BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4387

Length=831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB65008.1|  hypothetical protein B456_010G075800                    308   6e-97   Gossypium raimondii
gb|AAP49699.1|  putative oligosaccharyl transferase STT3 protein        295   2e-96   Vitis vinifera
ref|XP_008462759.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    311   2e-96   
ref|XP_006451262.1|  hypothetical protein CICLE_v10007513mg             310   6e-96   Citrus clementina [clementine]
dbj|BAJ92657.1|  predicted protein                                      294   1e-95   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009775565.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    309   2e-95   Nicotiana sylvestris
ref|XP_011048330.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    309   2e-95   Populus euphratica
ref|XP_011048329.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    309   3e-95   Populus euphratica
ref|XP_011655447.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    308   6e-95   Cucumis sativus [cucumbers]
gb|EPS65439.1|  hypothetical protein M569_09336                         299   7e-95   Genlisea aurea
gb|KJB65007.1|  hypothetical protein B456_010G075800                    308   8e-95   Gossypium raimondii
gb|KHG24964.1|  Oligosaccharyl transferase subunit STT3                 307   1e-94   Gossypium arboreum [tree cotton]
ref|XP_002514244.1|  oligosaccharyl transferase, putative               307   1e-94   Ricinus communis
gb|EYU30721.1|  hypothetical protein MIMGU_mgv1a001650mg                307   1e-94   Erythranthe guttata [common monkey flower]
ref|XP_009626922.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    306   2e-94   Nicotiana tomentosiformis
gb|KHG22028.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    305   2e-94   Gossypium arboreum [tree cotton]
ref|XP_010249572.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    306   3e-94   Nelumbo nucifera [Indian lotus]
ref|XP_006353484.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    306   3e-94   Solanum tuberosum [potatoes]
ref|XP_011078262.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    306   3e-94   Sesamum indicum [beniseed]
emb|CDP03275.1|  unnamed protein product                                306   4e-94   Coffea canephora [robusta coffee]
ref|XP_002280521.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    305   5e-94   Vitis vinifera
ref|XP_008462758.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    304   1e-93   Cucumis melo [Oriental melon]
ref|XP_012076776.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    304   1e-93   Jatropha curcas
gb|KJB83104.1|  hypothetical protein B456_013G229700                    304   2e-93   Gossypium raimondii
ref|XP_008242518.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    304   2e-93   Prunus mume [ume]
ref|XP_002325019.2|  hypothetical protein POPTR_0018s09300g             304   2e-93   Populus trichocarpa [western balsam poplar]
ref|XP_008810656.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    304   2e-93   Phoenix dactylifera
ref|XP_003516821.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    304   2e-93   Glycine max [soybeans]
emb|CDY71196.1|  BnaCnng71800D                                          292   2e-93   Brassica napus [oilseed rape]
ref|XP_007203242.1|  hypothetical protein PRUPE_ppa001464mg             304   3e-93   
ref|XP_004497228.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    303   3e-93   Cicer arietinum [garbanzo]
ref|XP_007013062.1|  Staurosporin and temperature sensitive 3-lik...    304   3e-93   
ref|XP_007013063.1|  Staurosporin and temperature sensitive 3-lik...    303   3e-93   
ref|XP_010924651.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    303   4e-93   Elaeis guineensis
ref|XP_006853616.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    303   5e-93   Amborella trichopoda
ref|XP_004251627.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    303   5e-93   Solanum lycopersicum
ref|XP_009352534.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    302   7e-93   
ref|XP_004961472.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    302   7e-93   Setaria italica
ref|XP_010047698.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    302   9e-93   Eucalyptus grandis [rose gum]
gb|KHN16965.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    302   9e-93   Glycine soja [wild soybean]
ref|XP_003547741.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    302   1e-92   Glycine max [soybeans]
ref|XP_007152904.1|  hypothetical protein PHAVU_004G170000g             301   2e-92   Phaseolus vulgaris [French bean]
ref|XP_010095369.1|  Dolichyl-diphosphooligosaccharide--protein g...    301   2e-92   Morus notabilis
ref|XP_009410892.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    301   3e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441399.1|  hypothetical protein SORBIDRAFT_09g025920          301   3e-92   Sorghum bicolor [broomcorn]
ref|XP_003592715.1|  Dolichyl-diphosphooligosaccharide-protein gl...    300   4e-92   Medicago truncatula
ref|NP_568380.1|  dolichyl-diphosphooligosaccharide--protein glyc...    300   6e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420783.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    300   7e-92   Camelina sativa [gold-of-pleasure]
ref|XP_004287460.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    300   7e-92   Fragaria vesca subsp. vesca
dbj|BAJ94938.1|  predicted protein                                      300   7e-92   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568077.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    300   1e-91   Brachypodium distachyon [annual false brome]
ref|XP_010493048.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    299   1e-91   Camelina sativa [gold-of-pleasure]
gb|EMT28410.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    303   2e-91   
ref|XP_010519673.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    298   2e-91   Tarenaya hassleriana [spider flower]
ref|NP_001136963.1|  hypothetical protein                               280   2e-91   
ref|XP_010454253.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    298   3e-91   Camelina sativa [gold-of-pleasure]
gb|AAK91413.1|  AT5g19690/T29J13_110                                    298   4e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387183.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    297   5e-91   
ref|XP_006287100.1|  hypothetical protein CARUB_v10000271mg             296   2e-90   Capsella rubella
gb|KFK26187.1|  hypothetical protein AALP_AA8G213900                    296   2e-90   Arabis alpina [alpine rockcress]
ref|XP_008647462.1|  PREDICTED: uncharacterized protein LOC100217...    295   4e-90   Zea mays [maize]
ref|XP_010688294.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    295   5e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006654660.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    295   5e-90   Oryza brachyantha
ref|XP_010254009.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    295   6e-90   Nelumbo nucifera [Indian lotus]
gb|EEC79544.1|  hypothetical protein OsI_20658                          300   6e-90   Oryza sativa Indica Group [Indian rice]
ref|XP_002871900.1|  hypothetical protein ARALYDRAFT_488863             295   6e-90   
ref|NP_001056068.1|  Os05g0519900                                       295   7e-90   
ref|XP_009120866.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    295   7e-90   Brassica rapa
ref|XP_006400531.1|  hypothetical protein EUTSA_v10012742mg             293   2e-89   Eutrema salsugineum [saltwater cress]
emb|CDX92509.1|  BnaA10g15480D                                          293   2e-89   
ref|XP_001784427.1|  predicted protein                                  284   2e-89   
emb|CDX88879.1|  BnaA03g07700D                                          292   4e-89   
emb|CDX70886.1|  BnaC03g09700D                                          291   1e-88   
gb|ACN31857.1|  unknown                                                 280   2e-88   Zea mays [maize]
ref|XP_009131748.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    290   3e-88   Brassica rapa
ref|XP_010535959.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    288   2e-87   Tarenaya hassleriana [spider flower]
gb|EMS67963.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    291   2e-87   Triticum urartu
ref|XP_001784419.1|  predicted protein                                  285   2e-86   
gb|EMS46014.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    287   2e-86   Triticum urartu
ref|XP_003569794.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    285   3e-86   Brachypodium distachyon [annual false brome]
ref|XP_002983693.1|  oligosaccharyltransferase subunit STT3             283   1e-85   
ref|XP_002456347.1|  hypothetical protein SORBIDRAFT_03g034385          281   2e-85   
gb|KHN40395.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    282   2e-85   Glycine soja [wild soybean]
ref|XP_004969929.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    282   3e-85   Setaria italica
emb|CDM84058.1|  unnamed protein product                                279   4e-85   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001146306.1|  hypothetical protein                               280   5e-85   Zea mays [maize]
ref|XP_008672724.1|  PREDICTED: hypothetical protein isoform X1         281   7e-85   Zea mays [maize]
ref|XP_008672725.1|  PREDICTED: hypothetical protein isoform X2         281   7e-85   Zea mays [maize]
gb|EMT33768.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    279   2e-84   
emb|CDY42286.1|  BnaC02g08920D                                          274   3e-82   Brassica napus [oilseed rape]
ref|XP_010915814.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    266   4e-79   Elaeis guineensis
ref|XP_006451261.1|  hypothetical protein CICLE_v10007513mg             258   1e-76   
gb|ACL54353.1|  unknown                                                 251   1e-73   Zea mays [maize]
ref|XP_006381754.1|  hypothetical protein POPTR_0006s17690g             241   2e-72   
gb|KGN65135.1|  hypothetical protein Csa_1G237040                       220   1e-67   Cucumis sativus [cucumbers]
gb|ACF79760.1|  unknown                                                 218   6e-67   Zea mays [maize]
gb|AFK44312.1|  unknown                                                 218   6e-65   Lotus japonicus
dbj|BAF01432.1|  hypothetical protein                                   212   3e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KHN23613.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    216   1e-63   Glycine soja [wild soybean]
emb|CBG76274.1|  OO_Ba0005L10-OO_Ba0081K17.25                           221   5e-63   Oryza officinalis
gb|KHN24504.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    217   1e-62   Glycine soja [wild soybean]
ref|XP_006653023.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    220   2e-62   Oryza brachyantha
ref|XP_002448765.1|  hypothetical protein SORBIDRAFT_06g032800          220   2e-62   Sorghum bicolor [broomcorn]
ref|NP_001131374.1|  oligosaccharyl transferase STT3 subunit            219   3e-62   Zea mays [maize]
ref|NP_001054248.1|  Os04g0675500                                       219   3e-62   
ref|XP_004515278.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    220   3e-62   Cicer arietinum [garbanzo]
ref|NP_001168720.1|  hypothetical protein                               219   3e-62   Zea mays [maize]
ref|XP_004960084.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    219   4e-62   Setaria italica
ref|XP_009391070.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    219   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534085.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    219   7e-62   Glycine max [soybeans]
ref|XP_008803294.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    219   7e-62   Phoenix dactylifera
ref|XP_003620143.1|  Dolichyl-diphosphooligosaccharide-protein gl...    218   7e-62   Medicago truncatula
ref|XP_004137528.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    218   2e-61   Cucumis sativus [cucumbers]
emb|CBI35275.3|  unnamed protein product                                214   2e-61   Vitis vinifera
ref|XP_003548296.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    217   2e-61   Glycine max [soybeans]
ref|XP_010940347.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   2e-61   Elaeis guineensis
ref|XP_006374276.1|  hypothetical protein POPTR_0015s05610g             216   3e-61   
ref|XP_010940345.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    217   3e-61   Elaeis guineensis
ref|XP_011003683.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    217   3e-61   Populus euphratica
gb|EYU17803.1|  hypothetical protein MIMGU_mgv1a001976mg                217   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_002318345.2|  STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIK...    217   4e-61   Populus trichocarpa [western balsam poplar]
gb|KJB78537.1|  hypothetical protein B456_013G004300                    216   4e-61   Gossypium raimondii
ref|XP_010543062.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   4e-61   Tarenaya hassleriana [spider flower]
ref|XP_011047756.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   5e-61   Populus euphratica
dbj|BAJ87792.1|  predicted protein                                      216   5e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008375065.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   5e-61   Malus domestica [apple tree]
ref|XP_009355928.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   6e-61   Pyrus x bretschneideri [bai li]
ref|XP_006493422.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   6e-61   Citrus sinensis [apfelsine]
ref|XP_006441420.1|  hypothetical protein CICLE_v10019005mg             216   6e-61   Citrus clementina [clementine]
ref|XP_008240342.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   6e-61   Prunus mume [ume]
ref|XP_007210892.1|  hypothetical protein PRUPE_ppa001886mg             216   7e-61   Prunus persica
ref|XP_009630495.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   8e-61   Nicotiana tomentosiformis
ref|XP_008467302.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   8e-61   Cucumis melo [Oriental melon]
ref|XP_008393507.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   8e-61   Malus domestica [apple tree]
ref|XP_002269119.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   8e-61   Vitis vinifera
ref|XP_009792115.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   8e-61   Nicotiana sylvestris
emb|CDO98566.1|  unnamed protein product                                216   9e-61   Coffea canephora [robusta coffee]
ref|XP_005847365.1|  hypothetical protein CHLNCDRAFT_31189              216   9e-61   Chlorella variabilis
ref|XP_003580816.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   9e-61   Brachypodium distachyon [annual false brome]
ref|XP_011086954.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    216   1e-60   Sesamum indicum [beniseed]
ref|XP_006847859.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    215   1e-60   Amborella trichopoda
ref|XP_006353938.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    215   1e-60   Solanum tuberosum [potatoes]
ref|XP_004299463.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    215   1e-60   Fragaria vesca subsp. vesca
ref|XP_010935542.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    215   1e-60   Elaeis guineensis
ref|XP_004235404.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    215   1e-60   Solanum lycopersicum
ref|XP_010530133.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    215   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_005650137.1|  STT3 subunit of Oligosaccharyl transferase         214   2e-60   Coccomyxa subellipsoidea C-169
ref|XP_006415033.1|  hypothetical protein EUTSA_v10006908mg             215   2e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006306856.1|  hypothetical protein CARUB_v10008402mg             215   2e-60   Capsella rubella
ref|XP_007010857.1|  Staurosporin and temperature sensitive 3-like b    214   2e-60   Theobroma cacao [chocolate]
ref|XP_012079356.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    214   3e-60   Jatropha curcas
ref|XP_002891078.1|  hypothetical protein ARALYDRAFT_891007             214   3e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_007152548.1|  hypothetical protein PHAVU_004G139400g             214   3e-60   Phaseolus vulgaris [French bean]
ref|NP_174675.2|  dolichyl-diphosphooligosaccharide--protein glyc...    214   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010037022.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    214   5e-60   Eucalyptus grandis [rose gum]
ref|XP_010037023.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    213   6e-60   Eucalyptus grandis [rose gum]
gb|KFK45118.1|  hypothetical protein AALP_AA1G346600                    213   6e-60   Arabis alpina [alpine rockcress]
emb|CDY15314.1|  BnaC06g08000D                                          213   7e-60   Brassica napus [oilseed rape]
emb|CDX93729.1|  BnaA09g23290D                                          213   7e-60   
ref|XP_010461241.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    212   8e-60   
gb|AGV54454.1|  dolichyl-diphosphooligosaccharide protein glycosy...    213   8e-60   Phaseolus vulgaris [French bean]
ref|XP_010499953.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    213   1e-59   Camelina sativa [gold-of-pleasure]
gb|KJB73162.1|  hypothetical protein B456_011G219600                    213   1e-59   Gossypium raimondii
gb|KHG18443.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    212   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010250082.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    212   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_002979240.1|  oligosaccharyltransferase subunit STT3             212   2e-59   Selaginella moellendorffii
ref|XP_010687248.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    212   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010478833.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    211   7e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009114756.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    210   8e-59   Brassica rapa
ref|XP_004622467.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    197   2e-58   Sorex araneus [Eurasian shrew]
ref|XP_004359158.1|  oligosaccharyl transferase                         208   4e-58   Cavenderia fasciculata
ref|XP_001767963.1|  predicted protein                                  208   6e-58   
ref|XP_011399692.1|  Dolichyl-diphosphooligosaccharide-protein gl...    208   6e-58   Auxenochlorella protothecoides
ref|XP_002955643.1|  hypothetical protein VOLCADRAFT_66117              208   8e-58   Volvox carteri f. nagariensis
gb|KDD76460.1|  STT3 subunit of oligosaccharyl transferase              206   2e-57   Helicosporidium sp. ATCC 50920
gb|EPS67017.1|  hypothetical protein M569_07758                         206   4e-57   Genlisea aurea
emb|CDY28395.1|  BnaA05g18450D                                          200   2e-56   Brassica napus [oilseed rape]
ref|XP_007013064.1|  Staurosporin and temperature sensitive 3-lik...    204   2e-56   
gb|EMT03890.1|  hypothetical protein F775_52478                         205   1e-55   
gb|KIY95689.1|  dolichyl-diphosphooligosaccharide--protein glycos...    197   2e-55   Monoraphidium neglectum
emb|CDW54120.1|  Argonaute 1 isoform B                                  202   9e-55   Trichuris trichiura
gb|KFD61424.1|  hypothetical protein M514_06001                         201   3e-54   Trichuris suis
gb|KFD53087.1|  hypothetical protein M513_06001                         201   3e-54   Trichuris suis
ref|XP_639887.1|  oligosaccharyl transferase, STT3 subunit              197   3e-54   Dictyostelium discoideum AX4
ref|XP_002956920.1|  hypothetical protein VOLCADRAFT_83836              197   4e-54   Volvox carteri f. nagariensis
gb|EFA77669.1|  oligosaccharyl transferase                              196   6e-54   Heterostelium album PN500
ref|XP_001690442.1|  oligsaccharyl transferase STT3 subunit             195   2e-53   Chlamydomonas reinhardtii
ref|XP_001439477.1|  hypothetical protein                               194   4e-53   Paramecium tetraurelia strain d4-2
dbj|GAM28549.1|  hypothetical protein SAMD00019534_117250               194   6e-53   Acytostelium subglobosum LB1
ref|XP_008813461.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    193   8e-53   Phoenix dactylifera
ref|XP_001016052.1|  Oligosaccharyl transferase STT3 subunit fami...    192   3e-52   Tetrahymena thermophila SB210
gb|ADB65765.1|  oligosaccharyl transferase                              191   6e-52   Dunaliella salina
ref|XP_003286566.1|  STT3 subunit of oligosaccharyl transferase         191   7e-52   Dictyostelium purpureum
ref|XP_002668944.1|  predicted protein                                  191   8e-52   Naegleria gruberi strain NEG-M
dbj|GAM26838.1|  hypothetical protein SAMD00019534_100130               190   9e-52   Acytostelium subglobosum LB1
dbj|BAM19801.1|  oligosaccharyl transferase                             178   1e-51   Papilio xuthus [Chinese swallowtail]
ref|XP_004353930.1|  integral membrane protein 1 isoform 5, putative    190   2e-51   Acanthamoeba castellanii str. Neff
ref|XP_001897932.1|  ITM1 protein                                       189   3e-51   Brugia malayi [agent of lymphatic filariasis]
emb|CDP94204.1|  Protein Bm9516, isoform b                              189   3e-51   Brugia malayi [agent of lymphatic filariasis]
gb|EJW83386.1|  hypothetical protein WUBG_05703                         189   4e-51   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_003144530.1|  ITM1 protein                                       187   4e-51   
ref|XP_004991063.1|  oligosaccharyl transferase                         188   7e-51   Salpingoeca rosetta
gb|KJB73166.1|  hypothetical protein B456_011G219600                    187   8e-51   Gossypium raimondii
ref|XP_004037041.1|  hypothetical protein IMG5_062800                   187   1e-50   Ichthyophthirius multifiliis
ref|XP_009059058.1|  hypothetical protein LOTGIDRAFT_164315             187   1e-50   Lottia gigantea
ref|XP_002423620.1|  Dolichyl-diphosphooligosaccharide--protein g...    186   1e-50   Pediculus humanus corporis [human body lice]
gb|EJD76555.1|  dolichyl-diphosphooligosaccharide-protein glycosy...    187   1e-50   Loa loa
gb|ERG82441.1|  dolichyl-diphosphooligosaccharide--protein glycos...    186   2e-50   
ref|XP_011177440.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    186   2e-50   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004536915.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    186   3e-50   
ref|XP_011200722.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    186   3e-50   Bactrocera dorsalis [papaya fruit fly]
ref|XP_001175790.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    186   3e-50   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003747558.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    186   4e-50   
