hypothetical protein AALP_AA5G029500 [Arabis alpina]
Length=577

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST+T E KT  N+LDNASNLLTN LSGG + SMP A+GAVSDLFG+PLF SLYDWF
Sbjct  45   IRCQSTNTKEPKTDGNILDNASNLLTNFLSGGSLSSMPIAKGAVSDLFGKPLFLSLYDWF  104

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +++G VYKLAFGPKAFVV+SDPIVARH+LRENAFSY
Sbjct  105  IEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFSY  140



>gb|KEH27407.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=463

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 5/101 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKM-----NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFS  544
            IRCQ+ + D++K        N+ DNASNLLTNLLSGG +G+MP AEGAV+DLF RPLFFS
Sbjct  36   IRCQAVNGDKKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFS  95

Query  545  LYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  96   LYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  136



>ref|XP_006285060.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
 gb|EOA17958.1| hypothetical protein CARUB_v10006369mg [Capsella rubella]
Length=576

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQST+T E K   N+LD+ASNLLTN LSGG +GSMPTAEGAVSDLFG+PLF SLYDWF
Sbjct  45   IRCQSTNTKEPKNG-NILDDASNLLTNFLSGGNLGSMPTAEGAVSDLFGKPLFLSLYDWF  103

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++G VYKLAFGPKAFVV+SDPIVARH+LRENAF+Y
Sbjct  104  LEHGGVYKLAFGPKAFVVISDPIVARHVLRENAFNY  139



>ref|XP_008679919.1| PREDICTED: cytochrome P450 97B2, chloroplastic [Zea mays]
 gb|ADL28271.1| carotene beta-ring hydroxylase [Zea mays]
 gb|AFP28222.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW66346.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=572

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 6/101 (6%)
 Frame = +2

Query  383  RCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFS  544
            RCQSTS D+++ +       NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+PLFFS
Sbjct  38   RCQSTSVDKQQERPPKPKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFFS  97

Query  545  LYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LYDWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAF Y
Sbjct  98   LYDWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFYY  138



>gb|AAT28222.1| putative 97B2-like cytochrome P450 [Ginkgo biloba]
Length=586

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 4/110 (4%)
 Frame = +2

Query  344  SSFKMKPSGGCRIRCQSTSTDERKTKMN--LLDNASNLLTNLLSGGKIGSMPTAEGAVSD  517
            SSF++ P      RC+S+ST ER TK N  LLDNASN LTNLLSGG++G+MP AEGAVSD
Sbjct  37   SSFRL-PGSKFFPRCESSST-ERATKSNRTLLDNASNFLTNLLSGGQLGTMPIAEGAVSD  94

Query  518  LFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LFG+PLFFSLYDWF+++GSVYKLAFGPK+FVVVSDPIV RHILRENAF+Y
Sbjct  95   LFGKPLFFSLYDWFIEHGSVYKLAFGPKSFVVVSDPIVVRHILRENAFAY  144



>ref|XP_003610974.1| Cytochrome P450 [Medicago truncatula]
 gb|AES93932.1| cytochrome P450 family 97 protein [Medicago truncatula]
Length=574

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 5/101 (5%)
 Frame = +2

Query  380  IRCQSTSTDERKTKM-----NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFS  544
            IRCQ+ + D++K        N+ DNASNLLTNLLSGG +G+MP AEGAV+DLF RPLFFS
Sbjct  36   IRCQAVNGDKKKQSSSSSSRNVFDNASNLLTNLLSGGSLGNMPIAEGAVTDLFDRPLFFS  95

Query  545  LYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  96   LYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  136



>sp|Q43078.1|C97B1_PEA RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome 
P450 97A2; Flags: Precursor [Pisum sativum]
 emb|CAA89260.1| cytochrome P450 [Pisum sativum]
Length=552

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = +2

Query  332  HSHGSSFKMKPSGGCRIRCQSTSTDERK-TKMNLLDNASNLLTNLLSGGKIGSMPTAEGA  508
            H H SS   + S    IRCQS + ++RK +  N+ DNASNLLT+LLSG  +GSMP AEGA
Sbjct  38   HFHFSSHSKRFSS---IRCQSVNGEKRKQSSRNVFDNASNLLTSLLSGANLGSMPIAEGA  94

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            V+DLF RPLFFSLYDWFL++GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  95   VTDLFDRPLFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  147



>emb|CAB10290.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB78553.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=576

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 3/96 (3%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            I+CQST   E KT  N+LDNASNLLTN LSGG +GSMPTAEG+VSDLFG+PLF SLYDWF
Sbjct  47   IKCQST---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGSVSDLFGKPLFLSLYDWF  103

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++G +YKLAFGPKAFVV+SDPI+ARH+LRENAFSY
Sbjct  104  LEHGGIYKLAFGPKAFVVISDPIIARHVLRENAFSY  139



>ref|NP_193247.2| cytochrome P450 97B3 [Arabidopsis thaliana]
 sp|O23365.2|C97B3_ARATH RecName: Full=Cytochrome P450 97B3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32753.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO00942.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AEE83557.1| cytochrome P450 97B3 [Arabidopsis thaliana]
Length=580

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 3/96 (3%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            I+CQST   E KT  N+LDNASNLLTN LSGG +GSMPTAEG+VSDLFG+PLF SLYDWF
Sbjct  51   IKCQST---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAEGSVSDLFGKPLFLSLYDWF  107

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++G +YKLAFGPKAFVV+SDPI+ARH+LRENAFSY
Sbjct  108  LEHGGIYKLAFGPKAFVVISDPIIARHVLRENAFSY  143



>ref|XP_004951757.1| PREDICTED: cytochrome P450 97B2, chloroplastic-like [Setaria 
italica]
Length=568

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 6/101 (6%)
 Frame = +2

Query  383  RCQSTSTDERKTK------MNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFS  544
            RCQSTS D+ + +       N+LDNASNLLTN LSGG +G+MP AEGAV+DLFG+PLFFS
Sbjct  37   RCQSTSVDKEQEQPPKPKQRNMLDNASNLLTNFLSGGSLGAMPVAEGAVTDLFGKPLFFS  96

Query  545  LYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            LYDWFL++GSVYKLAFGPK+FVVVSDP+VARHILRENAF Y
Sbjct  97   LYDWFLEHGSVYKLAFGPKSFVVVSDPMVARHILRENAFCY  137



>ref|XP_002868224.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44483.1| hypothetical protein ARALYDRAFT_493377 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 3/96 (3%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            I+CQS    E KT  N+LDNASNLLTN LSGG +GSMPTA+GAVSDLFG+PLF SLYDWF
Sbjct  42   IKCQSM---EPKTNGNILDNASNLLTNFLSGGSLGSMPTAQGAVSDLFGKPLFLSLYDWF  98

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++G VYKLAFGPKAFVV+SDPIVARHILRENAFSY
Sbjct  99   LEHGGVYKLAFGPKAFVVISDPIVARHILRENAFSY  134



>gb|EPS66221.1| hypothetical protein M569_08554, partial [Genlisea aurea]
Length=394

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = +2

Query  383  RCQSTSTDERKTKMNLLDNASNLLTNLLSGGK-IGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            RC+ ++  E    M+L DNASNLLTNLLSGG+  G MPTAEGAVSDLFGRPLFF+LYDWF
Sbjct  2    RCKLSTNAEDNKSMSLFDNASNLLTNLLSGGRRFGFMPTAEGAVSDLFGRPLFFALYDWF  61

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIVARHILR+NAF+Y
Sbjct  62   LQHGSVYKLAFGPKAFVVVSDPIVARHILRDNAFTY  97



>ref|XP_002451628.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
 gb|EES04604.1| hypothetical protein SORBIDRAFT_04g004850 [Sorghum bicolor]
Length=573

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 87/102 (85%), Gaps = 7/102 (7%)
 Frame = +2

Query  383  RCQSTSTDERKTKM-------NLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            RCQSTS D+++          NLLDNASNLLTN LSGG +G+MP AEGAV+DLFG+PLFF
Sbjct  38   RCQSTSVDKQQQPPPPKQKQRNLLDNASNLLTNFLSGGNLGAMPVAEGAVTDLFGKPLFF  97

Query  542  SLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SLYDWFL++GSVYKLAFGPK+FVVVSDPIVARHILRENAF Y
Sbjct  98   SLYDWFLEHGSVYKLAFGPKSFVVVSDPIVARHILRENAFCY  139



>dbj|BAR43285.1| cytochrome P450 CYP97B [Marchantia polymorpha]
Length=599

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 91/120 (76%), Gaps = 9/120 (8%)
 Frame = +2

Query  308  SSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGS  487
            SS  +G +HS G      P    R   +  S  ER    +LLDNASNLLTNLLSGG +GS
Sbjct  38   SSSPSGRKHSSGG-----PITCLRTDSEPKSVKER----SLLDNASNLLTNLLSGGNLGS  88

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP AEGAVSDLF RPLFF+LYDWF+++GSVYKLAFGPKAFVVVSDPIVARHILRENAF Y
Sbjct  89   MPIAEGAVSDLFARPLFFALYDWFIQHGSVYKLAFGPKAFVVVSDPIVARHILRENAFGY  148



>dbj|BAJ97821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 7/132 (5%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  13   LPRSSTGTHRVASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  66

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIV  631
            LTNLL+GG + +MP AEGAV+DLF RPLF+SLYDWFL++GSVYKLAFGPK+FVVVSDPIV
Sbjct  67   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLYDWFLEHGSVYKLAFGPKSFVVVSDPIV  126

Query  632  ARHILRENAFSY  667
            AR+ILRENAF Y
Sbjct  127  ARYILRENAFCY  138



>dbj|BAJ87287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 7/132 (5%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  13   LPRSSTGTHRVASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  66

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIV  631
            LTNLL+GG + +MP AEGAV+DLF RPLF+SLYDWFL++GSVYKLAFGPK+FVVVSDPIV
Sbjct  67   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLYDWFLEHGSVYKLAFGPKSFVVVSDPIV  126

Query  632  ARHILRENAFSY  667
            AR+ILRENAF Y
Sbjct  127  ARYILRENAFCY  138



>gb|EMS51606.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=571

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 7/132 (5%)
 Frame = +2

Query  275  LGRSCIGLPSISSRTAGTRHSHGSSFKMKPSGGCRIRCQSTSTDER-KTKMNLLDNASNL  451
            L RS  G   ++S    +  +HG S ++ P     +RCQS   D+  K K NL DNASNL
Sbjct  12   LPRSSTGTHRLASSYPSSSAAHGRS-RLLP-----VRCQSPGVDKTTKPKRNLFDNASNL  65

Query  452  LTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIV  631
            LTNLL+GG + +MP AEGAV+DLF RPLF+SLYDWFL++GSVYKLAFGPK+FVVVSDPIV
Sbjct  66   LTNLLAGGNLKNMPVAEGAVTDLFDRPLFYSLYDWFLEHGSVYKLAFGPKSFVVVSDPIV  125