ref|XP_667452.1|  oligosaccharyl transferase stt3 protein               186   4e-50   Cryptosporidium hominis TU502
ref|XP_003747556.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    186   5e-50   Galendromus occidentalis
ref|XP_627564.1|  oligosaccharyl transferase STT3 protein               186   5e-50   Cryptosporidium parvum Iowa II
ref|XP_004536913.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    185   5e-50   
ref|XP_003747557.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    185   6e-50   
gb|KFB38788.1|  AGAP000434-PA-like protein                              185   7e-50   Anopheles sinensis
ref|XP_001991867.1|  GH12900                                            185   8e-50   Drosophila grimshawi
ref|XP_005185991.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    185   8e-50   Musca domestica
ref|XP_011201044.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   9e-50   Bactrocera dorsalis [papaya fruit fly]
emb|CDW81938.1|  dolichyl-diphosphooligosaccharide--protein glyco...    187   1e-49   Stylonychia lemnae
gb|EHJ63188.1|  oligosaccharyl transferase                              184   1e-49   
gb|EKC29997.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    184   1e-49   Crassostrea gigas
ref|XP_002071638.1|  GK10089                                            184   1e-49   Drosophila willistoni
ref|XP_009014673.1|  hypothetical protein HELRODRAFT_98643              184   1e-49   Helobdella robusta
ref|XP_001648748.1|  AAEL004228-PA                                      184   1e-49   Aedes aegypti
ref|XP_001865872.1|  oligosaccharyl transferase                         184   1e-49   Culex quinquefasciatus
ref|XP_002055439.1|  GJ18789                                            184   1e-49   Drosophila virilis
ref|XP_002011908.1|  GI14454                                            184   1e-49   Drosophila mojavensis
ref|XP_011434154.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    184   2e-49   Crassostrea gigas
ref|XP_002023018.1|  GL16584                                            184   2e-49   
ref|XP_004923047.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    184   2e-49   Bombyx mori [silk moth]
ref|XP_001695034.1|  predicted protein                                  179   2e-49   Chlamydomonas reinhardtii
ref|XP_002134555.1|  GA22298                                            184   2e-49   Drosophila pseudoobscura pseudoobscura
gb|KFM62989.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    181   3e-49   Stegodyphus mimosarum
gb|EJY69225.1|  Oligosaccharyl transferase STT3 subunit family pr...    184   3e-49   Oxytricha trifallax
ref|XP_002039599.1|  GM22642                                            183   3e-49   Drosophila sechellia
ref|XP_002101953.1|  GE15319                                            183   3e-49   Drosophila yakuba
ref|XP_001978657.1|  GG17558                                            183   3e-49   Drosophila erecta
gb|ETN61504.1|  oligosaccharyl transferase                              183   3e-49   Anopheles darlingi [American malaria mosquito]
gb|AAH15880.1|  STT3B protein                                           174   3e-49   Homo sapiens [man]
ref|XP_002162870.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    182   4e-49   
ref|XP_006376693.1|  hypothetical protein POPTR_0012s033201g            173   4e-49   
gb|ACD81859.1|  LD39332p                                                183   4e-49   Drosophila melanogaster
ref|NP_608425.1|  CG1518, isoform A                                     183   4e-49   Drosophila melanogaster
gb|KDR18262.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    182   5e-49   Zootermopsis nevadensis
ref|XP_310665.3|  AGAP000434-PA                                         182   6e-49   Anopheles gambiae str. PEST
gb|AAH13054.2|  Stt3b protein                                           176   6e-49   
gb|AAI72203.1|  source of immunodominant MHC-associated peptides        173   7e-49   synthetic construct
ref|XP_005108238.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    182   9e-49   Aplysia californica
dbj|GAA49322.1|  dolichyl-diphosphooligosaccharide--protein glyco...    181   1e-48   Clonorchis sinensis [oriental liver fluke]
gb|ELU12621.1|  hypothetical protein CAPTEDRAFT_166596                  181   2e-48   Capitella teleta
ref|XP_011309118.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   2e-48   Fopius arisanus
ref|XP_002140643.1|  oligosaccharyl transferase STT3 subunit fami...    181   2e-48   Cryptosporidium muris RN66
dbj|BAB55370.1|  unnamed protein product                                174   2e-48   Homo sapiens [man]
ref|XP_011309135.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   2e-48   Fopius arisanus
ref|XP_003696801.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    181   2e-48   
ref|XP_009176065.1|  hypothetical protein T265_11205                    180   2e-48   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_008216175.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   2e-48   
ref|XP_006616543.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    181   2e-48   Apis dorsata [rock honeybee]
ref|XP_002114080.1|  conserved hypothetical protein                     181   3e-48   Trichoplax adhaerens
ref|NP_001229365.1|  STT3, subunit of the oligosaccharyltransfera...    181   3e-48   Apis mellifera [bee]
ref|XP_001601373.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   3e-48   Nasonia vitripennis
ref|XP_011638122.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   3e-48   Pogonomyrmex barbatus
ref|XP_008216174.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   3e-48   Nasonia vitripennis
ref|XP_001967075.1|  GF21857                                            180   3e-48   Drosophila ananassae
ref|XP_011860119.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   4e-48   Vollenhovia emeryi
gb|EFX84969.1|  hypothetical protein DAPPUDRAFT_300830                  180   4e-48   Daphnia pulex
gb|EFZ09359.1|  hypothetical protein SINV_08486                         181   4e-48   
ref|XP_011173303.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   4e-48   Solenopsis invicta [imported red fire ant]
ref|XP_011067312.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   4e-48   Acromyrmex echinatior
ref|XP_012055162.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    181   5e-48   Atta cephalotes
ref|XP_011067311.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   5e-48   Acromyrmex echinatior
ref|XP_011067310.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   5e-48   Acromyrmex echinatior
ref|XP_011173302.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   5e-48   Solenopsis invicta [imported red fire ant]
ref|XP_003700582.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   5e-48   Megachile rotundata
ref|XP_011860118.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   6e-48   Vollenhovia emeryi
ref|XP_011173301.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    180   6e-48   
ref|XP_001638406.1|  predicted protein                                  179   6e-48   
ref|XP_008543151.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   6e-48   
ref|XP_011068113.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   8e-48   
ref|XP_008591522.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   8e-48   
ref|XP_012055663.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   8e-48   
ref|XP_011875506.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   8e-48   
gb|ETN69475.1|  hypothetical protein NECAME_15282                       172   8e-48   
ref|XP_002155260.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   9e-48   
ref|XP_011703340.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   9e-48   
ref|XP_010781843.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    174   9e-48   
ref|XP_007887891.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   9e-48   
ref|XP_004447050.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    174   1e-47   
ref|XP_012145182.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_003487818.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011344412.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
gb|KKA65588.1|  hypothetical protein PRIPAC_15984                       173   1e-47   
ref|XP_392786.2|  PREDICTED: dolichyl-diphosphooligosaccharide--p...    179   1e-47   
ref|XP_001601974.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_003691905.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011257570.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011647807.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011343674.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
dbj|BAE35579.1|  unnamed protein product                                179   1e-47   
ref|XP_011647806.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_003705191.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011689836.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011257568.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011343671.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
ref|XP_011343673.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   1e-47   
gb|EFN67572.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    179   1e-47   
ref|XP_008200433.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   2e-47   
ref|XP_003493122.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   2e-47   
ref|XP_011647804.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   2e-47   
ref|XP_007894244.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   2e-47   
ref|XP_011301152.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   2e-47   
emb|CDS28695.1|  oligosaccharyl transferase                             179   2e-47   
ref|XP_011257569.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   2e-47   
ref|XP_009017952.1|  hypothetical protein HELRODRAFT_111950             179   2e-47   
ref|XP_003395697.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   2e-47   
ref|XP_002739605.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   2e-47   
ref|XP_011172616.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   2e-47   
ref|XP_011689835.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    179   2e-47   
ref|XP_011138057.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   2e-47   
gb|ELW47934.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    177   2e-47   
ref|XP_005991224.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   2e-47   
gb|EFN85392.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    178   2e-47   
ref|XP_009963506.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    173   2e-47   
dbj|BAG58686.1|  unnamed protein product                                177   3e-47   
ref|NP_001265433.1|  dolichyl-diphosphooligosaccharide--protein g...    177   3e-47   
gb|AAH03206.1|  Stt3b protein                                           176   3e-47   
ref|XP_011138056.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   3e-47   
ref|XP_005806733.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_011268921.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_003796822.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_006159021.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_006867725.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_005611741.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_004714216.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
ref|XP_007558076.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   3e-47   
gb|ELK09784.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    180   3e-47   
ref|XP_008591523.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   4e-47   
ref|XP_004878252.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   4e-47   
ref|XP_008409311.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   4e-47   
ref|XP_004084644.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   4e-47   
ref|XP_007550502.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    178   4e-47   
ref|XP_005339596.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   5e-47   
ref|XP_007191595.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   5e-47   
ref|XP_008833141.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   5e-47   
ref|XP_006079661.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   5e-47   
ref|XP_002754607.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
gb|AAL77539.1|L47337_1  transmembrane protein                           177   6e-47   
ref|XP_007950292.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
dbj|BAE40746.1|  unnamed protein product                                177   6e-47   
gb|EDL84046.1|  similar to integral membrane protein 1 (predicted)      177   6e-47   
ref|NP_689926.1|  dolichyl-diphosphooligosaccharide--protein glyc...    177   6e-47   
ref|XP_004641444.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_005803529.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_011500973.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_004379409.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_011149388.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
gb|ELW72225.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    179   6e-47   
ref|XP_006892874.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
dbj|BAE35910.1|  unnamed protein product                                177   6e-47   
ref|XP_003399124.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_006867724.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_004604845.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
dbj|BAE30692.1|  unnamed protein product                                177   6e-47   
ref|XP_002924040.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
ref|XP_002708712.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   6e-47   
dbj|BAC26921.1|  unnamed protein product                                177   6e-47   
gb|AAP36824.1|  Homo sapiens integral membrane protein 1                177   6e-47   
ref|XP_004469309.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   7e-47   
gb|ELU11110.1|  hypothetical protein CAPTEDRAFT_179664                  177   7e-47   
gb|AAP78765.1|  Ac1573                                                  176   7e-47   
ref|XP_007520709.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   7e-47   
ref|XP_004673405.1|  PREDICTED: LOW QUALITY PROTEIN: STT3A, subun...    176   7e-47   
ref|NP_032434.3|  dolichyl-diphosphooligosaccharide--protein glyc...    176   7e-47   
ref|XP_010784557.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    174   7e-47   
gb|AAH85313.1|  STT3, subunit of the oligosaccharyltransferase co...    176   7e-47   
ref|XP_007658498.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   7e-47   
ref|XP_011730759.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    176   7e-47   
gb|EFN88856.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    176   7e-47   
ref|XP_007646642.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   7e-47   
ref|XP_011720122.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_004280769.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_010169485.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    172   8e-47   
ref|XP_008069614.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_005870963.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_007520710.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_006796094.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_003472755.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_004689182.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_004417265.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_007607067.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    176   8e-47   
ref|XP_005347095.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   8e-47   
ref|XP_005085908.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_005378712.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_006915269.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_004604846.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_006890689.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_009896625.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_011789990.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_004379410.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_006176159.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
ref|XP_008707875.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   9e-47   
emb|CAG05725.1|  unnamed protein product                                173   9e-47   
ref|XP_006851655.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    177   1e-46   
ref|XP_005695574.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
gb|EPQ10562.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    176   1e-46   
ref|XP_011954703.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_010833860.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_008289975.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
dbj|BAE32233.1|  unnamed protein product                                176   1e-46   
ref|XP_005894229.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_006242870.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_006510101.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_312559.4|  AGAP002396-PA                                         176   1e-46   
ref|XP_008535106.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_007120476.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_006140661.1|  PREDICTED: LOW QUALITY PROTEIN: dolichyl-dip...    176   1e-46   
ref|XP_005877173.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
emb|CCD60218.1|  oligosaccharyl transferase, putative                   176   1e-46   
ref|XP_006905779.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
gb|KFV65671.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   1e-46   
gb|KFM59622.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    176   1e-46   
ref|XP_008535108.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_006936547.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_004417266.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|NP_001039445.1|  dolichyl-diphosphooligosaccharide--protein g...    176   1e-46   
ref|XP_004279731.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   1e-46   
gb|ERE76781.1|  dolichyl-diphosphooligosaccharide--protein glycos...    176   1e-46   
ref|XP_005978402.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   1e-46   
ref|XP_005667536.1|  PREDICTED: STT3, subunit of the oligosacchar...    176   2e-46   
ref|XP_007244780.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_007066428.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_008527561.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
gb|AAB05994.1|  putative transmembrane protein precursor                176   2e-46   
ref|XP_005894425.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_003511082.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_010868983.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
gb|ELR57489.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    176   2e-46   
ref|NP_001135197.1|  Dolichyl-diphosphooligosaccharide--protein g...    175   2e-46   
emb|CDQ66412.1|  unnamed protein product                                175   2e-46   
ref|XP_011954701.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
gb|EFB18158.1|  hypothetical protein PANDA_013577                       175   2e-46   
ref|XP_546418.3|  PREDICTED: dolichyl-diphosphooligosaccharide--p...    176   2e-46   
ref|XP_011414451.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_004280767.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_006209915.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_005978403.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
emb|CDQ67856.1|  unnamed protein product                                175   2e-46   
ref|XP_006635679.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_004447048.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    174   2e-46   
ref|XP_011954702.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_007463663.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_005294744.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_003764397.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_004519479.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_003965896.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|NP_001001202.1|  STT3A, subunit of the oligosaccharyltransfer...    175   2e-46   
ref|XP_008927650.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_009865986.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_003225760.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_006174391.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_002197814.2|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
gb|KFP04495.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_006021419.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
gb|KFP87141.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_006174392.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_001365210.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|NP_001083986.1|  STT3A, subunit of the oligosaccharyltransfer...    175   2e-46   
ref|XP_008058266.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    174   2e-46   
ref|XP_006116753.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_003459018.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_008287848.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
gb|KFV00546.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
gb|KFW85562.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_008322304.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_006991240.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_008330481.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_003976527.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|NP_958866.1|  dolichyl-diphosphooligosaccharide--protein glyc...    175   2e-46   
ref|XP_010006392.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_005615298.1|  PREDICTED: LOW QUALITY PROTEIN: STT3B, subun...    175   2e-46   
gb|KFR01965.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_007106668.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_005058753.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
gb|KFO81837.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
gb|KFO12039.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_008635110.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_005019699.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
gb|KFG48524.1|  putative oligosaccharyl transferase stt3 protein        171   2e-46   
gb|KFP31835.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_010747757.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_004560127.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
gb|ELK33312.1|  Dolichyl-diphosphooligosaccharide--protein glycos...    175   2e-46   
ref|XP_006970316.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_005075094.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    176   2e-46   
ref|XP_010721863.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   
ref|XP_007427479.1|  PREDICTED: dolichyl-diphosphooligosaccharide...    175   2e-46   