Query  632  ARHILRENAFSY  667
            AR+ILRENAF Y
Sbjct  126  ARYILRENAFCY  137



>ref|XP_001769554.1| predicted protein [Physcomitrella patens]
 gb|EDQ65715.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 89/112 (79%), Gaps = 3/112 (3%)
 Frame = +2

Query  341  GSSFKMK--PSGGCRIRCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAV  511
            G SF ++  PS       Q   TD + + +  LLDNASNLLTNLLSGG +G+MP AEGAV
Sbjct  34   GHSFLLRHLPSKTRSRGIQCLKTDRKPENERTLLDNASNLLTNLLSGGNMGTMPIAEGAV  93

Query  512  SDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            SDLFGRPLFF+LYDWF+++G VYKLAFGPKAFVVVSDPIVARHILREN FSY
Sbjct  94   SDLFGRPLFFALYDWFMQHGPVYKLAFGPKAFVVVSDPIVARHILRENTFSY  145



>ref|XP_003570274.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=569

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            +RCQS   D+ K K +L DNASN+LTNLL+GG + +MP AEGAV+DLF RPLF+SLYDWF
Sbjct  40   VRCQSPGVDKTKPKRSLFDNASNVLTNLLAGGSLRNMPVAEGAVTDLFDRPLFYSLYDWF  99

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPK+FVVVSDPIVAR+ILRENAF Y
Sbjct  100  LEHGSVYKLAFGPKSFVVVSDPIVARYILRENAFCY  135



>gb|EMT03024.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=605

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = +2

Query  383  RCQSTSTDER-KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            RCQ    D+  K K NL DNASNLLTNLL+G  + +MP AEGAV+DLF RPLF+SLYDWF
Sbjct  23   RCQLPGVDKTTKPKRNLFDNASNLLTNLLAGSNLKNMPVAEGAVTDLFDRPLFYSLYDWF  82

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPK+FVVVSDPIVAR+ILRENAFSY
Sbjct  83   LEHGSVYKLAFGPKSFVVVSDPIVARYILRENAFSY  118



>gb|KHG14945.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=576

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTST E K K NLLDN SNLLTN LSGG +GSMP AEGAVSDLFGRPLFFSLYDWF
Sbjct  46   IRCQSTSTKEPKAKRNLLDNLSNLLTNFLSGGSLGSMPVAEGAVSDLFGRPLFFSLYDWF  105

Query  560  LKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            L++GSVYKLAFGPKAFVVVSDPIV +HILRENAFS+
Sbjct  106  LEHGSVYKLAFGPKAFVVVSDPIVVKHILRENAFSF  141



>ref|XP_002976141.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
 gb|EFJ23046.1| hypothetical protein SELMODRAFT_175360 [Selaginella moellendorffii]
Length=541

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAF  592
            K +   LDNASN LTN LSGG I +MP A+GA+SDLF RPLFF+LYDWFL++G VYKLAF
Sbjct  21   KPQRTFLDNASNALTNFLSGGGIQNMPVADGAISDLFSRPLFFALYDWFLEHGPVYKLAF  80

Query  593  GPKAFVVVSDPIVARHILRENAFSY  667
            GPK FVVVSDPIV+R+ILRENAF Y
Sbjct  81   GPKVFVVVSDPIVSRYILRENAFGY  105



>ref|XP_002968239.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
 gb|EFJ30493.1| hypothetical protein SELMODRAFT_145597, partial [Selaginella 
moellendorffii]
Length=563

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAF  592
            K +   LDNASN LTN LSGG I +MP A+GA+SDLF RPLFF+LYDWFL++G VYKLAF
Sbjct  46   KPQRTFLDNASNALTNFLSGGGIQNMPVADGAISDLFSRPLFFALYDWFLEHGPVYKLAF  105

Query  593  GPKAFVVVSDPIVARHILRENAFSY  667
            GPK FVVVSDPIV+R+ILRENAF Y
Sbjct  106  GPKVFVVVSDPIVSRYILRENAFGY  130



>ref|XP_011620464.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 97B2, chloroplastic 
[Amborella trichopoda]
Length=553

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLS--GGKIGSMPTAEGAVSDLFGRPLFFSLY  550
            R RC S+S      +  LLD AS++LTN+    G   G+MP A GA+SDL GRPLF SLY
Sbjct  40   RPRCDSSSVKPLLLRTVLLDKASDILTNIYRDRGESYGTMPVARGALSDLVGRPLFLSLY  99

Query  551  DWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            D+FLK+G VYK++FGPKAFV+VSDPIVARHILREN F Y
Sbjct  100  DFFLKHGLVYKVSFGPKAFVIVSDPIVARHILRENMFGY  138



>ref|XP_006854622.2| PREDICTED: cytochrome P450 97B2, chloroplastic [Amborella trichopoda]
Length=578

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  377  RIRCQSTSTDERKTKMNLLDNASNLLTNLLS--GGKIGSMPTAEGAVSDLFGRPLFFSLY  550
            R RC S+       +  LLD AS++LTNL    G   G+MP A GA+SDL GRPLF S+Y
Sbjct  40   RPRCDSSDAKPLSLRRVLLDKASDILTNLYRDRGESYGTMPVAGGALSDLVGRPLFLSIY  99

Query  551  DWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            D+FLK+G VYK++FGPKAFV+VSDPIVARHILREN F Y
Sbjct  100  DFFLKHGLVYKVSFGPKAFVIVSDPIVARHILRENMFGY  138



>gb|KJB10650.1| hypothetical protein B456_001G213800 [Gossypium raimondii]
Length=498

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP AEGAVSDLFGRPLFFSLYDWFL++GSVYKLAFGPKAFVVVSDPIV +HILRENAFS+
Sbjct  1    MPVAEGAVSDLFGRPLFFSLYDWFLEHGSVYKLAFGPKAFVVVSDPIVVKHILRENAFSF  60



>ref|XP_009612399.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTSTDE KTKMNL DNASNLLTNLLSGG IGSMP AEGAVSDLF RPLFFSLYDWF
Sbjct  51   IRCQSTSTDEPKTKMNLFDNASNLLTNLLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWF  110

Query  560  LK  565
            +K
Sbjct  111  IK  112



>ref|XP_009784852.1| PREDICTED: cytochrome P450 97B2, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=548

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  380  IRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            IRCQSTSTDE KTKMNL DNASNLLTN+LSGG IGSMP AEGAVSDLF RPLFFSLYDWF
Sbjct  53   IRCQSTSTDEPKTKMNLFDNASNLLTNMLSGGSIGSMPIAEGAVSDLFDRPLFFSLYDWF  112

Query  560  LK  565
            +K
Sbjct  113  IK  114



>gb|AFK42094.1| unknown [Medicago truncatula]
Length=84

 Score =   101 bits (252),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  627  MGSDTTTNAFGPKASLYTEPYFKNQSYSEKKSGRPKRSETAPSAVGMDPIFPPLNRLVRR  448
            MGSDTTTNAFGP ASLYTEP  KNQSYSEKK GR  +S TAPSA+G+ P  PPLN+ V+R
Sbjct  1    MGSDTTTNAFGPNASLYTEPCSKNQSYSEKKRGRSNKSVTAPSAIGIFPKLPPLNKFVKR  60

Query  447  LLALSN  430
            LLALSN
Sbjct  61   LLALSN  66



>gb|AGK38421.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSG---GKIG--SMPTAEGAVSDLFG-RPLFFSLYDWFLKYGS  574
            K K NL D  S +LT    G     +G  ++P A+G +SDL G  PLF +LY WFL+ G 
Sbjct  67   KGKGNLKDGLSRVLTEFSQGYFQPNVGGKNIPVAQGELSDLAGDEPLFKALYKWFLESGG  126

Query  575  VYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            V+KL FGPKAF+VVSDP+VARH+L+ENAF+Y
Sbjct  127  VFKLEFGPKAFIVVSDPVVARHLLKENAFNY  157



>gb|AGK38423.1| CYP97B1 [Parachlorella kessleri]
Length=607

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSG---GKIG--SMPTAEGAVSDLFG-RPLFFSLYDWFLKYGS  574
            K K NL D  S +LT    G     +G  ++P A+G +SDL G  PLF +LY WFL+ G 
Sbjct  67   KGKGNLKDGLSRVLTEFSQGYFQPNVGGKNIPVAQGELSDLAGDEPLFKALYKWFLESGG  126

Query  575  VYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            V+KL FGPKAF+VVSDP+VARH+L+ENAF+Y
Sbjct  127  VFKLEFGPKAFIVVSDPVVARHLLKENAFNY  157



>gb|AGK38422.1| CYP97B2 [Parachlorella kessleri]
Length=576

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSG---GKIG--SMPTAEGAVSDLFG-RPLFFSLYDWFLKYGS  574
            K K NL D  S +LT    G     +G  ++P A+G +SDL G  PLF +LY WFL+ G 
Sbjct  67   KGKGNLKDGLSRVLTEFSQGYFQPNVGGKNIPVAQGELSDLAGDEPLFKALYKWFLESGG  126

Query  575  VYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            V+KL FGPKAF+VVSDP+VARH+L+ENAF+Y
Sbjct  127  VFKLEFGPKAFIVVSDPVVARHLLKENAFNY  157



>emb|CDY08069.1| BnaA06g16570D [Brassica napus]
Length=474

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVA  634
            MPTAEGAVSDLFG+PLF SLYDWF+++G VYKLAFGPK FVV+SDPIVA
Sbjct  1    MPTAEGAVSDLFGKPLFLSLYDWFMEHGGVYKLAFGPKTFVVISDPIVA  49



>ref|XP_002955478.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
 gb|EFJ43549.1| hypothetical protein VOLCADRAFT_65884 [Volvox carteri f. nagariensis]
Length=641

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 10/93 (11%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSG-------GKIGSMPTAEGAVSDLFG-RPLFFSLYDWFLKY  568
            + K NL D  S LLT +  G       GK  ++P A+G +SDL G +PLF +LY WF++ 
Sbjct  90   RGKGNLTDGLSRLLTEISQGYFQPDVGGK--NIPVAQGELSDLAGDQPLFKALYQWFIES  147

Query  569  GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            G VYKL FGPKAF+VVSDP+V RH+L++NAF+Y
Sbjct  148  GGVYKLVFGPKAFIVVSDPVVVRHLLKDNAFNY  180



>ref|XP_006478583.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Citrus sinensis]
 ref|XP_006478584.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X5 [Citrus sinensis]
Length=204

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +2

Query  248  VAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSF------------KMKPSGGCRIRCQ  391
            +A+ H    +  S +   S +S   G    HG  F              KP     IRCQ
Sbjct  92   LASNHAQLNISISNLN-NSTNSEAVGYGSFHGREFGFVGGNSRTHLVNSKPKESPSIRCQ  150

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            ST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  PLFF
Sbjct  151  STGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLFF  200



>ref|XP_006478580.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Citrus sinensis]
Length=267