>gb|KJB65008.1| hypothetical protein B456_010G075800 [Gossypium raimondii]
Length=574

 Score =   308 bits (788),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 180/194 (93%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE+AAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  382  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPERAAWEIFHSLDVKYVLVVFGGLVGYPS  441

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  442  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  500

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR+TEIGKK FKLTHFEE FTTHHWMVRIYKLKPPKNRIRGKTKKSKS  SS + 
Sbjct  501  KGFDRVRQTEIGKKYFKLTHFEEAFTTHHWMVRIYKLKPPKNRIRGKTKKSKSKTSSTTS  560

Query  289  r---SGTRKKNPWH  257
                SGT+KKNPW 
Sbjct  561  SPKRSGTKKKNPWQ  574



>gb|AAP49699.1| putative oligosaccharyl transferase STT3 protein [Vitis vinifera]
Length=230

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  64   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  123

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRIDSQATPTMLN LMYKLSY+RFVETD G
Sbjct  124  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDSQATPTMLNCLMYKLSYFRFVETD-G  182

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR  335
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIR
Sbjct  183  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR  227



>ref|XP_008462759.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Cucumis melo]
Length=777

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 182/194 (94%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  585  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  644

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  645  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  703

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktk---ksksvkss  299
            KGFDRVR+TEIGKK FKL+HFEEVFTTHHWMVRIYKLKPPKNRIRGKTK   + KS  ++
Sbjct  704  KGFDRVRQTEIGKKYFKLSHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKNQRQYKSSSTT  763

Query  298  nskrSGTRKKNPWH  257
            + KR GT+K+NPWH
Sbjct  764  SLKRKGTKKRNPWH  777



>ref|XP_006451262.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 ref|XP_006494313.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Citrus sinensis]
 gb|ESR64502.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|KDO66516.1| hypothetical protein CISIN_1g003973mg [Citrus sinensis]
Length=782

 Score =   310 bits (795),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 178/192 (93%), Positives = 182/192 (95%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  592  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  651

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  652  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  710

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkss-ns  293
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KKSKS  S+ +S
Sbjct  711  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPSKNRIRGKMKKSKSRTSTPSS  770

Query  292  krSGTRKKNPWH  257
            KRSG+RKKNPW 
Sbjct  771  KRSGSRKKNPWQ  782



>dbj|BAJ92657.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  83   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPS  142

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  143  DDINKFLWMVRIGGGEFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  201

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KK KS   ++S 
Sbjct  202  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRGKLKKLKSSAKTSST  261

Query  289  rSGTRKKNPWH  257
             +  RKKNPW 
Sbjct  262  LAAGRKKNPWQ  272



>ref|XP_009775565.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nicotiana sylvestris]
Length=772

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 177/192 (92%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  582  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  641

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLN LMYKLSYYRFVETD G
Sbjct  642  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETD-G  700

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG-ktkksksvkssns  293
            KGFDRVRRTEIGKK FKLTHF+EVFTTHHWMVRIYKLKPPKNRIRG   K      S++S
Sbjct  701  KGFDRVRRTEIGKKHFKLTHFDEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKSKSNSASS  760

Query  292  krSGTRKKNPWH  257
            KRS TRKKNPWH
Sbjct  761  KRSATRKKNPWH  772



>ref|XP_011048330.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X2 [Populus euphratica]
Length=781

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 183/194 (94%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFSSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvks---s  299
            K FDRVR+TEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSK  K+   S
Sbjct  708  KAFDRVRQTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKLQKASSTS  767

Query  298  nskrSGTRKKNPWH  257
            +SKRSGT K+NPWH
Sbjct  768  SSKRSGTGKRNPWH  781



>ref|XP_011048329.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X1 [Populus euphratica]
Length=782

 Score =   309 bits (791),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 179/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFSSLDVKYVLVVFGGLVGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K FDRVR+TEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSK   SS S 
Sbjct  710  KAFDRVRQTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKLKASSTSS  769

Query  289  r--SGTRKKNPWH  257
               SGT K+NPWH
Sbjct  770  SKRSGTGKRNPWH  782



>ref|XP_011655447.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Cucumis sativus]
Length=776

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 179/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  585  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  644

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQAT TMLN LMYKLSYYRFVETD G
Sbjct  645  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATQTMLNCLMYKLSYYRFVETD-G  703

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG--ktkksksvkssn  296
            KGFDRVR+TEIGKK FKL+HFEEVFTTHHWMVRIYKLKPPKNRIRG  K  K+KS  +++
Sbjct  704  KGFDRVRQTEIGKKYFKLSHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKTKSSSTTS  763

Query  295  skrSGTRKKNPWH  257
             K  GT+K+NPWH
Sbjct  764  LKTKGTKKRNPWH  776



>gb|EPS65439.1| hypothetical protein M569_09336, partial [Genlisea aurea]
Length=470

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 172/190 (91%), Gaps = 1/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  282  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFSSLDVKYVLVVFGGLVGYPS  341

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD G
Sbjct  342  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD-G  400

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            +GFDRVR TEIGKK FKLTHFEEVFTTHHWMVRIYKLK P+NRIRGK  K   V    +K
Sbjct  401  RGFDRVRHTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKAPRNRIRGKASKKSKVDDDKAK  460

Query  289  rSGTRKKNPW  260
            +    KKNPW
Sbjct  461  KKKKNKKNPW  470



>gb|KJB65007.1| hypothetical protein B456_010G075800 [Gossypium raimondii]
Length=788

 Score =   308 bits (788),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 180/194 (93%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE+AAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  596  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPERAAWEIFHSLDVKYVLVVFGGLVGYPS  655

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  656  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  714

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR+TEIGKK FKLTHFEE FTTHHWMVRIYKLKPPKNRIRGKTKKSKS  SS + 
Sbjct  715  KGFDRVRQTEIGKKYFKLTHFEEAFTTHHWMVRIYKLKPPKNRIRGKTKKSKSKTSSTTS  774

Query  289  r---SGTRKKNPWH  257
                SGT+KKNPW 
Sbjct  775  SPKRSGTKKKNPWQ  788



>gb|KHG24964.1| Oligosaccharyl transferase subunit STT3 [Gossypium arboreum]
Length=788

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 179/194 (92%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE+AAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  596  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPERAAWEIFHSLDVKYVLVVFGGLVGYPS  655

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  656  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  714

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR+TEIGKK FKLTHFEE FTTHHWMVRIYKLKPPKNRIRGKTKKSKS  SS + 
Sbjct  715  KGFDRVRQTEIGKKYFKLTHFEEAFTTHHWMVRIYKLKPPKNRIRGKTKKSKSKTSSTTS  774

Query  289  rS---GTRKKNPWH  257
                 GT+KKNPW 
Sbjct  775  SPKRGGTKKKNPWQ  788



>ref|XP_002514244.1| oligosaccharyl transferase, putative [Ricinus communis]
 gb|EEF48198.1| oligosaccharyl transferase, putative [Ricinus communis]
Length=779

 Score =   307 bits (786),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 175/192 (91%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KK     S+ S 
Sbjct  708  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRGKAKKKSKTSSTPSS  767

Query  289  rSG-TRKKNPWH  257
            +     K+NPWH
Sbjct  768  KRSRASKRNPWH  779



>gb|EYU30721.1| hypothetical protein MIMGU_mgv1a001650mg [Erythranthe guttata]
Length=778

 Score =   307 bits (786),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 179/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  587  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  646

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRID+QATPTMLNSLMYKLSYYRFVETD G
Sbjct  647  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDAQATPTMLNSLMYKLSYYRFVETD-G  705

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            +GFDRVR TEIGKK FKLTHFEEVFTTHHWMVR+YKLK PKNRIRGKTKKSKS  ++ + 
Sbjct  706  RGFDRVRHTEIGKKHFKLTHFEEVFTTHHWMVRLYKLKSPKNRIRGKTKKSKSKATTTTS  765

Query  289  r--SGTRKKNPWH  257
                G RKKNPWH
Sbjct  766  SKRIGARKKNPWH  778



>ref|XP_009626922.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nicotiana tomentosiformis]
Length=772

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 176/191 (92%), Gaps = 2/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  582  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  641

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLN LMYKLSYYRFVETD G
Sbjct  642  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETD-G  700

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG-ktkksksvkssns  293
            KGFDRVRRTEIGKK FKLTHF+EVFTTHHWMVRIYKLKPPKNRIRG   K      S++S
Sbjct  701  KGFDRVRRTEIGKKHFKLTHFDEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKSKSNSASS  760

Query  292  krSGTRKKNPW  260
            KRS TRKKNPW
Sbjct  761  KRSATRKKNPW  771



>gb|KHG22028.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Gossypium arboreum]
Length=724

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 178/193 (92%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE+AAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  533  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPERAAWEIFHSLDVKYVLVVFGGLIGYPS  592

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  593  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  651

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K +DRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KKSKS  SS S 
Sbjct  652  KAYDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPLKNRIRGKAKKSKSKTSSTSS  711

Query  289  r--SGTRKKNPWH  257
               SGT+KKNPW 
Sbjct  712  SKRSGTKKKNPWQ  724



>ref|XP_010249572.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Nelumbo nucifera]
Length=785

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 179/194 (92%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  652

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRIDSQAT TMLN LMYKLSYYRFVETD G
Sbjct  653  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDSQATSTMLNCLMYKLSYYRFVETD-G  711

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksks---vkss  299
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSK+     S+
Sbjct  712  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKAGSKTSST  771

Query  298  nskrSGTRKKNPWH  257
             S +   R+KNPWH
Sbjct  772  TSSKRAGRRKNPWH  785



>ref|XP_006353484.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Solanum tuberosum]
Length=772

 Score =   306 bits (783),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 181/192 (94%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  582  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  641

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLNSLMYKLSYYRFVETD G
Sbjct  642  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNSLMYKLSYYRFVETD-G  700

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFTTHHWMVR+YKLKPPKNRIRGKTKKSKS  +S S 
Sbjct  701  KGYDRVRRTEIGKKHFKLTHFEEVFTTHHWMVRLYKLKPPKNRIRGKTKKSKSKATSTSS  760

Query  289  r-SGTRKKNPWH  257
            + S T+KKNPW 
Sbjct  761  KRSATQKKNPWQ  772



>ref|XP_011078262.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Sesamum indicum]
Length=774

 Score =   306 bits (783),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 179/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  583  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  642

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  643  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  701

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG--ktkksksvkssn  296
            +GFDRVR TEIGKK FKLTHFEEVFTTHHWMVRIYKLK P+NR+RG  K  KSKS  +S 
Sbjct  702  RGFDRVRHTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKSPRNRVRGKTKKSKSKSTSTSI  761

Query  295  skrSGTRKKNPWH  257
            S+RSG RKKNPWH
Sbjct  762  SRRSGARKKNPWH  774



>emb|CDP03275.1| unnamed protein product [Coffea canephora]
Length=796

 Score =   306 bits (784),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 178/193 (92%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  605  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  664

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  665  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  723

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLK P+NRIRGKTKKSKS  SS   
Sbjct  724  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKSPRNRIRGKTKKSKSKSSSTIS  783

Query  289  rSG--TRKKNPWH  257
                 TRKKNPW+
Sbjct  784  SKSSRTRKKNPWN  796



>ref|XP_002280521.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Vitis vinifera]
 emb|CBI28016.3| unnamed protein product [Vitis vinifera]
Length=778

 Score =   305 bits (782),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 180/193 (93%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  587  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  646

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRIDSQATPTMLN LMYKLSY+RFVETD G
Sbjct  647  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDSQATPTMLNCLMYKLSYFRFVETD-G  705

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR--Gktkksksvkssn  296
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIR   K  KSK+  +++
Sbjct  706  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRVKTKKSKSKASSTTS  765

Query  295  skrSGTRKKNPWH  257
            SKRSG RKKNPW 
Sbjct  766  SKRSGKRKKNPWQ  778



>ref|XP_008462758.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A isoform X1 [Cucumis melo]
Length=763

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  585  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  644

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  645  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  703

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVR+TEIGKK FKL+HFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  704  KGFDRVRQTEIGKKYFKLSHFEEVFTTHHWMVRIYKLKPPKNRIRG  749



>ref|XP_012076776.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Jatropha curcas]
 gb|KDP33728.1| hypothetical protein JCGZ_07299 [Jatropha curcas]
Length=776

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 173/191 (91%), Positives = 177/191 (93%), Gaps = 4/191 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  590  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  649

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRID+QATPTMLN LMYKLSYYRFVETD G
Sbjct  650  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDNQATPTMLNCLMYKLSYYRFVETD-G  708

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIR    K+K  KS  S 
Sbjct  709  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR---GKTKKSKSKGSS  765

Query  289  rSGTRKKNPWH  257
            RSGT K+NPWH
Sbjct  766  RSGTNKRNPWH  776



>gb|KJB83104.1| hypothetical protein B456_013G229700 [Gossypium raimondii]
Length=793

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 178/192 (93%), Gaps = 3/192 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE+AAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  602  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPERAAWEIFHSLDVKYVLVVFGGLIGYPS  661

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  662  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  720

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K +DRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KKSKS  SS S 
Sbjct  721  KAYDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPLKNRIRGKAKKSKSKTSSTSS  780

Query  289  r--SGTRKKNPW  260
               SGT+KKNPW
Sbjct  781  SKRSGTKKKNPW  792



>ref|XP_008242518.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Prunus mume]
Length=778

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  587  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  646

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFV+TD G
Sbjct  647  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVDTD-G  705

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPP+NRIRG
Sbjct  706  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPRNRIRG  751



>ref|XP_002325019.2| hypothetical protein POPTR_0018s09300g [Populus trichocarpa]
 gb|EEF03584.2| hypothetical protein POPTR_0018s09300g [Populus trichocarpa]
Length=780

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 177/193 (92%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K FDRVR+TEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSK   SS S 
Sbjct  708  KAFDRVRQTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKLKASSTSS  767

Query  289  rSGTR--KKNPWH  257
               +   K+NPWH
Sbjct  768  SKRSAAGKRNPWH  780



>ref|XP_008810656.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Phoenix dactylifera]
Length=787

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 162/166 (98%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  595  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPS  654

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRID+QATPTMLN LMYKLSYYRFVETD G
Sbjct  655  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDAQATPTMLNCLMYKLSYYRFVETD-G  713

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  714  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  759



>ref|XP_003516821.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Glycine max]
Length=778

 Score =   304 bits (778),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            K FDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  708  KAFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  753



>emb|CDY71196.1| BnaCnng71800D [Brassica napus]
Length=378

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 170/190 (89%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  190  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  249

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDG YRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  250  DDINKFLWMVRIGGGVFPHIKEADYLRDGNYRIDSEATPTMLNCLMYKLSYYRFVETD-G  308

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG+ KK K   SS   
Sbjct  309  KGYDRVRRTEIGKKNFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRGRAKKLKLKTSSGLD  368

Query  289  rSGTRKKNPW  260
                 KKNPW
Sbjct  369  SKPA-KKNPW  377



>ref|XP_007203242.1| hypothetical protein PRUPE_ppa001464mg [Prunus persica]
 gb|EMJ04441.1| hypothetical protein PRUPE_ppa001464mg [Prunus persica]
Length=821

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  630  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  689

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFV+TD G
Sbjct  690  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVDTD-G  748

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPP+NRIRG
Sbjct  749  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPRNRIRG  794



>ref|XP_004497228.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Cicer arietinum]
Length=773

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  584  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  643

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLN LMYKLSYYRFVETD G
Sbjct  644  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETD-G  702

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            K FDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  703  KAFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  748



>ref|XP_007013062.1| Staurosporin and temperature sensitive 3-like A isoform 1 [Theobroma 
cacao]
 gb|EOY30681.1| Staurosporin and temperature sensitive 3-like A isoform 1 [Theobroma 
cacao]
Length=819

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKY+LVVFGGLVGYPS
Sbjct  596  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYILVVFGGLVGYPS  655

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  656  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  714

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRG
Sbjct  715  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRG  760



>ref|XP_007013063.1| Staurosporin and temperature sensitive 3-like A isoform 2 [Theobroma 
cacao]
 gb|EOY30682.1| Staurosporin and temperature sensitive 3-like A isoform 2 [Theobroma 
cacao]
Length=787

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 181/193 (94%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKY+LVVFGGLVGYPS
Sbjct  596  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYILVVFGGLVGYPS  655

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  656  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  714

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI--RGktkksksvkssn  296
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRI  + K  KSK+  +S+
Sbjct  715  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRGKTKKSKSKTSSTSS  774

Query  295  skrSGTRKKNPWH  257
            SKRSGTRKKNPWH
Sbjct  775  SKRSGTRKKNPWH  787



>ref|XP_010924651.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Elaeis guineensis]
Length=788

 Score =   303 bits (777),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 176/194 (91%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  596  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  655

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRID+QATPTMLN LMYKLSYYRFVETD G
Sbjct  656  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDAQATPTMLNCLMYKLSYYRFVETD-G  714

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K FDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGK KK KS   S+S 
Sbjct  715  KAFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKLKKPKSSSKSSSS  774

Query  289  r---SGTRKKNPWH  257
                +G  +KNPW 
Sbjct  775  NHKRAGNTQKNPWQ  788



>ref|XP_006853616.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Amborella trichopoda]
 gb|ERN15083.1| hypothetical protein AMTR_s00056p00052520 [Amborella trichopoda]
Length=774

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 175/193 (91%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  583  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKPAWEIFNSLDVKYVLVVFGGLVGYPS  642

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMY+LSYYRFVETD G
Sbjct  643  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYRLSYYRFVETD-G  701

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG--ktkksksvkssn  296
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  K  KS S  S +
Sbjct  702  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKSSSKSSKS  761

Query  295  skrSGTRKKNPWH  257
            S    T ++NPWH
Sbjct  762  SSIKSTTRRNPWH  774



>ref|XP_004251627.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Solanum lycopersicum]
Length=772

 Score =   303 bits (775),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 177/192 (92%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  582  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  641

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLNSLMYKLSYYRFVETD G
Sbjct  642  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNSLMYKLSYYRFVETD-G  700

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG-ktkksksvkssns  293
            KG+DRVRRTEIGKK FKLTHFEEVFTTHHWMVR+YKLKPPKNRIRG   K      SS+S
Sbjct  701  KGYDRVRRTEIGKKHFKLTHFEEVFTTHHWMVRLYKLKPPKNRIRGKTKKSKSKATSSSS  760

Query  292  krSGTRKKNPWH  257
            +RS T+KKNPW 
Sbjct  761  RRSATQKKNPWQ  772



>ref|XP_009352534.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Pyrus x bretschneideri]
Length=779

 Score =   302 bits (774),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 4/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRID+QATPTMLNSLMYKL YYRFV+TD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDNQATPTMLNSLMYKLCYYRFVDTD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG--ktkksksvkssn  296
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVR+YKLKPPKNRIRG  K  K+KS  +S+
Sbjct  708  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRLYKLKPPKNRIRGKTKKSKAKSSSTSS  767

Query  295  skrSGTRKKNPWH  257
            +K+SGT K+NPWH
Sbjct  768  AKKSGT-KRNPWH  779



>ref|XP_004961472.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Setaria italica]
Length=784

 Score =   302 bits (774),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  595  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  654

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  655  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  713

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK KS   ++S 
Sbjct  714  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKSNAKTSST  773

Query  289  rSGTRKKNPWH  257
                RKKNPW 
Sbjct  774  LVAGRKKNPWQ  784



>ref|XP_010047698.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Eucalyptus grandis]
 gb|KCW79655.1| hypothetical protein EUGRSUZ_C01008 [Eucalyptus grandis]
Length=786

 Score =   302 bits (774),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 177/193 (92%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  595  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  654

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFV+TD G
Sbjct  655  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVDTD-G  713

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K FDRVRRTEIGKK FKLTHFEEVFTTHHWMVR+YKLKPPKNR+RGKTKK KS  SS S 
Sbjct  714  KAFDRVRRTEIGKKHFKLTHFEEVFTTHHWMVRLYKLKPPKNRLRGKTKKLKSKTSSASN  773

Query  289  r--SGTRKKNPWH  257
               SG R KNPW 
Sbjct  774  SKRSGKRTKNPWQ  786



>gb|KHN16965.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Glycine soja]
Length=778

 Score =   302 bits (773),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLNSLMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNSLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            K FDRVR+TEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  708  KAFDRVRQTEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  753



>ref|XP_003547741.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Glycine max]
Length=778

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 161/166 (97%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLNSLMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNSLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            K FDRVR+TEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  708  KAFDRVRQTEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  753



>ref|XP_007152904.1| hypothetical protein PHAVU_004G170000g [Phaseolus vulgaris]
 gb|ESW24898.1| hypothetical protein PHAVU_004G170000g [Phaseolus vulgaris]
Length=774

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IFQSLDVKYVLVVFGGLVGYPS
Sbjct  585  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFQSLDVKYVLVVFGGLVGYPS  644

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDS ATPTMLN LMYKLSYYRFVETD G
Sbjct  645  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETD-G  703

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            K FDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLK PKNRIRG
Sbjct  704  KAFDRVRRTEIGKKHFKLTHFEEVFTTHHWMVRIYKLKSPKNRIRG  749



>ref|XP_010095369.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Morus notabilis]
 gb|EXB59788.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Morus notabilis]
Length=779

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 178/192 (93%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYL+DGQYRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEPDYLKDGQYRIDSEATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K FDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKS  S  + 
Sbjct  708  KAFDRVRRTEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKSKSSGTTT  767

Query  289  rSG-TRKKNPWH  257
            +   + KKNPWH
Sbjct  768  KRSRSGKKNPWH  779



>ref|XP_009410892.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Musa acuminata subsp. malaccensis]
Length=782

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 177/194 (91%), Gaps = 4/194 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  590  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKPAWEIFNSLDVKYVLVVFGGLVGYPS  649

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRID+QATPTMLN LMYKLSYYRFVETD G
Sbjct  650  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDAQATPTMLNCLMYKLSYYRFVETD-G  708

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGK+KKSKS   ++  
Sbjct  709  KGFDRVRRTEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGKSKKSKSNSKTSPS  768

Query  289  rS---GTRKKNPWH  257
             S   G  +KNPW 
Sbjct  769  NSKRHGNLRKNPWQ  782



>ref|XP_002441399.1| hypothetical protein SORBIDRAFT_09g025920 [Sorghum bicolor]
 gb|EES19829.1| hypothetical protein SORBIDRAFT_09g025920 [Sorghum bicolor]
Length=782

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  652

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  653  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  711

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK K+   ++S 
Sbjct  712  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKASAKTSST  771

Query  289  rSGTRKKNPWH  257
             +  +KKNPW 
Sbjct  772  LAAGQKKNPWQ  782



>ref|XP_003592715.1| Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A [Medicago truncatula]
 gb|AES62966.1| oligosaccharyltransferase subunit STT3 [Medicago truncatula]
Length=773

 Score =   300 bits (769),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  584  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  643

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRID+ ATPTMLN LMYKLSYYRFVETD G
Sbjct  644  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDNMATPTMLNCLMYKLSYYRFVETD-G  702

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            K +DRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  703  KAYDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  748



>ref|NP_568380.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Arabidopsis thaliana]
 sp|Q93ZY3.1|STT3A_ARATH RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A; Short=Oligosaccharyl transferase 
subunit STT3A; Short=STT3-A; AltName: Full=Integral membrane 
protein 1; AltName: Full=Protein STAUROSPORIN AND TEMPERATURE 
SENSITIVE 3-LIKE A [Arabidopsis thaliana]
 gb|AAL07040.1| putative oligosaccharyl transferase STT3 [Arabidopsis thaliana]
 gb|AED92738.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Arabidopsis thaliana]
 gb|AHL38618.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=779

 Score =   300 bits (768),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 175/190 (92%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLNSLMYKLSYYRFVETD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNSLMYKLSYYRFVETD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVR+YKLKPP+NRIRGK KK KS  SS   
Sbjct  710  KGYDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRLYKLKPPRNRIRGKAKKLKSKTSSGLS  769

Query  289  rSGTRKKNPW  260
               + KKNPW
Sbjct  770  SK-SAKKNPW  778



>ref|XP_010420783.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Camelina sativa]
Length=778

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP +NRIRG+ KK KS  +S+  
Sbjct  708  KGYDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRIYKLKPARNRIRGRAKKLKSKTTSSGW  767

Query  289  rSGTRKKNPW  260
             S + KKNPW
Sbjct  768  SSKSEKKNPW  777



>ref|XP_004287460.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Fragaria vesca subsp. vesca]
Length=777

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  587  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  646

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRID+QATPTMLN LMYKLSYYRFV+TD G
Sbjct  647  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDNQATPTMLNCLMYKLSYYRFVDTD-G  705

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR  335
            KGFDRVRRTEIGKK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIR
Sbjct  706  KGFDRVRRTEIGKKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR  750



>dbj|BAJ94938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=788

 Score =   300 bits (768),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  599  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPS  658

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  659  DDINKFLWMVRIGGGEFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  717

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KK KS   ++S 
Sbjct  718  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRGKLKKLKSSAKTSST  777

Query  289  rSGTRKKNPWH  257
             +  RKKNPW 
Sbjct  778  LAAGRKKNPWQ  788



>ref|XP_003568077.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Brachypodium distachyon]
Length=793

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  604  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPS  663

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKEPDYLRDGQYR+DSQATPTMLN LMYKL YYRFVETD G
Sbjct  664  DDINKFLWMVRIGGGEFPHIKEPDYLRDGQYRVDSQATPTMLNCLMYKLCYYRFVETD-G  722

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KK KS   ++S 
Sbjct  723  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRGKLKKLKSSSKTSST  782

Query  289  rSGTRKKNPWH  257
             +  RKKNPW 
Sbjct  783  LAAGRKKNPWQ  793



>ref|XP_010493048.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Camelina sativa]
Length=778

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            K +DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG+ KK KS  +S+  
Sbjct  708  KAYDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRIYKLKPAKNRIRGRAKKLKSKTTSSGW  767

Query  289  rSGTRKKNPW  260
             S + KKNPW
Sbjct  768  SSKSAKKNPW  777



>gb|EMT28410.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Aegilops tauschii]
Length=1002

 Score =   303 bits (776),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 166/191 (87%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
             QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  813   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPS  872

Query  649   DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
             DDINKFLWMVRIGGG FPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  873   DDINKFLWMVRIGGGEFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  931

Query  469   KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
             KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRGK KK KS   ++S 
Sbjct  932   KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRGKLKKLKSSSKTSST  991

Query  289   rSGTRKKNPWH  257
              +  RKKNPW 
Sbjct  992   LAAGRKKNPWQ  1002



>ref|XP_010519673.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Tarenaya hassleriana]
Length=780

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRIDS+ATPTMLN LMYKL YYRFVETD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDSEATPTMLNCLMYKLCYYRFVETD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRRTEIGKK FKLTHFEE FT+HHWMVRIYKLKP KNRIRGK KKSKS  SS + 
Sbjct  710  KGFDRVRRTEIGKKYFKLTHFEEAFTSHHWMVRIYKLKPAKNRIRGKAKKSKSKTSSGTS  769

Query  289  rSGTRKKNPWH  257
               + KKNPW+
Sbjct  770  SMRSTKKNPWN  780



>ref|NP_001136963.1| hypothetical protein [Zea mays]
 gb|ACF82977.1| unknown [Zea mays]
Length=185

 Score =   280 bits (717),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 167/187 (89%), Gaps = 2/187 (1%)
 Frame = -3

Query  817  MANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPSDDIN  638
            MANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPSDDIN
Sbjct  1    MANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPSDDIN  60

Query  637  KFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGGKGFD  458
            KFLWMVRIGGGVFPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD GKGFD
Sbjct  61   KFLWMVRIGGGVFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-GKGFD  119

Query  457  RVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnskrSGT  278
            RVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK K+   ++   +  
Sbjct  120  RVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKASAKTSPTLAAG  179

Query  277  RKKNPWH  257
            R KNPW 
Sbjct  180  R-KNPWQ  185



>ref|XP_010454253.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Camelina sativa]
Length=778

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  589  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  648

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRI+S+ATPTMLN LMYKLSYYRFVETD G
Sbjct  649  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRINSEATPTMLNCLMYKLSYYRFVETD-G  707

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP +NRIRG+ KK KS  +S   
Sbjct  708  KGYDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRIYKLKPARNRIRGRAKKLKSKTTSAGW  767

Query  289  rSGTRKKNPW  260
             S + KKNPW
Sbjct  768  SSKSEKKNPW  777



>gb|AAK91413.1| AT5g19690/T29J13_110 [Arabidopsis thaliana]
 gb|AAL31142.1| AT5g19690/T29J13_110 [Arabidopsis thaliana]
Length=779