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +2

Query  248  VAATHTDCGLGRSCIGLPSISSRTAGTRHSHGSSFKM------------KPSGGCRIRCQ  391
            +A+ H    +  S +   S +S   G    HG  F              KP     IRCQ
Sbjct  155  LASNHAQLNISISNLN-NSTNSEAVGYGSFHGREFGFVGGNSRTHLVNSKPKESPSIRCQ  213

Query  392  STSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFF  541
            ST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  PLFF
Sbjct  214  STGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLFF  263



>ref|XP_006478581.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Citrus sinensis]
Length=266

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  359  KPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLF  538
            KP     IRCQST T+E KT+ NLLDNASNLLTNLLSGG +GSMP AEGAV DLF  PLF
Sbjct  202  KPKESPSIRCQSTGTNEPKTRRNLLDNASNLLTNLLSGGSLGSMPVAEGAVFDLFSSPLF  261

Query  539  F  541
            F
Sbjct  262  F  262



>ref|XP_005650550.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
 gb|EIE26006.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
Length=533

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +2

Query  485  SMPTAEGAVSDLFG-RPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAF  661
            ++P A+G +SDL G  PLF +LY WFL  G VYKLAFGPKAF+VVSDP+V RH+L+ENAF
Sbjct  18   TIPVAQGELSDLAGDEPLFKALYQWFLDSGGVYKLAFGPKAFIVVSDPVVVRHLLKENAF  77

Query  662  SY  667
            +Y
Sbjct  78   NY  79



>gb|AFR36909.1| chloroplast CYP97B, partial [Haematococcus pluvialis]
Length=539

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 59/84 (70%), Gaps = 6/84 (7%)
 Frame = +2

Query  434  DNASNLLTNLLSG---GKIG--SMPTAEGAVSDLFG-RPLFFSLYDWFLKYGSVYKLAFG  595
            D  S LLT +  G     +G  S+P ++G +SDL G  PLF +LY WFL  G VYKL FG
Sbjct  3    DGLSRLLTAVSQGYFQPDVGGASIPVSQGELSDLAGDEPLFKALYKWFLDCGGVYKLVFG  62

Query  596  PKAFVVVSDPIVARHILRENAFSY  667
            PKAF+VVSDP+V RHIL+ENAF+Y
Sbjct  63   PKAFIVVSDPVVVRHILKENAFNY  86



>ref|XP_005845008.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
 gb|EFN52906.1| hypothetical protein CHLNCDRAFT_138471 [Chlorella variabilis]
Length=614

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 10/93 (11%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLSG-------GKIGSMPTAEGAVSDLFG-RPLFFSLYDWFLKY  568
            K K NL D  S LLT++  G       GK  ++P A+G +SDL G  PLF +LY WF++ 
Sbjct  80   KGKGNLTDGLSRLLTDVSQGYFQPDVGGK--NIPVAQGELSDLAGDEPLFKALYKWFIES  137

Query  569  GSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            G V+KL FGPKAF+V+SDP+V RH+L+EN  +Y
Sbjct  138  GGVFKLEFGPKAFIVISDPLVVRHLLKENYTNY  170



>gb|AHA51695.1| P450-type beta-carotene hydroxylase CYP97B29 [Porphyra umbilicalis]
Length=658

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
            ++P AEG VSDL G P F +L+  F +YG +YKLAFGPK F+VV+DP+V RHILRE +  
Sbjct  150  TVPVAEGDVSDLMGGPFFLALHRCFKQYGPIYKLAFGPKVFIVVNDPVVCRHILRERSIL  209

Query  665  Y  667
            Y
Sbjct  210  Y  210



>ref|XP_002506759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68017.1| predicted protein [Micromonas sp. RCC299]
Length=538

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  491  PTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            P  EG+V DL G P+F +LY +FL+YG V+KLAFGPK F+V+SDP+V R +L+E  F++
Sbjct  47   PVCEGSVDDLVGGPIFLALYPYFLRYGGVFKLAFGPKVFMVLSDPVVVREVLKEKPFAF  105



>ref|XP_003062894.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52833.1| predicted protein [Micromonas pusilla CCMP1545]
Length=529

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  491  PTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            P  EG+V DL G P+F +LY +FLKYG V+KLAFGPK F+V+SDP++ R +L+E  F++
Sbjct  18   PVCEGSVDDLVGGPIFLALYPYFLKYGGVFKLAFGPKVFMVLSDPVIVRRVLKEKPFAF  76



>ref|XP_003074608.1| cytochrome P450 (ISS) [Ostreococcus tauri]
 emb|CAL50459.1| Cytochrome P450, conserved site [Ostreococcus tauri]
Length=576

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +2

Query  410  RKTKMNLLDNASNLLTNLLS--GGKI--GSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSV  577
            +  ++   D  S  +T +L   GGK    + P  EG + DL G P+F +LY +F +YG V
Sbjct  50   KPEQLKFQDIVSLWVTQILQTYGGKESKDNAPVCEGVIDDLVGGPIFLALYPYFRRYGGV  109

Query  578  YKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +KLAFGPK F+V+SDP++ R +L+E  FS+
Sbjct  110  FKLAFGPKVFMVLSDPVIVREVLKEKPFSF  139



>ref|XP_006649172.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Oryza 
brachyantha]
Length=553

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIG---SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFV  610
            AS LLT L SGG       +P A G++  + G+  F  LYD FL YG +++L FGPK+F+
Sbjct  29   ASALLTKLASGGAASRGPEIPQAVGSLRAVAGQAFFMPLYDLFLTYGGIFRLNFGPKSFL  88

Query  611  VVSDPIVARHILRENAFSY  667
            +VSDP++A+HILR+N+ +Y
Sbjct  89   IVSDPVIAKHILRDNSKAY  107



>ref|XP_001415984.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=563

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = +2

Query  398  STDERKTKMNLLDNASNLLTNLLS--GGK--IGSMPTAEGAVSDLFGRPLFFSLYDWFLK  565
            S D +  ++   D  S  +T +L   G K    + P  EG + DL G P+F +LY +F +
Sbjct  40   SDDFKPEELKFRDIVSLWVTQILQTYGDKESKDNAPVCEGVIDDLVGGPIFLALYPYFRR  99

Query  566  YGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            YG V+KLAFGPK F+V+SDP+V R +L+E  FS+
Sbjct  100  YGGVFKLAFGPKVFMVLSDPVVVREVLKEKPFSF  133



>ref|XP_007509002.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20088.1| predicted protein [Bathycoccus prasinos]
Length=584

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = +2

Query  404  DERKTKMNLLDNASNLLTNLLS--GGKIGS--MPTAEGAVSDLFGRPLFFSLYDWFLKYG  571
            DE K  + L D  S  +T +L   G K  S   P  EG + DL G P+F +LY +F KYG
Sbjct  64   DEVK-DLKLRDIISLWITQILQTYGDKPSSDNAPIVEGEIDDLVGGPIFLALYPYFRKYG  122

Query  572  SVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
             V+KLAFGPK F+V+SDP+V + +L+E  FS+
Sbjct  123  GVFKLAFGPKVFMVLSDPVVVKEVLKEKPFSF  154



>gb|EMT31539.1| Cytochrome P450 97B2 [Aegilops tauschii]
Length=587

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIG-SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            A+ LLT +  G + G  +P A G+++ + G   F  LYD FL YG V++L FGPK+F++V
Sbjct  65   AAGLLTKVAGGERRGPELPQAVGSLASVAGEAFFLPLYDLFLTYGGVFRLNFGPKSFLIV  124

Query  617  SDPIVARHILRENAFSY  667
            SDP VA+HILR+N+ +Y
Sbjct  125  SDPDVAKHILRDNSKAY  141



>ref|NP_001048526.1| Os02g0817900 [Oryza sativa Japonica Group]
 dbj|BAF10440.1| Os02g0817900 [Oryza sativa Japonica Group]
Length=643

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            A+ LLT +  GG    +P A G++S + G+  F  LYD FL YG +++L FGPK+F++VS
Sbjct  123  AAALLTKVAGGGG-PEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPKSFLIVS  181

Query  620  DPIVARHILRENAFSY  667
            DP +A+HILR+N+ +Y
Sbjct  182  DPAIAKHILRDNSKAY  197



>gb|EEC74248.1| hypothetical protein OsI_09455 [Oryza sativa Indica Group]
Length=629

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            A+ LLT +  GG    +P A G++S + G+  F  LYD FL YG +++L FGPK+F++VS
Sbjct  109  AAALLTKVAGGGG-PEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPKSFLIVS  167

Query  620  DPIVARHILRENAFSY  667
            DP +A+HILR+N+ +Y
Sbjct  168  DPAIAKHILRDNSKAY  183



>gb|EEE58048.1| hypothetical protein OsJ_08883 [Oryza sativa Japonica Group]
Length=632

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            A+ LLT +  GG    +P A G++S + G+  F  LYD FL YG +++L FGPK+F++VS
Sbjct  112  AAALLTKVAGGGG-PEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPKSFLIVS  170

Query  620  DPIVARHILRENAFSY  667
            DP +A+HILR+N+ +Y
Sbjct  171  DPAIAKHILRDNSKAY  186



>ref|XP_008646433.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Zea mays]
 gb|ACG28871.1| cytochrome P450 CYP97A16 [Zea mays]
 gb|AFP28221.1| beta-carotene hydroxylase [synthetic construct]
 gb|AFW74044.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ADD14592.2| carotene beta-ring hydroxylase [Zea mays subsp. mays]
Length=637

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            A+ LLT +   G    +P A G+++ + G+  F  LYD FL YG +++L FGPK+F++VS
Sbjct  122  AAALLTRVAGAGG-PEIPQAVGSINAVVGQAFFVPLYDLFLTYGGIFRLNFGPKSFLIVS  180

Query  620  DPIVARHILRENAFSY  667
            DP +A+HILREN+ +Y
Sbjct  181  DPAIAKHILRENSKAY  196



>ref|XP_005826161.1| cytochrome P450 [Guillardia theta CCMP2712]
 gb|EKX39181.1| cytochrome P450 [Guillardia theta CCMP2712]
Length=637

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  497  AEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +EG V DL G PLF  LY +F   G +YKL FGPK F+V SDP+V RHI+++N FSY
Sbjct  125  SEGVVDDLVGGPLFLPLYKYFKDCGGLYKLCFGPKVFMVASDPLVIRHIMKDNVFSY  181



>gb|EYU39507.1| hypothetical protein MIMGU_mgv1a003045mg [Erythranthe guttata]
Length=612

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = +2

Query  329  RHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGA  508
            R + G     KPS G +++       +  +K+ L +     + N   G     +P A G+
Sbjct  70   RIASGEFTVEKPSFGSQLK-------DGLSKLGLPEEVLGFVFNFSGGPNNLKIPEARGS  122

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +S +   P F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++N  SY
Sbjct  123  ISAITNEPFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNPKSY  175



>gb|EYU39508.1| hypothetical protein MIMGU_mgv1a003045mg [Erythranthe guttata]
Length=572

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 7/113 (6%)
 Frame = +2

Query  329  RHSHGSSFKMKPSGGCRIRCQSTSTDERKTKMNLLDNASNLLTNLLSGGKIGSMPTAEGA  508
            R + G     KPS G +++       +  +K+ L +     + N   G     +P A G+
Sbjct  70   RIASGEFTVEKPSFGSQLK-------DGLSKLGLPEEVLGFVFNFSGGPNNLKIPEARGS  122

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +S +   P F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++N  SY
Sbjct  123  ISAITNEPFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNPKSY  175



>gb|AJD25226.1| cytochrome P450 CYP97A41 [Salvia miltiorrhiza]
Length=612

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  416  TKMNLLDNASNLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFG  595
            +K+ L       + N++ G     +P A G+++ +   P F  LY+ +L YG +++L FG
Sbjct  96   SKLGLPKEIVEFIVNVIGGSGDLKIPEARGSIAAIRDEPFFIPLYELYLTYGGIFRLTFG  155

Query  596  PKAFVVVSDPIVARHILRENAFSY  667
            PK+F++VSDP +A+HIL++N  SY
Sbjct  156  PKSFLIVSDPSIAKHILKDNPKSY  179



>ref|XP_004954387.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004954388.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X2 [Setaria italica]
Length=701

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
             +P A G+++ + G+  F  LYD FL YG +++L FGPK+F++VSDP++A+HILR+N+ +
Sbjct  201  EIPQALGSINAVVGQAFFVPLYDLFLTYGGIFRLNFGPKSFLIVSDPVIAKHILRDNSKA  260

Query  665  Y  667
            Y
Sbjct  261  Y  261



>ref|XP_003570402.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Brachypodium 
distachyon]
Length=641

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
             +P A G+++ + G   F  LYD FL YG V++L FGPK+F++VSDP++A+HILR+N+ +
Sbjct  140  ELPQAVGSLAAVTGEAFFLPLYDLFLTYGGVFRLNFGPKSFLIVSDPVIAKHILRDNSKA  199

Query  665  Y  667
            Y
Sbjct  200  Y  200



>ref|XP_008355900.1| PREDICTED: uncharacterized protein LOC103419579 [Malus domestica]
Length=838

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  704  IPEAKGAISAIRSEAFFIPLFELYLTYGGIYRLKFGPKSFLIVSDPAIAKHILRENSKAY  763



>gb|AFU10537.1| chloroplast cytochrome P450 monooxygenase 97A3, partial [Daucus 
carota]
Length=370

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  LY+ +L YG V++L FGPK+F++VSDP VA+HILR+N+ +Y
Sbjct  122  IPEAKGAISAIRSEAFFIPLYELYLTYGGVFRLTFGPKSFLIVSDPTVAKHILRDNSKAY  181



>gb|KHN25634.1| Cytochrome P450 97B2, chloroplastic [Glycine soja]
Length=353

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  557  FLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
             +++G+VYKLAFGPKAFVVVSDPIVARHILRENAFSY
Sbjct  1    MMQHGAVYKLAFGPKAFVVVSDPIVARHILRENAFSY  37



>gb|EMS64313.1| Cytochrome P450 97B2, chloroplastic [Triticum urartu]
Length=512

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
             +P A G+++ + G   F  LYD FL YG V++L FGPK+F++VSDP VA+HILR+N+ +
Sbjct  6    ELPQAVGSLASVAGEAFFLPLYDLFLTYGGVFRLNFGPKSFLIVSDPDVAKHILRDNSKA  65

Query  665  Y  667
            Y
Sbjct  66   Y  66



>ref|XP_002454784.1| hypothetical protein SORBIDRAFT_04g037300 [Sorghum bicolor]
 gb|EES07760.1| hypothetical protein SORBIDRAFT_04g037300 [Sorghum bicolor]
Length=647

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
             +P A G+++ + G+  F  LYD FL YG +++L FGPK+F++VSDP +A+HILR+N+ +
Sbjct  146  EIPQALGSINAVVGQAFFVPLYDLFLTYGGIFRLNFGPKSFLIVSDPAIAKHILRDNSKA  205

Query  665  Y  667
            Y
Sbjct  206  Y  206



>gb|AFU10536.1| chloroplast cytochrome P450 monooxygenase 97A3 [Daucus carota]
Length=616

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  LY+ +L YG V++L FGPK+F++VSDP VA+HILR+N+ +Y
Sbjct  122  IPEAKGAISAIRSEAFFIPLYELYLTYGGVFRLTFGPKSFLIVSDPTVAKHILRDNSKAY  181



>gb|AIX87527.1| P450 carotenoid beta-ring hydroxylase [Lycium ruthenicum]
Length=603

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +   P F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  105  GDYPRIPEAKGSISAIRDEPFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKD  164

Query  653  NAFSY  667
            N+ +Y
Sbjct  165  NSKAY  169



>gb|AIX87503.1| P450 carotenoid beta-ring hydroxylase [Lycium barbarum]
Length=605

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +   P F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  105  GDYPRIPEAKGSISAIRDEPFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKD  164

Query  653  NAFSY  667
            N+ +Y
Sbjct  165  NSKAY  169



>ref|XP_010245679.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X1 [Nelumbo nucifera]
Length=641

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  + G+  F  LY+ +L YG +++L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  131  IPEAKGAMKAIGGQAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRENSKAY  190



>ref|XP_002319296.2| hypothetical protein POPTR_0013s08610g [Populus trichocarpa]
 gb|EEE95219.2| hypothetical protein POPTR_0013s08610g [Populus trichocarpa]
Length=464

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G +S +   P F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  116  IPEAKGKISAIRSEPFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAY  175



>ref|XP_009346816.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=575

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  84   IPEAKGAISAIQSEAFFVPLFELYLTYGGIYRLTFGPKSFLIVSDPAIAKHILRENSKAY  143



>ref|XP_009346815.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=577

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  84   IPEAKGAISAIQSEAFFVPLFELYLTYGGIYRLTFGPKSFLIVSDPAIAKHILRENSKAY  143



>ref|XP_001783943.1| predicted protein [Physcomitrella patens]
 gb|EDQ51253.1| predicted protein [Physcomitrella patens]
Length=561

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP + G V  + G P F  L   FL YG V++L FGPK+FV+VSDP+VA+H+L++NA +Y
Sbjct  78   MPESRGDVGAIVGEPFFKPLQKLFLIYGGVFRLTFGPKSFVIVSDPMVAKHLLKDNAKAY  137



>ref|XP_009114070.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Brassica 
rapa]
Length=214

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  +Y+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  147  VPEAKGSIQAVRNEAFFIPIYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  206



>ref|XP_010264030.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Nelumbo 
nucifera]
Length=640

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  + G+  F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  131  IPEAKGAIKAIRGQAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAY  190



>ref|XP_008370918.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Malus 
domestica]
Length=467

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  46   IPEAKGAISAIRSEAFFIPLFELYLTYGGIYRLKFGPKSFLIVSDPAIAKHILRENSKAY  105



>ref|XP_004302135.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=607

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G+VS +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR+NA +Y
Sbjct  117  IPEAKGSVSAVQNEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPAIAKHILRDNAKAY  176



>gb|EPS59936.1| hypothetical protein M569_14868, partial [Genlisea aurea]
Length=565

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +   P F  LY+ ++ YG +++L+FGPK+F++VSDP++A+HIL++N  SY
Sbjct  82   IPEAKGSIKAIRSEPFFIPLYELYMTYGGIFRLSFGPKSFLIVSDPLIAKHILKDNPKSY  141



>ref|NP_001234049.1| cytochrome P450-type monooxygenase 97A29 [Solanum lycopersicum]
 gb|ACJ25969.1| cytochrome P450-type monooxygenase 97A29 [Solanum lycopersicum]
 gb|ACJ65304.1| cytochrome P450-type monooxygenase 97A29 [Solanum lycopersicum]
Length=605

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +   P F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  109  GNYPRIPEAKGSISAIRDEPFFMPLYELYLTYGGIFRLIFGPKSFLIVSDPSIAKHILKD  168

Query  653  NAFSY  667
            N+ +Y
Sbjct  169  NSKAY  173



>ref|XP_006340502.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Solanum 
tuberosum]
Length=604

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +   P F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  108  GDYPRIPEAKGSISAIRDEPFFMPLYELYLTYGGIFRLIFGPKSFLIVSDPSIAKHILKD  167

Query  653  NAFSY  667
            N+ +Y
Sbjct  168  NSKAY  172



>ref|XP_010940645.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Elaeis 
guineensis]
Length=684

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  464  LSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHI  643
            L  G+   +P A+G++  + G+  F  LY+ F+ YG +++L FGPK+F++VSDP +A+HI
Sbjct  172  LPEGEQLEIPRAKGSLGAVGGQAFFLPLYELFVTYGGIFRLTFGPKSFLIVSDPTIAKHI  231

Query  644  LRENAFSY  667
            LR+N+ +Y
Sbjct  232  LRDNSKAY  239



>ref|XP_011013175.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Populus 
euphratica]
Length=627

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G ++ +   P F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  131  IPEAKGKINAIRSEPFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAY  190



>emb|CDY71050.1| BnaAnng35900D, partial [Brassica napus]
Length=291

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  +Y+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  112  VPEAKGSIQAVRNEAFFIPIYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  171



>ref|XP_009337974.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=671

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+ A+S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  178  IPEAKEAISAIRSEAFFIPLFELYLTYGGIYRLTFGPKSFLIVSDPAIAKHILRENSKAY  237



>ref|XP_003552430.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Glycine 
max]
 gb|KHN40452.1| Protein LUTEIN DEFICIENT 5, chloroplastic [Glycine soja]
Length=641

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  470  GGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILR  649
            GG+   +P A+G++  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR
Sbjct  138  GGEHPKIPEAKGSIKAVRSVAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILR  197

Query  650  ENAFSY  667
            EN+ +Y
Sbjct  198  ENSKAY  203



>ref|XP_005715216.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
 emb|CDF35397.1| cytochrome P450 family 97G-CYP97G1 [Chondrus crispus]
Length=591

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = +2

Query  422  MNLLDNASNLLTNLLS--GGKIG--SMPTAEGAVSDLFG-RPLFFSLYDWFLKYGSVYKL  586
            ++ +D+ S ++ N+L   G +    + P A+G +  + G +P F +L++ FL  G +YKL
Sbjct  54   LSAMDSVSLMVENVLVLYGNRPARDATPVAQGDLDAVMGDKPFFLALHNAFLDTGPIYKL  113

Query  587  AFGPKAFVVVSDPIVARHILRENAFSY  667
            AFGPK F+V+ DP++AR +LREN+  Y
Sbjct  114  AFGPKVFIVIQDPVIARSVLRENSILY  140