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 174/190 (92%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLNSLMYKLSYYRFVETD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNSLMYKLSYYRFVETD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVF +HHWMVR+YKLKPP+NRIRGK KK KS  SS   
Sbjct  710  KGYDRVRRTEIGKKHFKLTHFEEVFKSHHWMVRLYKLKPPRNRIRGKAKKLKSKTSSGLS  769

Query  289  rSGTRKKNPW  260
               + KKNPW
Sbjct  770  SK-SAKKNPW  778



>ref|XP_008387183.1| PREDICTED: LOW QUALITY PROTEIN: dolichyl-diphosphooligosaccharide--protein 
glycosyltransferase subunit STT3A [Malus domestica]
Length=777

 Score =   297 bits (761),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 177/192 (92%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  587  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKXAWEIFNSLDVKYVLVVFGGLVGYPS  646

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRID+QATPTMLN LMYKLSYYRFV+TD G
Sbjct  647  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDNQATPTMLNCLMYKLSYYRFVDTD-G  705

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR+TEIGKK FKLTHFEEVFTTHHWMVR+YKLKPPKNRIRGKTKKSKS  SS S 
Sbjct  706  KGFDRVRQTEIGKKHFKLTHFEEVFTTHHWMVRLYKLKPPKNRIRGKTKKSKSKSSSTSS  765

Query  289  rS-GTRKKNPWH  257
                  K+NPWH
Sbjct  766  TKRXGXKRNPWH  777



>ref|XP_006287100.1| hypothetical protein CARUB_v10000271mg [Capsella rubella]
 gb|EOA19998.1| hypothetical protein CARUB_v10000271mg [Capsella rubella]
Length=776

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 173/190 (91%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  588  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  647

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  648  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLSYYRFVETD-G  706

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP +NRIRGK KK KS  SS   
Sbjct  707  KGYDRVRRTEIGKKNFKLTHFEEVFTSHHWMVRIYKLKPARNRIRGKAKKLKSKTSSGWS  766

Query  289  rSGTRKKNPW  260
               + KKNPW
Sbjct  767  SK-SAKKNPW  775



>gb|KFK26187.1| hypothetical protein AALP_AA8G213900 [Arabis alpina]
Length=780

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 161/166 (97%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  592  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  651

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLNSLMYKLSYYRFVETD G
Sbjct  652  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNSLMYKLSYYRFVETD-G  710

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVRRTEIGKK FKLTHFEEVFT+HHWMVR+YKLKP KNRIRG
Sbjct  711  KGFDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRLYKLKPQKNRIRG  756



>ref|XP_008647462.1| PREDICTED: uncharacterized protein LOC100217123 isoform X1 [Zea 
mays]
 gb|AFW78839.1| hypothetical protein ZEAMMB73_319539 [Zea mays]
Length=781

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  652

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  653  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  711

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK K+   ++  
Sbjct  712  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKASAKTSPT  771

Query  289  rSGTRKKNPWH  257
             +  R KNPW 
Sbjct  772  LAAGR-KNPWQ  781



>ref|XP_010688294.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Beta vulgaris subsp. vulgaris]
Length=781

 Score =   295 bits (755),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+I+ SLDVKYVLVVFGGLVGYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKTAWEIYNSLDVKYVLVVFGGLVGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KG+DRVRRTEIGKK FKLTHFEE FT+HHWMVRIYKLKP KNRIRG
Sbjct  710  KGYDRVRRTEIGKKHFKLTHFEEAFTSHHWMVRIYKLKPQKNRIRG  755



>ref|XP_006654660.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Oryza brachyantha]
Length=787

 Score =   295 bits (755),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  598  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  657

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDG YR+D+Q TPTMLN LMYKL YYRFVETD G
Sbjct  658  DDINKFLWMVRIGGGVFPHIKEPDYLRDGNYRVDAQGTPTMLNCLMYKLCYYRFVETD-G  716

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK KS   ++S 
Sbjct  717  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKSGSKASST  776

Query  289  rSGTRKKNPWH  257
                RKKNPW 
Sbjct  777  NVAGRKKNPWQ  787



>ref|XP_010254009.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Nelumbo nucifera]
Length=786

 Score =   295 bits (755),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 173/195 (89%), Gaps = 5/195 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGG VGYPS
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYVLVVFGGFVGYPS  652

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDGQYRIDSQAT TMLN LMYKLSYYRFVETD G
Sbjct  653  DDINKFLWMVRIGGGVFPHIREPDYLRDGQYRIDSQATSTMLNCLMYKLSYYRFVETD-G  711

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIR----Gktkksksvks  302
            KGFDRVR TEIGKK F+L+HFEE FTTHHWMVRIYKLK PKNR+R         SK   +
Sbjct  712  KGFDRVRGTEIGKKYFELSHFEEAFTTHHWMVRIYKLKAPKNRVRGKTKKSKASSKGSTA  771

Query  301  snskrSGTRKKNPWH  257
            ++SKR+G RKKNPWH
Sbjct  772  TSSKRAGRRKKNPWH  786



>gb|EEC79544.1| hypothetical protein OsI_20658 [Oryza sativa Indica Group]
Length=1119

 Score =   300 bits (768),  Expect = 6e-90, Method: Composition-based stats.
 Identities = 164/191 (86%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
             QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  930   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  989

Query  649   DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
             DDINKFLWMVRIGGGVFPHIKEPDYLRDG YR+D+Q TPTMLN LMYKL YYRFVETD G
Sbjct  990   DDINKFLWMVRIGGGVFPHIKEPDYLRDGNYRVDAQGTPTMLNCLMYKLCYYRFVETD-G  1048

Query  469   KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
             KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK KS   ++S 
Sbjct  1049  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKSGSKASST  1108

Query  289   rSGTRKKNPWH  257
              +  RKKNPW 
Sbjct  1109  NAAGRKKNPWQ  1119



>ref|XP_002871900.1| hypothetical protein ARALYDRAFT_488863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48159.1| hypothetical protein ARALYDRAFT_488863 [Arabidopsis lyrata subsp. 
lyrata]
Length=779

 Score =   295 bits (754),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 173/190 (91%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSS EKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSSEKAAWEIFNSLDVKYVLVVFGGLIGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLN LMYKLSYYRFV+TD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLSYYRFVKTD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKPP+NRIRG+TKK KS  SS   
Sbjct  710  KGYDRVRRTEIGKKNFKLTHFEEVFTSHHWMVRIYKLKPPRNRIRGRTKKLKSKTSSGLS  769

Query  289  rSGTRKKNPW  260
                 KKNPW
Sbjct  770  SKSV-KKNPW  778



>ref|NP_001056068.1| Os05g0519900 [Oryza sativa Japonica Group]
 sp|Q6F2Z1.1|STT3A_ORYSJ RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A; Short=Oligosaccharyl transferase 
subunit STT3A; Short=STT3-A; AltName: Full=Protein STAUROSPORIN 
AND TEMPERATURE SENSITIVE 3-LIKE A [Oryza sativa Japonica 
Group]
 gb|AAT69659.1| putative oligosaccharyl transferase STT3 subunit [Oryza sativa 
Japonica Group]
 gb|AAU44267.1| putative oligosaccharyl transferase STT3 [Oryza sativa Japonica 
Group]
 dbj|BAF17982.1| Os05g0519900 [Oryza sativa Japonica Group]
 dbj|BAG90322.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64392.1| hypothetical protein OsJ_19234 [Oryza sativa Japonica Group]
Length=787

 Score =   295 bits (754),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  598  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  657

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDG YR+D+Q TPTMLN LMYKL YYRFVETD G
Sbjct  658  DDINKFLWMVRIGGGVFPHIKEPDYLRDGNYRVDAQGTPTMLNCLMYKLCYYRFVETD-G  716

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK KS   ++S 
Sbjct  717  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKSGSKASST  776

Query  289  rSGTRKKNPWH  257
             +  RKKNPW 
Sbjct  777  NAAGRKKNPWQ  787



>ref|XP_009120866.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Brassica rapa]
Length=781

 Score =   295 bits (754),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 170/190 (89%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  652

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDG YRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  653  DDINKFLWMVRIGGGVFPHIKEADYLRDGNYRIDSEATPTMLNCLMYKLSYYRFVETD-G  711

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG+ KK K   SS   
Sbjct  712  KGYDRVRRTEIGKKNFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRGRAKKLKLKTSSGLD  771

Query  289  rSGTRKKNPW  260
                 KKNPW
Sbjct  772  SKAA-KKNPW  780



>ref|XP_006400531.1| hypothetical protein EUTSA_v10012742mg [Eutrema salsugineum]
 gb|ESQ41984.1| hypothetical protein EUTSA_v10012742mg [Eutrema salsugineum]
Length=777

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  592  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  651

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  652  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLSYYRFVETD-G  710

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVRRTEIGKK FKLTHF+EVFT+HHWMVRIYKLKP KNRIRG
Sbjct  711  KGFDRVRRTEIGKKNFKLTHFDEVFTSHHWMVRIYKLKPQKNRIRG  756



>emb|CDX92509.1| BnaA10g15480D [Brassica napus]
Length=779

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 170/190 (89%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  591  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  650

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDG YRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  651  DDINKFLWMVRIGGGVFPHIKEADYLRDGNYRIDSEATPTMLNCLMYKLSYYRFVETD-G  709

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG+ KK K   SS   
Sbjct  710  KGYDRVRRTEIGKKNFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRGRAKKLKLKTSSGLD  769

Query  289  rSGTRKKNPW  260
                 KKNPW
Sbjct  770  SKPA-KKNPW  778



>ref|XP_001784427.1| predicted protein [Physcomitrella patens]
 gb|EDQ50779.1| predicted protein, partial [Physcomitrella patens]
Length=448

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVG AMSSPEKAAWDI++SLDVKYV VVFGGLVGYPS
Sbjct  169  QTTAMANRTVIVDNNTWNNTHIATVGMAMSSPEKAAWDIYRSLDVKYVFVVFGGLVGYPS  228

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE-TDG  473
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQAT TMLNSLMYKLSYYRF E T  
Sbjct  229  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATQTMLNSLMYKLSYYRFAEATMD  288

Query  472  GKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            GKG+DRVRRTEIGKK F+LTHFEEVFT+HHWMVRIYKLK  KN++RG
Sbjct  289  GKGYDRVRRTEIGKKQFRLTHFEEVFTSHHWMVRIYKLKEQKNKVRG  335



>emb|CDX88879.1| BnaA03g07700D [Brassica napus]
Length=778

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 169/190 (89%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGG++GYPS
Sbjct  590  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGVIGYPS  649

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKE DYLRDGQYRIDS+ATPTMLN LMYKL YYRFVETD G
Sbjct  650  DDINKFLWMVRIGGGEFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLCYYRFVETD-G  708

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG+ KK K   +S   
Sbjct  709  KGYDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRGRVKKLKQKTTSGVS  768

Query  289  rSGTRKKNPW  260
                 KKNPW
Sbjct  769  SKSV-KKNPW  777



>emb|CDX70886.1| BnaC03g09700D [Brassica napus]
Length=778

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGG++GYPS
Sbjct  590  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGVIGYPS  649

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKE DYLRDGQYRIDS+ATPTMLN LMYKL YYRFVETD G
Sbjct  650  DDINKFLWMVRIGGGEFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLCYYRFVETD-G  708

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG
Sbjct  709  KGYDRVRRTEIGKKYFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRG  754



>gb|ACN31857.1| unknown [Zea mays]
 gb|ACN33744.1| unknown [Zea mays]
 tpg|DAA57616.1| TPA: hypothetical protein ZEAMMB73_748744 [Zea mays]
Length=399

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAM+SPEK AW+IF SLDVKYVLV+FGGL+GYPS
Sbjct  211  QTTAMANRTVIVDNNTWNNTHIATVGTAMASPEKVAWEIFNSLDVKYVLVIFGGLIGYPS  270

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFP IKE DYL+DG YR+D+ +TPTMLNSLMYKL YYRFVETD G
Sbjct  271  DDINKFLWMVRIGGGVFPQIKEADYLKDGNYRVDAHSTPTMLNSLMYKLCYYRFVETD-G  329

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRR EIGKK FKLTHFEEVFTTHHW+VRIYKLKP KNR+RGK K   S+K+S  +
Sbjct  330  KGFDRVRRYEIGKKHFKLTHFEEVFTTHHWLVRIYKLKPQKNRVRGKLKFKSSLKASFMR  389

Query  289  rSGTRKKNPW  260
            ++G  KK+PW
Sbjct  390  KTGG-KKSPW  398



>ref|XP_009131748.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Brassica rapa]
Length=778

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGG++GYPS
Sbjct  590  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGVIGYPS  649

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKE DYLRDGQYRIDS+ATPTMLN LMYKL YYRFVETD G
Sbjct  650  DDINKFLWMVRIGGGEFPHIKEADYLRDGQYRIDSEATPTMLNCLMYKLCYYRFVETD-G  708

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRG
Sbjct  709  KGYDRVRRTEIGKKHFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRG  754



>ref|XP_010535959.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Tarenaya hassleriana]
Length=781

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDV YVLVVFGGL+GY S
Sbjct  592  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVNYVLVVFGGLIGYSS  651

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+E DYLRDG YRIDS+ATPTMLN LMYKLSYYRFVETD G
Sbjct  652  DDINKFLWMVRIGGGVFPHIRESDYLRDGNYRIDSEATPTMLNCLMYKLSYYRFVETD-G  710

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR+TEIGKK FKLTHFEE FT+HHWMVRIYKLKPPKNRIRGKTKKSKS KSS + 
Sbjct  711  KGFDRVRQTEIGKKHFKLTHFEEAFTSHHWMVRIYKLKPPKNRIRGKTKKSKSKKSSGTS  770

Query  289  rSGTRKKNPW  260
               + KKNPW
Sbjct  771  SKRSTKKNPW  780



>gb|EMS67963.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Triticum urartu]
Length=950

 Score =   291 bits (744),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 157/166 (95%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  714  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPS  773

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  774  DDINKFLWMVRIGGGEFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  832

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNRIRG
Sbjct  833  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRIRG  878



>ref|XP_001784419.1| predicted protein [Physcomitrella patens]
 gb|EDQ50771.1| predicted protein [Physcomitrella patens]
Length=784

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVG AMSSPEKAAWDI++SLDVKYV VVFGGLVGYPS
Sbjct  590  QTTAMANRTVIVDNNTWNNTHIATVGMAMSSPEKAAWDIYRSLDVKYVFVVFGGLVGYPS  649

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE-TDG  473
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQAT TMLNSLMYKLSYYRF E T  
Sbjct  650  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATQTMLNSLMYKLSYYRFAEATMD  709

Query  472  GKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            GKG+DRVRRTEIGKK F+LTHFEEVFT+HHWMVRIYKLK  KN++RG
Sbjct  710  GKGYDRVRRTEIGKKQFRLTHFEEVFTSHHWMVRIYKLKEQKNKVRG  756



>gb|EMS46014.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Triticum urartu]
Length=873

 Score =   287 bits (734),  Expect = 2e-86, Method: Composition-based stats.
 Identities = 156/191 (82%), Positives = 164/191 (86%), Gaps = 2/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  683  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKGAWEIFNSLDVKYVLVVFGGLIGYPS  742

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKE DYLRDG YR+D+Q TPTMLN LMYKLSYYRF ETD G
Sbjct  743  DDINKFLWMVRIGGGEFPHIKEQDYLRDGNYRVDAQGTPTMLNCLMYKLSYYRFAETD-G  801

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG-ktkksksvkssns  293
            KGFDR RR EIG+K FKLTHFEEVFTT HWMVRIYKLKP KNR+RG    K KS   ++ 
Sbjct  802  KGFDRARRYEIGRKHFKLTHFEEVFTTQHWMVRIYKLKPQKNRVRGKLKLKLKSSSKTSL  861

Query  292  krSGTRKKNPW  260
             R G  KKNPW
Sbjct  862  MRKGAGKKNPW  872