>ref|XP_009337972.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=674

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+ A+S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  178  IPEAKEAISAIRSEAFFIPLFELYLTYGGIYRLTFGPKSFLIVSDPAIAKHILRENSKAY  237



>ref|XP_008218412.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Prunus 
mume]
Length=610

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +Y+L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  120  IPEAKGAIRAIQSEAFFIPLYELYLTYGGIYRLTFGPKSFLIVSDPSIAKHILRDNSKAY  179



>ref|XP_007204988.1| hypothetical protein PRUPE_ppa003455mg [Prunus persica]
 gb|EMJ06187.1| hypothetical protein PRUPE_ppa003455mg [Prunus persica]
Length=573

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +Y+L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  83   IPEAKGAIGAIQSEAFFIPLYELYLTYGGIYRLTFGPKSFLIVSDPSIAKHILRDNSKAY  142



>ref|XP_008789534.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Phoenix 
dactylifera]
Length=640

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 9/94 (10%)
 Frame = +2

Query  413  KTKMNLLDNASNLLTNLLS--GGKIGS-------MPTAEGAVSDLFGRPLFFSLYDWFLK  565
            K+ +  L     LL  LLS   G+ GS       +P A+G+   + G+  F  LY+ FL 
Sbjct  102  KSGLAKLGPPGKLLKELLSRLAGEDGSPEGERPEIPQAKGSFRAVGGQAFFLPLYELFLT  161

Query  566  YGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            YG +++L FGPK+F++VSDP +A+HILR N+ +Y
Sbjct  162  YGGIFRLTFGPKSFLIVSDPAIAKHILRNNSKAY  195



>ref|XP_008218411.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Prunus 
mume]
Length=529

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +Y+L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  83   IPEAKGAIRAIQSEAFFIPLYELYLTYGGIYRLTFGPKSFLIVSDPSIAKHILRDNSKAY  142



>ref|XP_001700492.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
 gb|ABQ59244.1| CYP97A5 [Chlamydomonas reinhardtii]
 gb|EDO98047.1| cytochrome P450, carotenoid hydroxylase [Chlamydomonas reinhardtii]
Length=652

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP A G + ++ G+P+F  LY  FL YG +++L+FGPK+FV++SDP  A+ IL  NA  Y
Sbjct  121  MPEARGDIREIVGQPVFVPLYKLFLVYGKIFRLSFGPKSFVIISDPAYAKQILLTNADKY  180



>ref|XP_008388781.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic isoform 
X2 [Malus domestica]
Length=623

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G +S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  123  IPEAKGXISAIQSEAFFVPLFELYLTYGGIYRLTFGPKSFLIVSDPAIAKHILRENSKAY  182



>ref|XP_002958826.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
 gb|EFJ40130.1| hypothetical protein VOLCADRAFT_100143 [Volvox carteri f. nagariensis]
Length=671

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP A G + ++ G+P+F  LY  FL YG +++L+FGPK+FV++SDP  A+ IL  NA  Y
Sbjct  122  MPEARGDIREIVGQPVFVPLYKLFLVYGKIFRLSFGPKSFVIISDPAYAKQILLTNADKY  181



>ref|XP_002512609.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50061.1| cytochrome P450, putative [Ricinus communis]
Length=632

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+S +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR+N+ +Y
Sbjct  136  IPEAKGAISAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAY  195



>ref|XP_009386597.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=656

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  467  SGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHIL  646
            S G++  +P   G+V  + G+  F  LY+ FL YG +++L FGPK+F+++SDP +A+HIL
Sbjct  136  SSGELLEIPQTRGSVDAVAGQAFFIPLYELFLIYGGIFRLNFGPKSFLIISDPDIAKHIL  195

Query  647  RENAFSY  667
            + N+ +Y
Sbjct  196  KNNSKAY  202



>ref|XP_008388780.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic isoform 
X1 [Malus domestica]
Length=629

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G +S +     F  L++ +L YG +Y+L FGPK+F++VSDP +A+HILREN+ +Y
Sbjct  123  IPEAKGXISAIQSEAFFVPLFELYLTYGGIYRLTFGPKSFLIVSDPAIAKHILRENSKAY  182



>gb|AFR31786.1| cytochrome P450 [Haematococcus pluvialis]
Length=530

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP A G + +L G+P+F  LY  F  YG +++L+FGPK+FV++SDP  AR IL  NA  Y
Sbjct  115  MPEARGDLRELVGQPVFVPLYKLFTVYGKIFRLSFGPKSFVIISDPAYARQILLTNADKY  174



>dbj|BAR43284.1| cytochrome P450 CYP97A [Marchantia polymorpha]
Length=662

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  464  LSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHI  643
            L    +  +P A+G V  + G+P F  L+  F  YG +++L+FGPK+FV+VSDP + + I
Sbjct  139  LKQESLKKLPEAKGDVRKIVGQPFFVPLFTLFRTYGGIFRLSFGPKSFVIVSDPTITKRI  198

Query  644  LRENAFSY  667
            L++NA SY
Sbjct  199  LKDNAKSY  206



>ref|XP_011077088.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Sesamum 
indicum]
Length=617

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  458  NLLSGGKIG-SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVA  634
            NL +G +    +P A+G+++ +   P F  LY+ +L YG +++L FGPK+F++VSDP +A
Sbjct  110  NLTTGSEDHLKIPEAKGSINAIKNEPFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIA  169

Query  635  RHILRENAFSY  667
            +HIL++N  +Y
Sbjct  170  KHILKDNPKTY  180



>emb|CDP04239.1| unnamed protein product [Coffea canephora]
Length=639

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +2

Query  473  GKIG------SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVA  634
            GKIG       +P A+G+VS +     F  LY+ +L YG +++L FGPK+F++VSDP +A
Sbjct  132  GKIGPADDYPKIPEAKGSVSAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIA  191

Query  635  RHILRENAFSY  667
            +HIL++N+ +Y
Sbjct  192  KHILKDNSKAY  202



>ref|XP_003534527.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Glycine 
max]
Length=633

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  470  GGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILR  649
            GG    +P A+G++  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HILR
Sbjct  132  GGLQPKIPEAKGSIKAIRSVAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILR  191

Query  650  ENAFSY  667
            +N+ SY
Sbjct  192  DNSKSY  197



>ref|XP_009802494.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Nicotiana 
sylvestris]
Length=618

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  115  GDYPRIPEAKGSISAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKD  174

Query  653  NAFSY  667
            N+ +Y
Sbjct  175  NSKAY  179



>ref|XP_006304811.1| hypothetical protein CARUB_v10012441mg [Capsella rubella]
 gb|EOA37709.1| hypothetical protein CARUB_v10012441mg [Capsella rubella]
Length=594

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  112  IPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPAIAKHILKDNAKAY  171



>ref|XP_009627106.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Nicotiana 
tomentosiformis]
Length=618

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  115  GDYPRIPEAKGSISAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKD  174

Query  653  NAFSY  667
            N+ +Y
Sbjct  175  NSKAY  179



>gb|KFK44941.1| hypothetical protein AALP_AA1G322700 [Arabis alpina]
Length=593

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = +2

Query  467  SGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHIL  646
            S G    +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL
Sbjct  101  SDGDYLKVPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHIL  160

Query  647  RENAFSY  667
            ++NA  Y
Sbjct  161  KDNAKGY  167



>ref|XP_012088784.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic isoform 
X1 [Jatropha curcas]
 gb|KDP23307.1| hypothetical protein JCGZ_23140 [Jatropha curcas]
Length=631

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  467  SGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHIL  646
            +G     +P A+GA+S +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL
Sbjct  126  AGEDYPKIPEAKGAISAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHIL  185

Query  647  RENAFSY  667
            + N+ +Y
Sbjct  186  KNNSKAY  192



>ref|XP_010674674.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=628

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  476  KIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILREN  655
            K   +P A+G ++ +     F  LY+ +L YG +++L FGPKAF++VSDP + +HIL++N
Sbjct  129  KYSQIPVAKGQIAAIQSEAFFLPLYELYLTYGGIFRLVFGPKAFLIVSDPTIVKHILKDN  188

Query  656  AFSY  667
            + +Y
Sbjct  189  SKAY  192



>ref|XP_012088785.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic isoform 
X2 [Jatropha curcas]
Length=629

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  467  SGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHIL  646
            +G     +P A+GA+S +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL
Sbjct  126  AGEDYPKIPEAKGAISAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHIL  185

Query  647  RENAFSY  667
            + N+ +Y
Sbjct  186  KNNSKAY  192



>gb|ERM98304.1| hypothetical protein AMTR_s00094p00103220, partial [Amborella 
trichopoda]
Length=70

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  386  CQSTSTDERKTKMNLLDNASNLLTNLLS--GGKIGSMPTAEGAVSDLFGRPLFFSLYDWF  559
            C S+S      +  LLD AS++LTN+    G   G+MP A GA+SDL GRPLF SLYD+F
Sbjct  1    CDSSSVKPLLLRTVLLDKASDILTNIYRDRGESYGTMPVARGALSDLVGRPLFLSLYDFF  60

Query  560  LK  565
            LK
Sbjct  61   LK  62



>ref|XP_010499724.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Camelina 
sativa]
Length=595

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  113  IPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  172



>emb|CBJ27248.1| Cytochrome P450 [Ectocarpus siliculosus]
Length=774

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  497  AEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            + G + DL G PLF  L  +FL  G VYKLAFGP++F+VVSDP++A+H+L+ +   Y
Sbjct  204  SNGRLEDLAGGPLFLMLEKYFLAEGPVYKLAFGPRSFIVVSDPVMAKHVLKSSVGDY  260



>ref|XP_010461000.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Camelina 
sativa]
Length=595

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  113  IPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  172



>ref|XP_002965693.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
 gb|EFJ33113.1| hypothetical protein SELMODRAFT_407294 [Selaginella moellendorffii]
Length=553

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  491  PTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            P A   V  + G P F  LY+ ++++G +++L+FGPK+F++VSDP V +H+L++NA SY
Sbjct  75   PVARADVRAIAGEPFFVPLYNLYIQHGGIFRLSFGPKSFIIVSDPQVTKHVLKDNAKSY  133



>ref|XP_010478597.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Camelina 
sativa]
Length=595

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  113  IPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  172



>ref|XP_003542540.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Glycine max]
Length=534

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +2

Query  434  DNASNLLTNLLSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKA  604
            D  ++L  +L +G  +  +P A      VSDL G  LF  L+ W   YG +Y+LA GP+ 
Sbjct  54   DWLTSLSRSLTAGNDVSGIPVASAKLDDVSDLLGGALFLPLFKWMQDYGPIYRLAAGPRN  113

Query  605  FVVVSDPIVARHILR  649
            FVVVSDP +A+H+LR
Sbjct  114  FVVVSDPAIAKHVLR  128



>ref|XP_006291026.1| hypothetical protein CARUB_v10017141mg [Capsella rubella]
 gb|EOA23924.1| hypothetical protein CARUB_v10017141mg [Capsella rubella]
Length=476