>ref|XP_003569794.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Brachypodium distachyon]
Length=788

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  600  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLIGYPS  659

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYL+DG YR+D+Q TPTMLN LMYKL YYRFVETD G
Sbjct  660  DDINKFLWMVRIGGGVFPHIKEQDYLKDGNYRVDAQGTPTMLNCLMYKLCYYRFVETD-G  718

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDR RR EIG+K FKLTHFEE FTTHHWMVRIYKLK  KNR++G  K   S K+S+  
Sbjct  719  KGFDRARRYEIGRKHFKLTHFEEAFTTHHWMVRIYKLKSQKNRVQGVLKLKSSSKTSSMH  778

Query  289  rSGTRKKNPWH  257
            + G RKKNPW 
Sbjct  779  KGG-RKKNPWQ  788



>ref|XP_002983693.1| oligosaccharyltransferase subunit STT3 [Selaginella moellendorffii]
 gb|EFJ15189.1| oligosaccharyltransferase subunit STT3 [Selaginella moellendorffii]
Length=759

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPE+ AW+IFQSLDVKYV V+FGGLVGYPS
Sbjct  587  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPERQAWEIFQSLDVKYVFVIFGGLVGYPS  646

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHI+EPDYLRDG YRIDSQATPTMLN LMYKLSYYRF E D G
Sbjct  647  DDINKFLWMVRIGGGVFPHIREPDYLRDGHYRIDSQATPTMLNCLMYKLSYYRFAEAD-G  705

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KG+DRVRRTEIGKK FKL +FEEVFTT HWMVRIYKLKPP+N +  
Sbjct  706  KGYDRVRRTEIGKKYFKLNYFEEVFTTQHWMVRIYKLKPPRNLVSA  751



>ref|XP_002456347.1| hypothetical protein SORBIDRAFT_03g034385 [Sorghum bicolor]
 gb|EES01467.1| hypothetical protein SORBIDRAFT_03g034385, partial [Sorghum bicolor]
Length=705

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAM+SPEKAAW+IF SLDVKYVLV+FGGL+GYPS
Sbjct  517  QTTAMANRTVIVDNNTWNNTHIATVGTAMASPEKAAWEIFNSLDVKYVLVIFGGLIGYPS  576

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFP IKE DYL+DG YR+D+  TPTMLNSLMYKL YYRFVETD G
Sbjct  577  DDINKFLWMVRIGGGVFPQIKEADYLKDGNYRVDAHGTPTMLNSLMYKLCYYRFVETD-G  635

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRR EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK K   S K+S+ +
Sbjct  636  KGYDRVRRYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKFKSSSKTSSMR  695

Query  289  rSGTRKKNPWH  257
            ++G  KK+PW 
Sbjct  696  KTG-GKKSPWQ  705



>gb|KHN40395.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Glycine soja]
Length=761

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 148/154 (96%), Gaps = 1/154 (1%)
 Frame = -3

Query  793  DNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPSDDINKFLWMVRI  614
            DNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPSDDINKFLWMVRI
Sbjct  584  DNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYVLVVFGGLVGYPSDDINKFLWMVRI  643

Query  613  GGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGGKGFDRVRRTEIG  434
            GGGVFPHIKEPDYLRDGQYRIDS ATPTMLN LMYKLSYYRFVETD GK FDRVRRTEIG
Sbjct  644  GGGVFPHIKEPDYLRDGQYRIDSMATPTMLNCLMYKLSYYRFVETD-GKAFDRVRRTEIG  702

Query  433  KKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            KK FKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG
Sbjct  703  KKYFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  736



>ref|XP_004969929.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Setaria italica]
Length=770

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAM+SPEKAAW+I  SLDVKYVLVVFGGL+GYPS
Sbjct  582  QTTAMANRTVIVDNNTWNNTHIATVGTAMASPEKAAWEILNSLDVKYVLVVFGGLIGYPS  641

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDG YR+D+  TPTMLNSLMYKL YYRF +TD G
Sbjct  642  DDINKFLWMVRIGGGVFPHIKEADYLRDGNYRVDAHGTPTMLNSLMYKLCYYRFADTD-G  700

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRR EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK K   S K+S+ +
Sbjct  701  KGFDRVRRYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKLKSSSKTSSMR  760

Query  289  rSGTRKKNPWH  257
            ++G  KK+PW 
Sbjct  761  KTG-GKKSPWQ  770



>emb|CDM84058.1| unnamed protein product [Triticum aestivum]
Length=653

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 160/192 (83%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+IF SLDVKYVLVVFGGL GYPS
Sbjct  463  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKGAWEIFNSLDVKYVLVVFGGLSGYPS  522

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKE DYLRDG YR+D+Q TPTMLN LMYKL YYRF ETD G
Sbjct  523  DDINKFLWMVRIGGGEFPHIKEQDYLRDGNYRVDAQGTPTMLNCLMYKLCYYRFAETD-G  581

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDR R+ EIG+K FKLTHFEEVFTT HWMVRIYKLKP KNR+RGK K      S  S 
Sbjct  582  KGFDRARKYEIGRKHFKLTHFEEVFTTQHWMVRIYKLKPQKNRVRGKLKLKLKYSSKTSL  641

Query  289  r-SGTRKKNPWH  257
               G  KKNPW 
Sbjct  642  MRKGAGKKNPWQ  653



>ref|NP_001146306.1| hypothetical protein [Zea mays]
 gb|ACL53661.1| unknown [Zea mays]
 tpg|DAA57614.1| TPA: hypothetical protein ZEAMMB73_748744 [Zea mays]
Length=718

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAM+SPEK AW+IF SLDVKYVLV+FGGL+GYPS
Sbjct  530  QTTAMANRTVIVDNNTWNNTHIATVGTAMASPEKVAWEIFNSLDVKYVLVIFGGLIGYPS  589

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFP IKE DYL+DG YR+D+ +TPTMLNSLMYKL YYRFVETD G
Sbjct  590  DDINKFLWMVRIGGGVFPQIKEADYLKDGNYRVDAHSTPTMLNSLMYKLCYYRFVETD-G  648

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRR EIGKK FKLTHFEEVFTTHHW+VRIYKLKP KNR+RGK K   S+K+S  +
Sbjct  649  KGFDRVRRYEIGKKHFKLTHFEEVFTTHHWLVRIYKLKPQKNRVRGKLKFKSSLKASFMR  708

Query  289  rSGTRKKNPW  260
            ++G  KK+PW
Sbjct  709  KTG-GKKSPW  717



>ref|XP_008672724.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=770

 Score =   281 bits (719),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAM+SPEK AW+IF SLDVKYVLV+FGGL+GYPS
Sbjct  582  QTTAMANRTVIVDNNTWNNTHIATVGTAMASPEKVAWEIFNSLDVKYVLVIFGGLIGYPS  641

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFP IKE DYL+DG YR+D+ +TPTMLNSLMYKL YYRFVETD G
Sbjct  642  DDINKFLWMVRIGGGVFPQIKEADYLKDGNYRVDAHSTPTMLNSLMYKLCYYRFVETD-G  700

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRR EIGKK FKLTHFEEVFTTHHW+VRIYKLKP KNR+RGK K   S+K+S  +
Sbjct  701  KGFDRVRRYEIGKKHFKLTHFEEVFTTHHWLVRIYKLKPQKNRVRGKLKFKSSLKASFMR  760

Query  289  rSGTRKKNPW  260
            ++G  KK+PW
Sbjct  761  KTG-GKKSPW  769



>ref|XP_008672725.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=750

 Score =   281 bits (718),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 2/190 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAM+SPEK AW+IF SLDVKYVLV+FGGL+GYPS
Sbjct  562  QTTAMANRTVIVDNNTWNNTHIATVGTAMASPEKVAWEIFNSLDVKYVLVIFGGLIGYPS  621

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFP IKE DYL+DG YR+D+ +TPTMLNSLMYKL YYRFVETD G
Sbjct  622  DDINKFLWMVRIGGGVFPQIKEADYLKDGNYRVDAHSTPTMLNSLMYKLCYYRFVETD-G  680

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVRR EIGKK FKLTHFEEVFTTHHW+VRIYKLKP KNR+RGK K   S+K+S  +
Sbjct  681  KGFDRVRRYEIGKKHFKLTHFEEVFTTHHWLVRIYKLKPQKNRVRGKLKFKSSLKASFMR  740

Query  289  rSGTRKKNPW  260
            ++G  KK+PW
Sbjct  741  KTG-GKKSPW  749



>gb|EMT33768.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Aegilops tauschii]
Length=749

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEK AW+IF SLDVKYVLVVFGGL+GYPS
Sbjct  559  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKGAWEIFNSLDVKYVLVVFGGLIGYPS  618

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGG FPHIKE DYLRDG YR+D+Q TPTMLN LMYKL YYRF ETD G
Sbjct  619  DDINKFLWMVRIGGGEFPHIKEQDYLRDGNYRVDAQGTPTMLNCLMYKLCYYRFAETD-G  677

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDR RR EIG+K FKLTHFEEVFTT HWMVRIYKLKP KNR+RGK K      S  S 
Sbjct  678  KGFDRARRYEIGRKHFKLTHFEEVFTTQHWMVRIYKLKPQKNRVRGKLKLKLKSSSKTSL  737

Query  289  r-SGTRKKNPWH  257
               G  KKNPW 
Sbjct  738  MRKGAGKKNPWQ  749



>emb|CDY42286.1| BnaC02g08920D [Brassica napus]
Length=776

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 166/190 (87%), Gaps = 7/190 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGG++GY S
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGVIGYSS  652

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKE DYLRDGQYRIDS+ATPT+LN LM     YRFVETD G
Sbjct  653  DDINKFLWMVRIGGGVFPHIKEADYLRDGQYRIDSEATPTILNCLM-----YRFVETD-G  706

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KG+DRVRRTEIGKK FKLTHFEEVFT+HHWMVRIYKLKP KNRIRGK KK K   S+   
Sbjct  707  KGYDRVRRTEIGKKNFKLTHFEEVFTSHHWMVRIYKLKPQKNRIRGKGKKLKLKTSTGLS  766

Query  289  rSGTRKKNPW  260
               T KKNPW
Sbjct  767  SK-TAKKNPW  775



>ref|XP_010915814.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Elaeis guineensis]
Length=775

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 166/193 (86%), Gaps = 3/193 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHIATVG A+SSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  584  QITAMANRTVIVDNNTWNNTHIATVGAAVSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  643

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDI+KF+WMVRI GGVFPHI+E DYLRDG+Y ID+ ATPTMLN LMYKLSYYRFVET+  
Sbjct  644  DDIDKFIWMVRIAGGVFPHIREQDYLRDGRYHIDAHATPTMLNCLMYKLSYYRFVETE-A  702

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            +GFD+VRRTEIG K F+LTHFEE FTT HWMVRIYKLK PKNRI+GK K   S ++ +S 
Sbjct  703  EGFDKVRRTEIGNKKFELTHFEEAFTTEHWMVRIYKLKLPKNRIQGKLKNKSSSETYSSN  762

Query  289  rSGTR--KKNPWH  257
            ++  R  ++NPW 
Sbjct  763  QTRARNTRRNPWQ  775



>ref|XP_006451261.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|ESR64501.1| hypothetical protein CICLE_v10007513mg [Citrus clementina]
 gb|KDO66517.1| hypothetical protein CISIN_1g003973mg [Citrus sinensis]
Length=737

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 140/144 (97%), Gaps = 1/144 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKYVLVVFGGLVGYPS
Sbjct  592  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFNSLDVKYVLVVFGGLVGYPS  651

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYRFVETD G
Sbjct  652  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETD-G  710

Query  469  KGFDRVRRTEIGKKVFKLTHFEEV  398
            KGFDRVRRTEIGKK FKLTHFEEV
Sbjct  711  KGFDRVRRTEIGKKYFKLTHFEEV  734



>gb|ACL54353.1| unknown [Zea mays]
 gb|AFW78837.1| hypothetical protein ZEAMMB73_319539 [Zea mays]
Length=753

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 142/191 (74%), Gaps = 30/191 (16%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVG                              GYPS
Sbjct  593  QTTAMANRTVIVDNNTWNNTHIATVGLV----------------------------GYPS  624

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYR+D+QATPTMLN LMYKL YYRFVETD G
Sbjct  625  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRVDAQATPTMLNCLMYKLCYYRFVETD-G  683

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRGktkksksvkssnsk  290
            KGFDRVR  EIGKK FKLTHFEEVFTTHHWMVRIYKLKP KNR+RGK KK K+   ++  
Sbjct  684  KGFDRVRGYEIGKKHFKLTHFEEVFTTHHWMVRIYKLKPQKNRVRGKLKKLKASAKTSPT  743

Query  289  rSGTRKKNPWH  257
             +  R KNPW 
Sbjct  744  LAAGR-KNPWQ  753



>ref|XP_006381754.1| hypothetical protein POPTR_0006s17690g [Populus trichocarpa]
 gb|ERP59551.1| hypothetical protein POPTR_0006s17690g [Populus trichocarpa]
Length=477

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 136/157 (87%), Gaps = 12/157 (8%)
 Frame = -3

Query  802  VIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPSDDINKFLWM  623
            ++ DNNTWNNTHIA VG+AMSSPEKAAW+IF SLDVKYVLVVFGG VGYPSDDINKFLWM
Sbjct  306  LLFDNNTWNNTHIANVGSAMSSPEKAAWEIFNSLDVKYVLVVFGGFVGYPSDDINKFLWM  365

Query  622  VRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGGKGFDRVRRT  443
            VRIGGGVFPHIKEPDYLRDGQY IDSQATPTMLN LMYKLSYY            RVRRT
Sbjct  366  VRIGGGVFPHIKEPDYLRDGQYWIDSQATPTMLNCLMYKLSYY------------RVRRT  413

Query  442  EIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG  332
            EIGKK FKLT FEEVFTTHHWMVRIYKLKPPKNRI G
Sbjct  414  EIGKKYFKLTPFEEVFTTHHWMVRIYKLKPPKNRIWG  450



>gb|KGN65135.1| hypothetical protein Csa_1G237040 [Cucumis sativus]
Length=202

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 122/135 (90%), Gaps = 3/135 (2%)
 Frame = -3

Query  655  PSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETD  476
            PSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQAT TMLN LMYKLSYYRFVETD
Sbjct  69   PSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATQTMLNCLMYKLSYYRFVETD  128

Query  475  GGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRIRG--ktkksksvks  302
             GKGFDRVR+TEIGKK FKL+HFEEVFTTHHWMVRIYKLKPPKNRIRG  K  K+KS  +
Sbjct  129  -GKGFDRVRQTEIGKKYFKLSHFEEVFTTHHWMVRIYKLKPPKNRIRGKTKKSKTKSSST  187

Query  301  snskrSGTRKKNPWH  257
            ++ K  GT+K+NPWH
Sbjct  188  TSLKTKGTKKRNPWH  202



>gb|ACF79760.1| unknown [Zea mays]
Length=176

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  9    QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  68

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YRID  A P MLN LMYKL YYRF E  T+
Sbjct  69   DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRIDKGAAPKMLNCLMYKLCYYRFGELTTE  128

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  129  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  175



>gb|AFK44312.1| unknown [Lotus japonicus]
Length=351

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  184  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  243

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  244  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  303

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  304  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTQNWIVRIYKVKPPKNR  350



>dbj|BAF01432.1| hypothetical protein [Arabidopsis thaliana]
Length=221

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  54   QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDDAYDIMRSLDVNYVLVVFGGVTGYSS  113

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  114  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  173

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  174  YGKPPGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  221



>gb|KHN23613.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Glycine soja]
Length=394

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  227  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  286

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  287  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  346

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W VRIYK+KPPKNR
Sbjct  347  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTQNWRVRIYKVKPPKNR  393



>emb|CBG76274.1| OO_Ba0005L10-OO_Ba0081K17.25 [Oryza officinalis]
Length=707

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  540  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  599