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS GK     +P A      VSDL G  LF  LY W  +YG +Y+LA GP+ FVVV
Sbjct  65   LTRTLSSGKNDDSGIPIASAKLDDVSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVV  124

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  125  SDPAIAKHVLR  135



>emb|CDY27131.1| BnaA08g07690D [Brassica napus]
Length=593

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  114  VPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  173



>ref|XP_006415302.1| hypothetical protein EUTSA_v10007138mg [Eutrema salsugineum]
 gb|ESQ33655.1| hypothetical protein EUTSA_v10007138mg [Eutrema salsugineum]
Length=597

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  112  VPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  171



>ref|XP_010504071.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS GK     +P A      VSDL G  LF  LY W  +YG +Y+LA GP+ FVVV
Sbjct  71   LTRTLSSGKNDDSGIPIASAKLDDVSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVV  130

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  131  SDPAIAKHVLR  141



>gb|KIY93092.1| hypothetical protein MNEG_14870 [Monoraphidium neglectum]
Length=168

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENA  658
            MP A G + ++ G+P+F  LY    +YG +++L+FGPK FV++SDP  A+ IL  NA
Sbjct  110  MPEARGDIREIVGQPVFVPLYRLAQRYGKIFRLSFGPKTFVIISDPKYAKQILATNA  166



>gb|AAG50718.1|AC079041_11 cytochrome P450, putative [Arabidopsis thaliana]
Length=593

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  111  VPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  170



>ref|XP_010540722.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Tarenaya 
hassleriana]
Length=595

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +   P F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  107  IPEAKGSIRAVRNEPFFIPLYELYITYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  166



>emb|CDY12360.1| BnaC08g08450D [Brassica napus]
Length=597

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  118  VPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  177



>ref|NP_564384.1| protein LUTEIN DEFICIENT 5 [Arabidopsis thaliana]
 sp|Q93VK5.1|LUT5_ARATH RecName: Full=Protein LUTEIN DEFICIENT 5, chloroplastic; AltName: 
Full=Cytochrome P450 97A3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL08302.1| At1g31800/68069_m00159 [Arabidopsis thaliana]
 gb|AAL25587.1| At1g31800/68069_m00159 [Arabidopsis thaliana]
 gb|AAM98281.1| At1g31800/68069_m00159 [Arabidopsis thaliana]
 gb|AEE31394.1| protein LUTEIN DEFICIENT 5 [Arabidopsis thaliana]
Length=595

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  113  VPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  172



>gb|EWM30289.1| cytochrome p450 [Nannochloropsis gaditana]
Length=623

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  IGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENA  658
            +   P AEG VS +     F  LY +F KYG VYKL FGPK+F+V+SDP + +H+L+ N 
Sbjct  116  VDGAPLAEGEVSSMTDGTAFLGLYQYFKKYGPVYKLLFGPKSFIVLSDPTIIKHVLKTNN  175

Query  659  FSY  667
             +Y
Sbjct  176  VAY  178



>gb|KDO54883.1| hypothetical protein CISIN_1g0072311mg, partial [Citrus sinensis]
Length=333

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GAV+ +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+  Y
Sbjct  117  IPEAKGAVNAIRSEAFFLPLYELYLTYGGIFRLTFGPKSFLIVSDPSMAKHILKDNSKGY  176



>ref|XP_002890950.1| hypothetical protein ARALYDRAFT_473366 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67209.1| hypothetical protein ARALYDRAFT_473366 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ FL YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  104  VPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAY  163



>gb|KDO54885.1| hypothetical protein CISIN_1g0072311mg, partial [Citrus sinensis]
 gb|KDO54886.1| hypothetical protein CISIN_1g0072311mg, partial [Citrus sinensis]
 gb|KDO54887.1| hypothetical protein CISIN_1g0072311mg, partial [Citrus sinensis]
Length=332

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GAV+ +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+  Y
Sbjct  117  IPEAKGAVNAIRSEAFFLPLYELYLTYGGIFRLTFGPKSFLIVSDPSMAKHILKDNSKGY  176



>gb|KDO54884.1| hypothetical protein CISIN_1g0072311mg, partial [Citrus sinensis]
Length=323

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GAV+ +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+  Y
Sbjct  108  IPEAKGAVNAIRSEAFFLPLYELYLTYGGIFRLTFGPKSFLIVSDPSMAKHILKDNSKGY  167



>ref|XP_010515801.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic-like 
[Camelina sativa]
Length=545

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS GK     +P A      VSDL G  LF  LY W  +YG +Y+LA GP+ FVVV
Sbjct  71   LTRTLSSGKNDDSGIPIASAKLDDVSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVV  130

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  131  SDPAIAKHVLR  141



>gb|KEH23385.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=487

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++S +     F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  192  IPEAKGSISAIRSEAFFIPLYELYITYGGIFRLNFGPKSFLIVSDPAIAKHILKDNSKAY  251



>ref|XP_010907644.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=544

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            VSDL G  LF  L+ W L+YG VY+LA GP+ FVVVSDP +A+H+LR     Y
Sbjct  89   VSDLLGGALFLPLFKWMLEYGPVYRLAAGPRNFVVVSDPAIAKHVLRSYGTKY  141



>ref|XP_003624119.1| Cytochrome P450 [Medicago truncatula]
Length=389

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++S +     F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  139  IPEAKGSISAIRSEAFFIPLYELYITYGGIFRLNFGPKSFLIVSDPAIAKHILKDNSKAY  198



>ref|XP_010070132.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Eucalyptus 
grandis]
 gb|KCW58728.1| hypothetical protein EUGRSUZ_H01373 [Eucalyptus grandis]
Length=626

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  130  IPEAKGAIKAIQNEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  189



>ref|XP_010907643.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=549

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            VSDL G  LF  L+ W L+YG VY+LA GP+ FVVVSDP +A+H+LR     Y
Sbjct  89   VSDLLGGALFLPLFKWMLEYGPVYRLAAGPRNFVVVSDPAIAKHVLRSYGTKY  141



>gb|KJB82186.1| hypothetical protein B456_013G180200 [Gossypium raimondii]
Length=591

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  95   IPEAKGAIKAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  154



>ref|XP_010907645.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X3 [Elaeis guineensis]
Length=542

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            VSDL G  LF  L+ W L+YG VY+LA GP+ FVVVSDP +A+H+LR     Y
Sbjct  89   VSDLLGGALFLPLFKWMLEYGPVYRLAAGPRNFVVVSDPAIAKHVLRSYGTKY  141



>gb|KHF99465.1| Cytochrome P450, chloroplastic [Gossypium arboreum]
Length=572

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  120  IPEAKGAIHAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  179



>ref|XP_010907646.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X4 [Elaeis guineensis]
Length=483

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            VSDL G  LF  L+ W L+YG VY+LA GP+ FVVVSDP +A+H+LR     Y
Sbjct  89   VSDLLGGALFLPLFKWMLEYGPVYRLAAGPRNFVVVSDPAIAKHVLRSYGTKY  141



>ref|XP_007139751.1| hypothetical protein PHAVU_008G056400g [Phaseolus vulgaris]
 gb|ESW11745.1| hypothetical protein PHAVU_008G056400g [Phaseolus vulgaris]
Length=643

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  467  SGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHIL  646
             GG+   +P A+G++  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL
Sbjct  137  EGGEHPKIPEAKGSIKAVRSVAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPNIAKHIL  196

Query  647  RENAFSY  667
            ++N+ +Y
Sbjct  197  KDNSKAY  203



>tpg|DAA46176.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=180

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  467  SGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVAR  637
            SGG    +P A      V DL G  LF  L+ WF + G VY+LA GP+ FV+VSDP VAR
Sbjct  74   SGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPQDFVIVSDPAVAR  133

Query  638  HILR  649
            H+LR
Sbjct  134  HVLR  137



>gb|KJB82185.1| hypothetical protein B456_013G180200 [Gossypium raimondii]
Length=616

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  120  IPEAKGAIKAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  179



>gb|KJB82188.1| hypothetical protein B456_013G180200 [Gossypium raimondii]
Length=603

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  120  IPEAKGAIKAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  179



>gb|KJB82184.1| hypothetical protein B456_013G180200 [Gossypium raimondii]
Length=614

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  120  IPEAKGAIKAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  179



>gb|KJB82187.1| hypothetical protein B456_013G180200 [Gossypium raimondii]
Length=512

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  120  IPEAKGAIKAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  179



>gb|KJB82189.1| hypothetical protein B456_013G180200 [Gossypium raimondii]
Length=517

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GA+  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  120  IPEAKGAIKAIRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNSKAY  179



>ref|XP_010426945.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Camelina 
sativa]
Length=544

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  +S GK     +P A      VSDL G  LF  LY W  +YG +Y+LA GP+ FVVV
Sbjct  70   LTRTISSGKNDDSGIPIASAKLDDVSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVV  129

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  130  SDPAIAKHVLR  140



>ref|XP_006428548.1| hypothetical protein CICLE_v10011312mg [Citrus clementina]
 gb|ESR41788.1| hypothetical protein CICLE_v10011312mg [Citrus clementina]
Length=478

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GAV+ +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+  Y
Sbjct  117  IPEAKGAVNAIRSEAFFLPLYELYLTYGGIFRLTFGPKSFLIVSDPSMAKHILKDNSKGY  176



>ref|NP_190881.2| carotene epsilon-monooxygenase [Arabidopsis thaliana]
 sp|Q6TBX7.1|LUT1_ARATH RecName: Full=Carotene epsilon-monooxygenase, chloroplastic; 
AltName: Full=Cytochrome P450 97C1; AltName: Full=Protein LUTEIN 
DEFICIENT 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAR83120.1| chloroplast carotenoid epsilon-ring hydroxylase [Arabidopsis 
thaliana]
 gb|AEE79040.1| carotene epsilon-monooxygenase [Arabidopsis thaliana]
Length=539

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS GK     +P A      V+DL G  LF  LY W  +YG +Y+LA GP+ FV+V
Sbjct  65   LTRTLSSGKNDESGIPIANAKLDDVADLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVIV  124

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  125  SDPAIAKHVLR  135



>gb|AES80336.2| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=689

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++S +     F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  192  IPEAKGSISAIRSEAFFIPLYELYITYGGIFRLNFGPKSFLIVSDPAIAKHILKDNSKAY  251



>gb|AES80337.2| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=589

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A+G++S +     F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  187  GLYPKIPEAKGSISAIRSEAFFIPLYELYITYGGIFRLNFGPKSFLIVSDPAIAKHILKD  246

Query  653  NAFSY  667
            N+ +Y
Sbjct  247  NSKAY  251



>ref|XP_008807069.1| PREDICTED: LOW QUALITY PROTEIN: carotene epsilon-monooxygenase, 
chloroplastic [Phoenix dactylifera]
Length=552

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            VSDL G  LF  L+ W L+YG +Y+LA GP+ FVVVSDP +A+H+LR     Y
Sbjct  92   VSDLLGGALFLPLFKWMLEYGPIYRLAAGPRNFVVVSDPAIAKHVLRSYGTKY  144