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  600  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELTTE  659

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL H EE FTT +W+VRIYK+KPPKNR
Sbjct  660  YGKPPGYDRVRGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPKNR  706



>gb|KHN24504.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Glycine soja]
Length=508

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  341  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  400

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  401  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  460

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  461  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTQNWIVRIYKVKPPKNR  507



>ref|XP_006653023.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Oryza brachyantha]
Length=720

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  553  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  612

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A+P MLN LMYKL YYRF E  T+
Sbjct  613  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGASPKMLNCLMYKLCYYRFGELTTE  672

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  673  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  719



>ref|XP_002448765.1| hypothetical protein SORBIDRAFT_06g032800 [Sorghum bicolor]
 gb|EES13093.1| hypothetical protein SORBIDRAFT_06g032800 [Sorghum bicolor]
Length=720

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  553  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  612

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YRID  A P MLN LMYKL YYRF E  T+
Sbjct  613  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRIDKGAAPKMLNCLMYKLCYYRFGELTTE  672

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  673  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  719



>ref|NP_001131374.1| oligosaccharyl transferase STT3 subunit [Zea mays]
 gb|ACG32197.1| oligosaccharyl transferase STT3 subunit [Zea mays]
 gb|AFW59881.1| oligosaccharyl transferase STT3 subunit [Zea mays]
Length=720

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  553  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  612

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YRID  A P MLN LMYKL YYRF E  T+
Sbjct  613  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRIDKGAAPKMLNCLMYKLCYYRFGELTTE  672

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  673  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  719



>ref|NP_001054248.1| Os04g0675500 [Oryza sativa Japonica Group]
 sp|Q7XQ88.2|STT3B_ORYSJ RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B; Short=Oligosaccharyl transferase 
subunit STT3B; Short=STT3-B; AltName: Full=Protein STAUROSPORIN 
AND TEMPERATURE SENSITIVE 3-LIKE B [Oryza sativa Japonica 
Group]
 emb|CAE03245.2| OSJNBa0018M05.20 [Oryza sativa Japonica Group]
 emb|CAJ86104.1| H0103C06.8 [Oryza sativa Indica Group]
 dbj|BAF16162.1| Os04g0675500 [Oryza sativa Japonica Group]
 gb|EAY96032.1| hypothetical protein OsI_17905 [Oryza sativa Indica Group]
 gb|EAZ32398.1| hypothetical protein OsJ_16609 [Oryza sativa Japonica Group]
 dbj|BAG93946.1| unnamed protein product [Oryza sativa Japonica Group]
Length=721

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  554  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  613

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  614  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELTTE  673

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  674  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  720



>ref|XP_004515278.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Cicer arietinum]
Length=731

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  564  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  623

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  624  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  683

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  GFDR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  684  YGKPPGFDRARGVEIGNKDIKLEYLEEAFTTQNWIVRIYKVKPPKNR  730



>ref|NP_001168720.1| hypothetical protein [Zea mays]
 gb|ACN29281.1| unknown [Zea mays]
 tpg|DAA35369.1| TPA: hypothetical protein ZEAMMB73_533808 [Zea mays]
Length=719

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  552  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  611

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YRID  A P MLN LMYKL YYRF E  T+
Sbjct  612  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRIDKGAAPKMLNCLMYKLCYYRFGELTTE  671

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  672  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  718



>ref|XP_004960084.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Setaria italica]
Length=720

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  553  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  612

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  613  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELTTE  672

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  673  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  719



>ref|XP_009391070.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Musa acuminata subsp. malaccensis]
Length=730

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGGL GY S
Sbjct  563  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEHEAYEIMQSLDVDYVLVVFGGLTGYSS  622

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF  V T+
Sbjct  623  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGEVTTE  682

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W++RIYK+KPPKNR
Sbjct  683  YGKPTGYDRARGVEIGNKDIKLEYLEEAFTTSNWIIRIYKVKPPKNR  729



>ref|XP_003534085.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Glycine max]
Length=729

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  562  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  621

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  622  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  681

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  682  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTQNWIVRIYKVKPPKNR  728



>ref|XP_008803294.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Phoenix dactylifera]
Length=733

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  566  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  625

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  626  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  685

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  686  YGKPTGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  732



>ref|XP_003620143.1| Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A [Medicago truncatula]
 gb|AES76361.1| oligosaccharyltransferase subunit STT3 [Medicago truncatula]
Length=727

 Score =   218 bits (556),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  560  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMKSLDVDYVLVVFGGVTGYSS  619

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  620  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  679

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  680  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTQNWIVRIYKVKPPKNR  726



>ref|XP_004137528.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Cucumis sativus]
 gb|KGN64209.1| hypothetical protein Csa_1G043120 [Cucumis sativus]
Length=747

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  580  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEGEAYEIMRSLDVDYVLVVFGGVTGYSS  639

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  640  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  699

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  GFDR R  EIG K  KL H EE FTT +W+VRIY++KPP NR
Sbjct  700  YGKPPGFDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYRVKPPNNR  746



>emb|CBI35275.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  387  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  446

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF  ++T+
Sbjct  447  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELQTE  506

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  507  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  553



>ref|XP_003548296.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Glycine max]
Length=733

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  566  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  625

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  626  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  685

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  686  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTQNWIVRIYKVKPPKNR  732



>ref|XP_010940347.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B isoform X2 [Elaeis guineensis]
Length=676

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  509  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  568

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  569  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELTTE  628

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  629  YGKPTGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  675



>ref|XP_006374276.1| hypothetical protein POPTR_0015s05610g [Populus trichocarpa]
 gb|ERP52073.1| hypothetical protein POPTR_0015s05610g [Populus trichocarpa]
Length=652

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  485  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  544

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  545  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  604

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  605  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  651



>ref|XP_010940345.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B isoform X1 [Elaeis guineensis]
Length=733

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  566  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  625

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  626  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELTTE  685

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  686  YGKPTGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  732



>ref|XP_011003683.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Populus euphratica]
Length=743

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  576  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMKSLDVDYVLVVFGGVTGYSS  635

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  636  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  695

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  696  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  742



>gb|EYU17803.1| hypothetical protein MIMGU_mgv1a001976mg [Erythranthe guttata]
Length=731

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  564  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  623

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  624  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  683

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  684  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  730



>ref|XP_002318345.2| STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE B family protein 
[Populus trichocarpa]
 gb|EEE96565.2| STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE B family protein 
[Populus trichocarpa]
Length=743

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  576  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMKSLDVDYVLVVFGGVTGYSS  635

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  636  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  695

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  696  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  742



>gb|KJB78537.1| hypothetical protein B456_013G004300 [Gossypium raimondii]
Length=718

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  551  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIIRSLDVDYVLVVFGGVTGYSS  610

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  611  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGEMMTE  670

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  671  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  717



>ref|XP_010543062.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Tarenaya hassleriana]
Length=723

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  556  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVNYVLVVFGGVTGYSS  615

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  616  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELVTE  675

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIY++KPPKNR
Sbjct  676  YGKPPGYDRARGVEIGNKDIKLDHLEEAFTTSNWIVRIYRVKPPKNR  722



>ref|XP_011047756.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Populus euphratica]
Length=738

 Score =   216 bits (551),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  571  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  630

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  631  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  690

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  691  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  737



>dbj|BAJ87792.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=725

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKE DYL +G+YR+D  A+P MLN LMYKL YYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVFPVIKESDYLVNGEYRVDKGASPKMLNCLMYKLCYYRFGELTTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  678  YGKPPGYDRVRGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPKNR  724



>ref|XP_008375065.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Malus domestica]
Length=747

 Score =   216 bits (551),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  580  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  639

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  640  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGEMTTE  699

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  700  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  746



>ref|XP_009355928.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Pyrus x bretschneideri]
Length=747

 Score =   216 bits (551),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  580  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  639

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  640  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGEMTTE  699

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  700  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  746



>ref|XP_006493422.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Citrus sinensis]
Length=740

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  573  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  632

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  633  DDINKFLWMVRIGGGVFPVIKEPDYLVNGDYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  692

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  693  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  739



>ref|XP_006441420.1| hypothetical protein CICLE_v10019005mg [Citrus clementina]
 gb|ESR54660.1| hypothetical protein CICLE_v10019005mg [Citrus clementina]
Length=740

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  573  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  632

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  633  DDINKFLWMVRIGGGVFPVIKEPDYLVNGDYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  692

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  693  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  739



>ref|XP_008240342.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Prunus mume]
Length=747

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  580  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  639

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  640  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  699

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  700  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  746



>ref|XP_007210892.1| hypothetical protein PRUPE_ppa001886mg [Prunus persica]
 gb|EMJ12091.1| hypothetical protein PRUPE_ppa001886mg [Prunus persica]
Length=747

 Score =   216 bits (550),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  580  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  639

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  640  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  699

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  700  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  746



>ref|XP_009630495.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Nicotiana tomentosiformis]
Length=729

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  562  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  621

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  622  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  681

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE +TT +W+VRIYK+KPPKNR
Sbjct  682  YGKPPGYDRARGVEIGNKDIKLEYLEEAYTTSNWIVRIYKVKPPKNR  728



>ref|XP_008467302.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Cucumis melo]
Length=747

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  580  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  639

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  640  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  699

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIY++KPP NR
Sbjct  700  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYRVKPPNNR  746



>ref|XP_008393507.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Malus domestica]
Length=743

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  576  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  635

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  636  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  695

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  696  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  742



>ref|XP_002269119.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Vitis vinifera]
Length=741

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  574  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  633

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF  ++T+
Sbjct  634  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELQTE  693

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  694  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  740



>ref|XP_009792115.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Nicotiana sylvestris]
Length=729

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  562  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  621

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  622  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  681

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE +TT +W+VRIYK+KPPKNR
Sbjct  682  YGKPPGYDRARGVEIGNKDIKLEYLEEAYTTSNWIVRIYKVKPPKNR  728



>emb|CDO98566.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDRGAAPKMLNCLMYKLSYYRFGELTTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  678  FGKPPGYDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPNNR  724



>ref|XP_005847365.1| hypothetical protein CHLNCDRAFT_31189 [Chlorella variabilis]
 gb|EFN55263.1| hypothetical protein CHLNCDRAFT_31189 [Chlorella variabilis]
Length=769

 Score =   216 bits (550),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 135/168 (80%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVG AMSSPE+ AW IF+SLDV+YV VVFGG +GYPS
Sbjct  574  QTTAMANRTVIVDNNTWNNTHIATVGRAMSSPERKAWQIFRSLDVEYVFVVFGGFIGYPS  633

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRFVET--  479
            DDINKFLWMVRIGGGVFP IKEP+YL  DG YR+D QA   +L+S M+KLSYYRF +   
Sbjct  634  DDINKFLWMVRIGGGVFPEIKEPNYLGSDGNYRVDDQAGKALLDSTMWKLSYYRFADCGP  693

Query  478  --DGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
                 +G+DRVR T IGK  F+L +FEEVFT+ HWM+RIY++    NR
Sbjct  694  MFGAPRGYDRVRNTVIGKTDFELKYFEEVFTSEHWMMRIYRVLDKPNR  741



>ref|XP_003580816.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Brachypodium distachyon]
Length=723

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  556  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  615

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A+  MLN LMYKL YYRF E  T+
Sbjct  616  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGASHKMLNCLMYKLCYYRFGELTTE  675

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  676  YGKPPGYDRVRGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPKNR  722



>ref|XP_011086954.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Sesamum indicum]
Length=731

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  564  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  623

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  624  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  683

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W++RIYK+KPP NR
Sbjct  684  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIIRIYKVKPPNNR  730



>ref|XP_006847859.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Amborella trichopoda]
 gb|ERN09440.1| hypothetical protein AMTR_s00029p00078080 [Amborella trichopoda]
Length=733

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  566  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEPEAYEIMQSLDVDYVLVVFGGVTGYSS  625

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  626  DDINKFLWMVRIGGGVFPIIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  685

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  686  YGKPLGWDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPSNR  732



>ref|XP_006353938.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Solanum tuberosum]
Length=725

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  678  YGQPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  724



>ref|XP_004299463.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Fragaria vesca subsp. vesca]
Length=738

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  571  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSS  630

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  631  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  690

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  691  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  737



>ref|XP_010935542.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Elaeis guineensis]
Length=729

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  562  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  621

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  622  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  681

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  +L + EE +TT +W++RIYK+KPPKNR
Sbjct  682  YGKPAGYDRARGVEIGNKDIELEYLEEAYTTSNWIIRIYKVKPPKNR  728



>ref|XP_004235404.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Solanum lycopersicum]
Length=725

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPPKNR
Sbjct  678  YGQPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPKNR  724



>ref|XP_010530133.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Tarenaya hassleriana]
Length=739

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+ I +SLDV YVLVVFGG+ GY S
Sbjct  572  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYGIMRSLDVDYVLVVFGGVTGYSS  631

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  632  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELVTE  691

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIY++KPPKNR
Sbjct  692  YGKPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYRVKPPKNR  738



>ref|XP_005650137.1| STT3 subunit of Oligosaccharyl transferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25593.1| STT3 subunit of Oligosaccharyl transferase [Coccomyxa subellipsoidea 
C-169]
Length=721

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 6/168 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTV+VDNNTWNNTHIATVG AM+SPEK AW+I+++LDV +VLV+FGG +GYPS
Sbjct  535  QTTAMANRTVLVDNNTWNNTHIATVGRAMASPEKQAWEIYRALDVTHVLVIFGGFIGYPS  594

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE----  482
            DDINKFLWMVRIGGGVFP IKE D+L +G YR+DS+A   +L+ LMYKLSYYR+ E    
Sbjct  595  DDINKFLWMVRIGGGVFPDIKEKDFLGEGGYRVDSKAGKALLDCLMYKLSYYRYAEASLM  654

Query  481  TDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKL--KPPKN  344
            T G  GFDRVR  +IGK    L +FEEVFT+ HWMVRIY++  KP ++
Sbjct  655  TTGQLGFDRVRNVQIGKMDVSLEYFEEVFTSEHWMVRIYRVLDKPARD  702



>ref|XP_006415033.1| hypothetical protein EUTSA_v10006908mg [Eutrema salsugineum]
 gb|ESQ33386.1| hypothetical protein EUTSA_v10006908mg [Eutrema salsugineum]
Length=741

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  574  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  633

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  634  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELVTE  693

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  694  YGKPSGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  741



>ref|XP_006306856.1| hypothetical protein CARUB_v10008402mg [Capsella rubella]
 gb|EOA39754.1| hypothetical protein CARUB_v10008402mg [Capsella rubella]
Length=739

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  572  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  631

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  632  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  691

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  692  YGKPPGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  739



>ref|XP_007010857.1| Staurosporin and temperature sensitive 3-like b [Theobroma cacao]
 gb|EOY19667.1| Staurosporin and temperature sensitive 3-like b [Theobroma cacao]
Length=718

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  551  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  610

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP I+EPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  611  DDINKFLWMVRIGGGVFPVIREPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  670

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL H EE FTT +W+VRIYK+KPP NR
Sbjct  671  YGRPPGYDRARGVEIGNKDIKLEHLEEAFTTSNWIVRIYKVKPPNNR  717



>ref|XP_012079356.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Jatropha curcas]
 gb|KDP45809.1| hypothetical protein JCGZ_17416 [Jatropha curcas]
Length=743

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  576  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  635

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  636  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  695

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  696  YGRPSGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  742



>ref|XP_002891078.1| hypothetical protein ARALYDRAFT_891007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67337.1| hypothetical protein ARALYDRAFT_891007 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  571  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  630

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  631  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  690

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  691  YGKPPGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  738



>ref|XP_007152548.1| hypothetical protein PHAVU_004G139400g [Phaseolus vulgaris]
 gb|ESW24542.1| hypothetical protein PHAVU_004G139400g [Phaseolus vulgaris]
Length=723