>gb|AAM13903.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=552

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS GK     +P A      V+DL G  LF  LY W  +YG +Y+LA GP+ FV+V
Sbjct  78   LTRTLSSGKNDESGIPIANAKLDDVADLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVIV  137

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  138  SDPAIAKHVLR  148



>ref|XP_007029434.1| Cytochrome P450, family 97, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
 gb|EOY09936.1| Cytochrome P450, family 97, subfamily A, polypeptide 3 isoform 
1 [Theobroma cacao]
Length=585

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  446  NLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDP  625
             +L  L   G    +P A+G +  +     F  LY+ +L YG +++L  GPK+F++VSDP
Sbjct  80   EVLEFLFKCGDYPKIPEAKGTIKAIRSEAFFLPLYELYLTYGGMFRLTIGPKSFLIVSDP  139

Query  626  IVARHILRENAFSY  667
             +A+HILR+N+ SY
Sbjct  140  SIAKHILRDNSKSY  153



>ref|XP_004133753.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Cucumis 
sativus]
 gb|KGN56324.1| hypothetical protein Csa_3G115620 [Cucumis sativus]
Length=624

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = +2

Query  416  TKMNLLDNASNLLTNLLSG-GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAF  592
            +KM +     +LL  L++   +   +P A+G+V+ +     F  LY+ +L YG +++L F
Sbjct  109  SKMGVPSEILDLLFGLVNAQDEYPKIPEAKGSVNAIRSEAFFMPLYELYLTYGGIFRLTF  168

Query  593  GPKAFVVVSDPIVARHILRENAFSY  667
            GPK+F++VSDP +A+HIL++N  +Y
Sbjct  169  GPKSFLIVSDPSIAKHILKDNPKNY  193



>ref|XP_007029435.1| Cytochrome P450 97B2 isoform 2 [Theobroma cacao]
 gb|EOY09937.1| Cytochrome P450 97B2 isoform 2 [Theobroma cacao]
Length=605

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  446  NLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDP  625
             +L  L   G    +P A+G +  +     F  LY+ +L YG +++L  GPK+F++VSDP
Sbjct  100  EVLEFLFKCGDYPKIPEAKGTIKAIRSEAFFLPLYELYLTYGGMFRLTIGPKSFLIVSDP  159

Query  626  IVARHILRENAFSY  667
             +A+HILR+N+ SY
Sbjct  160  SIAKHILRDNSKSY  173



>ref|XP_007029436.1| Cytochrome P450, family 97, subfamily A, polypeptide 3 isoform 
3, partial [Theobroma cacao]
 gb|EOY09938.1| Cytochrome P450, family 97, subfamily A, polypeptide 3 isoform 
3, partial [Theobroma cacao]
Length=595

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  446  NLLTNLLSGGKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDP  625
             +L  L   G    +P A+G +  +     F  LY+ +L YG +++L  GPK+F++VSDP
Sbjct  92   EVLEFLFKCGDYPKIPEAKGTIKAIRSEAFFLPLYELYLTYGGMFRLTIGPKSFLIVSDP  151

Query  626  IVARHILRENAFSY  667
             +A+HILR+N+ SY
Sbjct  152  SIAKHILRDNSKSY  165



>ref|XP_003624118.1| Cytochrome P450 [Medicago truncatula]
 gb|ABD28565.1| E-class P450, group I [Medicago truncatula]
Length=636

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++S +     F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++N+ +Y
Sbjct  139  IPEAKGSISAIRSEAFFIPLYELYITYGGIFRLNFGPKSFLIVSDPAIAKHILKDNSKAY  198



>ref|XP_006428547.1| hypothetical protein CICLE_v10011312mg [Citrus clementina]
 ref|XP_006491779.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491780.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR41787.1| hypothetical protein CICLE_v10011312mg [Citrus clementina]
Length=612

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GAV+ +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+  Y
Sbjct  117  IPEAKGAVNAIRSEAFFLPLYELYLTYGGIFRLTFGPKSFLIVSDPSMAKHILKDNSKGY  176



>ref|XP_003058421.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
 gb|EEH56876.1| cytochrome P450 superfamily protein [Micromonas pusilla CCMP1545]
Length=702

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +2

Query  479  IGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENA  658
            +  MP A G + ++ G+P+F  LY  FL YG ++ LA GPK FVVVSD  VAR +L++ A
Sbjct  121  MSKMPVAAGDIREIAGQPVFVPLYKLFLAYGEMFVLAIGPKKFVVVSDNDVAREMLKDQA  180

Query  659  FSY  667
             S+
Sbjct  181  TSF  183



>ref|XP_005652354.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
 gb|EIE27810.1| cytochrome P450 [Coccomyxa subellipsoidea C-169]
Length=431

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP A G + ++ G+P+F  L    + YG V++L+FGPK+FVVVSD  VARHI+  NA +Y
Sbjct  1    MPEARGDIREIVGQPVFVPLQKLAMIYGKVFRLSFGPKSFVVVSDAAVARHIMMTNAANY  60



>ref|XP_006428546.1| hypothetical protein CICLE_v10011312mg [Citrus clementina]
 ref|XP_006491781.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like isoform 
X3 [Citrus sinensis]
 gb|ESR41786.1| hypothetical protein CICLE_v10011312mg [Citrus clementina]
Length=603

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+GAV+ +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++N+  Y
Sbjct  108  IPEAKGAVNAIRSEAFFLPLYELYLTYGGIFRLTFGPKSFLIVSDPSMAKHILKDNSKGY  167



>ref|XP_008658121.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Zea 
mays]
 gb|ADD14593.1| carotene epsilon-ring hydroxylase [Zea mays subsp. mays]
 gb|AFP28223.1| carotene epsilon-ring hydroxylase [synthetic construct]
Length=556

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  467  SGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVAR  637
            SGG    +P A      V DL G  LF  L+ WF + G VY+LA GP+ FV+VSDP VAR
Sbjct  74   SGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPQDFVIVSDPAVAR  133

Query  638  HILR  649
            H+LR
Sbjct  134  HVLR  137



>gb|AGI61105.1| carotenoid hydroxylase [Parachlorella kessleri]
Length=647

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            MP A G + ++ G+P+F  L+  +  YG ++KL+FGPK FVVVSDP + + IL  NA +Y
Sbjct  122  MPVARGDIREIIGQPVFIPLFKLYQVYGGIFKLSFGPKNFVVVSDPQITKQILLTNAGAY  181



>tpg|DAA46175.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=420

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  467  SGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVAR  637
            SGG    +P A      V DL G  LF  L+ WF + G VY+LA GP+ FV+VSDP VAR
Sbjct  74   SGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPQDFVIVSDPAVAR  133

Query  638  HILR  649
            H+LR
Sbjct  134  HVLR  137



>ref|XP_004492816.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Cicer 
arietinum]
Length=633

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ ++ YG +++L FGPK+F++VSDP +A+HIL++NA +Y
Sbjct  138  IPEAKGSIKAIRSEAFFIPLYELYITYGGIFRLNFGPKSFLIVSDPAIAKHILKDNAKAY  197



>emb|CAB64216.1| Cytochrom P450-like protein [Arabidopsis thaliana]
Length=566

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS GK     +P A      V+DL G  LF  LY W  +YG +Y+LA GP+ FV+V
Sbjct  65   LTRTLSSGKNDESGIPIANAKLDDVADLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVIV  124

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  125  SDPAIAKHVLR  135



>gb|ERM98042.1| hypothetical protein AMTR_s00120p00092320 [Amborella trichopoda]
Length=661

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
             +P A+G+   +   P F  LY+ FL YG +++L FGPK+F++VSDP +A+ ILREN+ +
Sbjct  154  QIPQAKGSAGFIGSAPFFIPLYELFLTYGGLFRLKFGPKSFLIVSDPSIAKRILRENSKA  213

Query  665  Y  667
            Y
Sbjct  214  Y  214



>ref|XP_008450166.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Cucumis 
melo]
Length=628

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = +2

Query  416  TKMNLLDNASNLLTNLLSG-GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAF  592
            +KM +     +LL  L++   +   +P A+G+++ +     F  LY+ +L YG +++L F
Sbjct  109  SKMGVPSEILDLLFGLVNAQDEYPKIPEAKGSINAIRSEAFFVPLYELYLTYGGIFRLTF  168

Query  593  GPKAFVVVSDPIVARHILRENAFSY  667
            GPK+F++VSDP +A+HIL++N  +Y
Sbjct  169  GPKSFLIVSDPSIAKHILKDNPKNY  193



>gb|EPS64627.1| hypothetical protein M569_10150 [Genlisea aurea]
Length=624

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  425  NLLDNASNLLTNLLSGGKIGSMPTAEGA----VSDLFGRPLFFSLYDWFLKYGSVYKLAF  592
            + L + SN + ++L      ++P A GA    VS+L G  LF  L+ W  +YG +Y+LA 
Sbjct  57   DWLTSVSNSVASVLGPKDESNIPVA-GAKLEDVSELLGGALFLPLFKWMNQYGPIYRLAA  115

Query  593  GPKAFVVVSDPIVARHILRENAFSY  667
            GP+ FVVVSDP +ARH+LR     Y
Sbjct  116  GPRNFVVVSDPSIARHVLRNYGTKY  140



>ref|XP_010546518.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=517

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILR  649
            VSDL G  LF  LY W  +YG +Y+LA GP+ FVVVSDP +A+H+LR
Sbjct  91   VSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVVSDPAIAKHVLR  137



>emb|CBI17673.3| unnamed protein product [Vitis vinifera]
Length=638

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+H+LR+N+ +Y
Sbjct  142  VPEAKGSIRAVRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHVLRDNSKAY  201



>ref|XP_002876190.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52449.1| hypothetical protein ARALYDRAFT_485688 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  +S G+     +P A      VSDL G  LF  LY W  +YG +Y+LA GP+ FV+V
Sbjct  56   LTRTISSGQNDDSGIPIANAKLEDVSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVIV  115

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  116  SDPAIAKHVLR  126



>ref|XP_002279984.3| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Vitis vinifera]
Length=672

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFSY  667
            +P A+G++  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+H+LR+N+ +Y
Sbjct  176  VPEAKGSIRAVRSEAFFIPLYELYLTYGGIFRLTFGPKSFLIVSDPSIAKHVLRDNSKAY  235



>ref|XP_010546517.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=543

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  509  VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILR  649
            VSDL G  LF  LY W  +YG +Y+LA GP+ FVVVSDP +A+H+LR
Sbjct  91   VSDLLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVVSDPAIAKHVLR  137



>ref|XP_007145288.1| hypothetical protein PHAVU_007G2265001g, partial [Phaseolus vulgaris]
 gb|ESW17282.1| hypothetical protein PHAVU_007G2265001g, partial [Phaseolus vulgaris]
Length=406

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query  434  DNASNLLTNLLSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKA  604
            D  ++L  +L +G     +P A      VSDL G  LF  L+ W   YG +Y+LA GP+ 
Sbjct  55   DWLTSLSRSLTAGNDDSGIPIATAKLDDVSDLLGGALFLPLFKWMQDYGPIYRLAAGPRN  114

Query  605  FVVVSDPIVARHILR  649
            FVVVSDP +A+H+LR
Sbjct  115  FVVVSDPAIAKHVLR  129



>ref|XP_006830626.2| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Amborella 
trichopoda]
Length=676

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  485  SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENAFS  664
             +P A+G+   +   P F  LY+ FL YG +++L FGPK+F++VSDP +A+ ILREN+ +
Sbjct  169  QIPQAKGSAGFIGSAPFFIPLYELFLTYGGLFRLKFGPKSFLIVSDPSIAKRILRENSKA  228

Query  665  Y  667
            Y
Sbjct  229  Y  229



>ref|XP_010050328.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Eucalyptus 
grandis]
Length=559

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  434  DNASNLLTNLLSGGKIGS-MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPK  601
            D  ++L  +L +G   GS +P A      VSDL G  LF  L+ W  +YG +Y+LA GP+
Sbjct  68   DWLTSLARSLAAGAGDGSGIPVASAKLDDVSDLLGGVLFLPLFKWMKEYGPIYRLAAGPR  127

Query  602  AFVVVSDPIVARHILR  649
             FVVVSDP +A+H+LR
Sbjct  128  NFVVVSDPAIAKHVLR  143



>gb|KCW89308.1| hypothetical protein EUGRSUZ_A01599 [Eucalyptus grandis]
Length=529

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  434  DNASNLLTNLLSGGKIGS-MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPK  601
            D  ++L  +L +G   GS +P A      VSDL G  LF  L+ W  +YG +Y+LA GP+
Sbjct  38   DWLTSLARSLAAGAGDGSGIPVASAKLDDVSDLLGGVLFLPLFKWMKEYGPIYRLAAGPR  97

Query  602  AFVVVSDPIVARHILR  649
             FVVVSDP +A+H+LR
Sbjct  98   NFVVVSDPAIAKHVLR  113



>ref|XP_010111039.1| Protein LUTEIN DEFICIENT 5 [Morus notabilis]
 gb|EXC29901.1| Protein LUTEIN DEFICIENT 5 [Morus notabilis]
Length=613

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  473  GKIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRE  652
            G    +P A G++  +     F  LY+ +L YG +++L FGPK+F++VSDP +A+HIL++
Sbjct  112  GDYPKIPEARGSIKAVQSEAFFIPLYELYLSYGGIFRLNFGPKSFLIVSDPSIAKHILKD  171

Query  653  NAFSY  667
            N+ +Y
Sbjct  172  NSKAY  176



>ref|XP_003537025.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic [Glycine 
max]
Length=537

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +2

Query  434  DNASNLLTNLLSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKA  604
            D  ++L  +L +G     +P A      VSDL G  LF  L+ W   YG +Y+LA GP+ 
Sbjct  57   DWLTSLSRSLAAGNDDSGIPLASAKLDDVSDLLGGALFLPLFKWMQDYGPIYRLAAGPRN  116

Query  605  FVVVSDPIVARHILR  649
            FVVVSDP +A+H+LR
Sbjct  117  FVVVSDPAIAKHVLR  131



>gb|KFK34549.1| hypothetical protein AALP_AA5G160700 [Arabis alpina]
Length=542

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS G+     +P A      VS+L G  LF  LY W  +YG +Y+LA GP+ FVVV
Sbjct  68   LTRTLSSGQNDDSGIPIASAKLDDVSELLGGALFLPLYKWMNQYGPIYRLAAGPRNFVVV  127

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  128  SDPAIAKHVLR  138



>ref|XP_010241652.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=555

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = +2

Query  452  LTNLLSGGKIGS-MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            LT  LS G+  S +P A      VSDL G  LF  L+ W  +YG +Y+LA GP+ FV+VS
Sbjct  71   LTRPLSIGRDDSGIPIANAKLEDVSDLLGGALFLPLFKWMNEYGPIYRLAAGPRNFVIVS  130

Query  620  DPIVARHILR  649
            DP +A+H+LR
Sbjct  131  DPAIAKHVLR  140



>dbj|BAJ91518.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 6/80 (8%)
 Frame = +2

Query  440  ASNLLTNLLSGGKIG----SMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAF  607
            A+ LLT +L G        ++P   G+++   G  +F  LYD FL +G +++L  GPK+F
Sbjct  89   AAGLLTKVLGGSAAARRGPALPQVAGSLAA--GDAIFLPLYDHFLTHGGLFRLNLGPKSF  146

Query  608  VVVSDPIVARHILRENAFSY  667
            V+VSDP +A+HILR+N+ +Y
Sbjct  147  VIVSDPDIAKHILRDNSKAY  166



>gb|EEC67393.1| hypothetical protein OsI_34547 [Oryza sativa Indica Group]
Length=557

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  464  LSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVA  634
            L GG    +P A      V DL G  LF  L+ WF + G VY+LA GP+  VVVSDP VA
Sbjct  74   LGGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPRDLVVVSDPAVA  133

Query  635  RHILR  649
            RH+LR
Sbjct  134  RHVLR  138



>ref|XP_006403722.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
 gb|ESQ45175.1| hypothetical protein EUTSA_v10010267mg [Eutrema salsugineum]
Length=546

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +2

Query  452  LTNLLSGGKIGS--MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVV  616
            LT  LS G+     +P A      VS+L G  LF  LY W  +YG +Y+LA GP+ FVVV
Sbjct  71   LTRTLSSGQNDDSGIPIASAKLEDVSELLGGALFLPLYKWMNEYGPIYRLAAGPRNFVVV  130

Query  617  SDPIVARHILR  649
            SDP +A+H+LR
Sbjct  131  SDPAIAKHVLR  141



>ref|NP_001065217.1| Os10g0546600 [Oryza sativa Japonica Group]
 gb|ABB47954.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27131.1| Os10g0546600 [Oryza sativa Japonica Group]
 dbj|BAG89623.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51348.1| hypothetical protein OsJ_32354 [Oryza sativa Japonica Group]
Length=561

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  464  LSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVA  634
            L GG    +P A      V DL G  LF  L+ WF + G VY+LA GP+  VVVSDP VA
Sbjct  78   LGGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPRDLVVVSDPAVA  137

Query  635  RHILR  649
            RH+LR
Sbjct  138  RHVLR  142



>ref|XP_002185035.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43482.1| lut1-1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=538

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +2

Query  434  DNASNLLTNL--LSGG--KIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPK  601
            D+A+ L TN+  + GG   +   P AEG ++D+    +F  L +++  YGS YKL FGPK
Sbjct  14   DSANVLRTNIEQIYGGFPSLDGCPLAEGELADIGDGTMFIGLQNYYRNYGSPYKLCFGPK  73

Query  602  AFVVVSDPIVARHILRENAFSY  667
            +F+V+SDP+ A+HIL++   +Y
Sbjct  74   SFLVISDPVQAKHILKDANTNY  95



>ref|XP_002185034.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43481.1| lutein deficient 1-like protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=644

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +2

Query  434  DNASNLLTNL--LSGG--KIGSMPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPK  601
            D+A+ L TN+  + GG   +   P AEG ++D+    +F  L +++  YGS YKL FGPK
Sbjct  120  DSANVLRTNIEQIYGGFPSLDGCPLAEGELADIGDGTMFIGLQNYYRNYGSPYKLCFGPK  179

Query  602  AFVVVSDPIVARHILRENAFSY  667
            +F+V+SDP+ A+HIL++   +Y
Sbjct  180  SFLVISDPVQAKHILKDANTNY  201



>ref|XP_010241651.1| PREDICTED: carotene epsilon-monooxygenase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=580

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = +2

Query  452  LTNLLSGGKIGS-MPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVS  619
            LT  LS G+  S +P A      VSDL G  LF  L+ W  +YG +Y+LA GP+ FV+VS
Sbjct  71   LTRPLSIGRDDSGIPIANAKLEDVSDLLGGALFLPLFKWMNEYGPIYRLAAGPRNFVIVS  130

Query  620  DPIVARHILR  649
            DP +A+H+LR
Sbjct  131  DPAIAKHVLR  140



>gb|AAK20054.1|AC025783_14 putative cytochrome P450 monooxygenase [Oryza sativa Japonica 
Group]
Length=584

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  464  LSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVA  634
            L GG    +P A      V DL G  LF  L+ WF + G VY+LA GP+  VVVSDP VA
Sbjct  78   LGGGDDSGIPVASAKLDDVRDLLGGALFLPLFKWFREEGPVYRLAAGPRDLVVVSDPAVA  137

Query  635  RHILR  649
            RH+LR
Sbjct  138  RHVLR  142



>gb|AGN27239.1| CYP97A1 [Parachlorella kessleri]
Length=647

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  488  MPTAEGAVSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILRENA  658
            MP A G + ++ G+P+F  L+  +  YG ++KL+FGPK FVVVSDP + + IL  NA
Sbjct  122  MPVARGDIREIIGQPVFIPLFKLYQVYGGIFKLSFGPKNFVVVSDPQITKQILLTNA  178



>ref|XP_001781608.1| predicted protein [Physcomitrella patens]
 gb|EDQ53564.1| predicted protein [Physcomitrella patens]
Length=576

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (53%), Gaps = 13/108 (12%)
 Frame = +2

Query  365  SGGCRIRCQSTSTDERKTKMNLLDNAS-------NLLTNLLSGGK---IGSMPTAEGA--  508
             G  R+RC   + D    + ++  + +       + LT ++S GK      +P A+    
Sbjct  53   QGRLRVRCSGGAEDNDNGRSSVEKSGAGKSWVSPDWLTKIVSLGKGPDTSGIPVADAKLE  112

Query  509  -VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKAFVVVSDPIVARHILR  649
             V DL G  LF  L+ W ++ G VY+LA GP+ FV+V DP VA+H+L+
Sbjct  113  DVKDLLGGALFLPLFKWMMENGPVYRLAAGPRNFVIVGDPAVAKHVLK  160



>gb|AJB84623.1| carotene epsilon-monooxygenase [Camellia sinensis]
Length=557

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = +2

Query  434  DNASNLLTNLLSGGKIGSMPTAEGA---VSDLFGRPLFFSLYDWFLKYGSVYKLAFGPKA  604
            D  ++L  +L  G    ++P A      VS+L G  LF  L+ W  +YG +Y+LA GP+ 
Sbjct  65   DWLTSLAQSLSIGKDDSNIPIANAKLEDVSELLGGALFLPLFKWMQEYGPIYRLAAGPRN  124

Query  605  FVVVSDPIVARHILR  649
            FVVVSDP +A+H+LR
Sbjct  125  FVVVSDPAIAKHVLR  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1105426564043