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  556  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  615

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  616  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  675

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE  TT +W+VRIYK+KPPKNR
Sbjct  676  YGRPPGYDRARGVEIGNKDIKLEYLEEALTTQNWIVRIYKVKPPKNR  722



>ref|NP_174675.2| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Arabidopsis thaliana]
 sp|Q9FX21.1|STT3B_ARATH RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B; Short=Oligosaccharyl transferase 
subunit STT3B; Short=STT3-B; AltName: Full=Protein STAUROSPORIN 
AND TEMPERATURE SENSITIVE 3-LIKE B [Arabidopsis thaliana]
 gb|AAG12524.1|AC015446_5 Putative integral membrane protein [Arabidopsis thaliana]
 gb|AEE31675.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Arabidopsis thaliana]
 gb|AHL38912.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=735

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  568  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDDAYDIMRSLDVNYVLVVFGGVTGYSS  627

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  628  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  687

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  688  YGKPPGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  735



>ref|XP_010037022.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B isoform X1 [Eucalyptus grandis]
Length=744

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  577  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  636

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  637  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  696

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  697  YGRPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  743



>ref|XP_010037023.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B isoform X2 [Eucalyptus grandis]
 gb|KCW48657.1| hypothetical protein EUGRSUZ_K02314 [Eucalyptus grandis]
Length=743

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  576  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  635

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  636  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  695

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  696  YGRPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKPPNNR  742



>gb|KFK45118.1| hypothetical protein AALP_AA1G346600 [Arabis alpina]
Length=726

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  559  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  618

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGV+P IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  619  DDINKFLWMVRIGGGVYPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELVTE  678

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  679  YGKPSGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  726



>emb|CDY15314.1| BnaC06g08000D [Brassica napus]
Length=725

 Score =   213 bits (542),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGV+P IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVYPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELVTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  678  YGKPTGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  725



>emb|CDX93729.1| BnaA09g23290D [Brassica napus]
Length=725

 Score =   213 bits (542),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGV+P IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVYPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELVTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  678  YGKPTGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  725



>ref|XP_010461241.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Camelina sativa]
Length=669

 Score =   212 bits (540),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  502  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSNEDEAYEIMRSLDVNYVLVVFGGVTGYSS  561

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  562  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  621

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  622  YGKPPGYDRARGGEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  669



>gb|AGV54454.1| dolichyl-diphosphooligosaccharide protein glycosyltransferase 
subunit STT3A [Phaseolus vulgaris]
Length=723

 Score =   213 bits (542),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  556  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  615

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  616  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  675

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DR R  EIG K  KL + EE  TT +W+VRIYK+KPPKNR
Sbjct  676  YGRPPGYDRARGVEIGNKDIKLEYLEEALTTQNWIVRIYKVKPPKNR  722



>ref|XP_010499953.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Camelina sativa]
Length=738

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  571  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSNEDEAYEIMRSLDVNYVLVVFGGVTGYSS  630

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  631  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  690

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  691  YGKPPGYDRARGGEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  738



>gb|KJB73162.1| hypothetical protein B456_011G219600 [Gossypium raimondii]
Length=720

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A +I +SLDV YVLVVFGG+ GY S
Sbjct  553  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAIEIIRSLDVDYVLVVFGGVTGYSS  612

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  613  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGEMMTE  672

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIY++KPP NR
Sbjct  673  YGKPPGYDRARGVEIGNKDVKLEHLEEAFTTSNWIVRIYRVKPPNNR  719



>gb|KHG18443.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3 [Gossypium arboreum]
Length=687

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A +I +SLDV YVLVVFGG+ GY S
Sbjct  512  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAIEIIRSLDVDYVLVVFGGVTGYSS  571

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  572  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGEMLTE  631

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL H EE FTT +W+VRIY++KPP NR
Sbjct  632  YGKPPGYDRARGVEIGNKDVKLEHLEEAFTTSNWIVRIYRVKPPNNR  678



>ref|XP_010250082.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Nelumbo nucifera]
 ref|XP_010250089.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Nelumbo nucifera]
Length=735

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  568  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  627

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  628  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELTTE  687

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+K P NR
Sbjct  688  YGKPPGYDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKVKSPSNR  734



>ref|XP_002979240.1| oligosaccharyltransferase subunit STT3 [Selaginella moellendorffii]
 gb|EFJ19648.1| oligosaccharyltransferase subunit STT3 [Selaginella moellendorffii]
Length=743

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  576  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSS  635

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGGGVFP IKE DYL +G+YRID+ A P ML  LMYKL YYRF  V T+
Sbjct  636  DDINKFLWMVRIGGGVFPVIKESDYLNNGEYRIDAAAAPKMLECLMYKLCYYRFGEVSTE  695

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R T IGKK F+L + +E FTT +W+VRIYKLKPP NR
Sbjct  696  YGKPPGWDRARGTVIGKKDFELEYLDEAFTTSNWIVRIYKLKPPANR  742



>ref|XP_010687248.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Beta vulgaris subsp. vulgaris]
Length=740

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  573  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  632

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKE DYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  633  DDINKFLWMVRIGGGVFPVIKESDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELRTE  692

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DR R  EIG K  KL + EE FTT +W+VRIYK+KPP NR
Sbjct  693  YGKPPGYDRARGVEIGNKDVKLEYLEEAFTTSNWIVRIYKVKPPNNR  739



>ref|XP_010478833.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B isoform X2 [Camelina sativa]
Length=738

 Score =   211 bits (536),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  571  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSNEDEAYEIMRSLDVNYVLVVFGGVTGYSS  630

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGV+P IKEP+YL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  631  DDINKFLWMVRIGGGVYPVIKEPEYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELTTE  690

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  691  YGKPPGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRIYRVKPPTNRL  738



>ref|XP_009114756.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B [Brassica rapa]
Length=725

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 4/168 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  558  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGV+P IKEPDYL +G++R+D  A+P MLN LMYKL YYRF E  T+
Sbjct  618  DDINKFLWMVRIGGGVYPVIKEPDYLVNGEFRVDKGASPKMLNCLMYKLCYYRFGELVTE  677

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             GK  G+DR R  EIG K  KL H EE +TT +W+VR+Y++KPP N +
Sbjct  678  YGKPTGYDRARGVEIGNKDIKLEHLEEAYTTSNWIVRVYRVKPPTNML  725



>ref|XP_004622467.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like, partial [Sorex araneus]
Length=228

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 131/170 (77%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNT NNTHI+ VG AM+SPE+ A++I Q LDV YVLV+FGGLVGY S
Sbjct  59   QITAMGNRTVIVDNNTSNNTHISRVGQAMASPEEKAYEILQELDVDYVLVIFGGLVGYSS  118

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF---  488
            DDINKFLWM+RIGG      HIKE DYL   G+YR+D +A+PTMLNSLMYKLSYYRF   
Sbjct  119  DDINKFLWMIRIGGSTPEGKHIKESDYLSPTGEYRVDREASPTMLNSLMYKLSYYRFGQV  178

Query  487  -VETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
              E+    GFDRVR +EIG K F++ H EE FT+ HW+VRIY++ PP NR
Sbjct  179  YTESSKPAGFDRVRHSEIGNKNFRMQHLEEAFTSEHWLVRIYRVLPPDNR  228



>ref|XP_004359158.1| oligosaccharyl transferase [Dictyostelium fasciculatum]
 gb|EGG21308.1| oligosaccharyl transferase [Dictyostelium fasciculatum]
Length=709

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AMANRTVIVDNNTWNNTHIA VG A +S E+ A+ I + LDV YVLV+FGGL GY S
Sbjct  542  QMSAMANRTVIVDNNTWNNTHIAQVGKAFASNEEDAYKIIKDLDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGG   P+IKE DYL +G YRID  ATPTMLNSLMYKLSYYRF  V TD
Sbjct  602  DDINKFLWMVRIGGSCDPNIKEADYLANGHYRIDKGATPTMLNSLMYKLSYYRFSEVSTD  661

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  G+DRVR TEIG K F LTH EE FT+ HW+VRIYK+K   NR
Sbjct  662  YGRPSGYDRVRNTEIGYKGFSLTHLEEAFTSVHWLVRIYKVKDIDNR  708



>ref|XP_001767963.1| predicted protein [Physcomitrella patens]
 gb|EDQ67238.1| predicted protein [Physcomitrella patens]
Length=742

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AM+S E  A++I + LDV YVLVVFGG+ GY S
Sbjct  575  QITAMGNRTVIVDNNTWNNTHIATVGRAMASNEDDAYEIMRQLDVNYVLVVFGGITGYSS  634

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIG GVFP I+E DYL +G+YRID +A P ML  LMYKL YYRF  ++T+
Sbjct  635  DDINKFLWMVRIGSGVFPVIQEADYLNNGEYRIDKEAAPKMLECLMYKLCYYRFGEMQTE  694

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G+  GFDR R  EIG K F+L H EE FTT +W+VRIYK+KPP NR
Sbjct  695  YGRPSGFDRARGVEIGNKEFELKHVEEAFTTQNWIVRIYKVKPPVNR  741



>ref|XP_011399692.1| Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3 [Auxenochlorella protothecoides]
 gb|KFM26750.1| Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3 [Auxenochlorella protothecoides]
Length=809

 Score =   208 bits (530),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 133/175 (76%), Gaps = 12/175 (7%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvg---  659
            QTTAMANRTVIVDNNTWNNTHIATVG AM+ PEKA+ ++F+SLDV+YV VVFG  +G   
Sbjct  599  QTTAMANRTVIVDNNTWNNTHIATVGRAMALPEKASSEVFRSLDVEYVFVVFGAFIGRVL  658

Query  658  -----YPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYY  494
                 YPSDDINKFLWMVRIGGGVFP IKE DYL  GQYR+DS A   ML+S MY+LSYY
Sbjct  659  GVGRGYPSDDINKFLWMVRIGGGVFPDIKERDYLNRGQYRVDSTAPKAMLDSTMYRLSYY  718

Query  493  RFVETDG----GKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
            RF ET        G+DRVR+  IG   FKL H+EEVFT+ HWMVR+Y++ P  NR
Sbjct  719  RFAETGPLFGMPYGYDRVRQQTIGLPDFKLKHYEEVFTSEHWMVRVYRVLPEPNR  773



>ref|XP_002955643.1| hypothetical protein VOLCADRAFT_66117 [Volvox carteri f. nagariensis]
 gb|EFJ43283.1| hypothetical protein VOLCADRAFT_66117 [Volvox carteri f. nagariensis]
Length=767

 Score =   208 bits (529),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 10/174 (6%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWN +HIATVG AMSS E  AW I++SLDV YV VVFGGLVGYPS
Sbjct  583  QTTAMANRTVIVDNNTWNTSHIATVGRAMSSSEAKAWSIYRSLDVDYVFVVFGGLVGYPS  642

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRFVE---  482
            DDINKFLWMVRIGGGV+P IKEPDYL  +G YR+D++ T TMLNSLMYKLSYY F +   
Sbjct  643  DDINKFLWMVRIGGGVYPEIKEPDYLTPEGDYRVDARGTKTMLNSLMYKLSYYNFADESQ  702

Query  481  -TDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYK-----LKPPKNRI  338
             + G +G DRVR   IG+   KL +FEEVFT+ HWM+RIY+     L+ P +R+
Sbjct  703  LSTGQRGVDRVRGYPIGRLNVKLNYFEEVFTSQHWMMRIYRVRDRPLRDPTSRV  756



>gb|KDD76460.1| STT3 subunit of oligosaccharyl transferase [Helicosporidium sp. 
ATCC 50920]
Length=777

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVG AM+SPE+ A  IF++LDV+YV VVFG  +GYPS
Sbjct  594  QTTAMANRTVIVDNNTWNNTHIATVGRAMASPERKAAAIFRTLDVEYVFVVFGAFIGYPS  653

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRFVETDG  473
            DDINKFLWMVRIGGGVFP IKE D+L   G YR+D QA   + +S++Y+LSYYRF E   
Sbjct  654  DDINKFLWMVRIGGGVFPEIKEKDFLSASGSYRVDDQAGRALTDSIVYRLSYYRFAEAAE  713

Query  472  ----GKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
                 +G+DRVR+  IG + F+L HFEEVFT+ HWMVRIY++ P  NR
Sbjct  714  LLGLERGYDRVRQAVIGLQDFELKHFEEVFTSEHWMVRIYRVLPEPNR  761



>gb|EPS67017.1| hypothetical protein M569_07758, partial [Genlisea aurea]
Length=733

 Score =   206 bits (523),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T+M NRTVIVDNNTWNNTHIATVG AM+S E  A+ I +SLDV YVLVVFGG+ GY S
Sbjct  567  QITSMGNRTVIVDNNTWNNTHIATVGRAMASYEDEAYAIMRSLDVDYVLVVFGGVTGYSS  626

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGV+P IKE DYL +G++R+D   +P MLN LMYKL YYRF E  T+
Sbjct  627  DDINKFLWMVRIGGGVYPVIKESDYLVNGEFRVDRGGSPKMLNCLMYKLCYYRFGELSTE  686

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  GFDR R  EIG K  KL + EE FTT +W+VRIYKLKPP NR
Sbjct  687  YGKAGGFDRARGVEIGNKDIKLEYLEEAFTTSNWIVRIYKLKPPNNR  733



>emb|CDY28395.1| BnaA05g18450D [Brassica napus]
Length=486

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 127/169 (75%), Gaps = 5/169 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM N TVIVDNNTWNNTHIATVG AMSS E  A+DI +SLDV YVLVVFGG+ GY S
Sbjct  318  QITAMGNITVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVNYVLVVFGGVTGYSS  377

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGV P IKEPDYL +G+ R+D  A+P MLN LMYKL YYRF E    
Sbjct  378  DDINKFLWMVRIGGGVDPVIKEPDYLVNGELRVDKGASPKMLNCLMYKLCYYRFGELVTE  437

Query  469  KG-----FDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
             G     +DR R  EI KK  KL H EE +TT +W+VRIY++KPP NR+
Sbjct  438  YGSQPGTYDRARWVEIEKKYIKLKHLEEAYTTSNWIVRIYRVKPPTNRL  486



>ref|XP_007013064.1| Staurosporin and temperature sensitive 3-like A isoform 3 [Theobroma 
cacao]
 gb|EOY30683.1| Staurosporin and temperature sensitive 3-like A isoform 3 [Theobroma 
cacao]
Length=708

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAW+IF SLDVKY+LVVFGGLVGYPS
Sbjct  596  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWEIFHSLDVKYILVVFGGLVGYPS  655

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYR  491
            DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLN LMYKLSYYR
Sbjct  656  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYR  708



>gb|EMT03890.1| hypothetical protein F775_52478 [Aegilops tauschii]
Length=1288

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  482  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVNYVLVVFGGVTGYSS  541

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A+P MLN LMYKL YYRF E  T+
Sbjct  542  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGASPKMLNCLMYKLCYYRFGELTTE  601

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKL  359
             GK  G+DRVR  EIG K  KL + EE FTT +W+VRIYK 
Sbjct  602  YGKPPGYDRVRGVEIGNKDIKLEYLEEAFTTSNWIVRIYKF  642



>gb|KIY95689.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
[Monoraphidium neglectum]
Length=503

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 129/163 (79%), Gaps = 5/163 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRT+IVDNNTWN +HIATVG AM+SPE  AW I++SLDV+YV VVFGGL+GY S
Sbjct  318  QTTAMANRTIIVDNNTWNTSHIATVGRAMASPEAKAWRIYRSLDVEYVFVVFGGLIGYSS  377

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRFVETD-  476
            DDINKFLWMVRIGGGV+P IKE DYL  +G+YRID++  P ML SLMYKLSYY F E   
Sbjct  378  DDINKFLWMVRIGGGVYPEIKEKDYLSANGEYRIDAEGNPIMLKSLMYKLSYYDFPEASE  437

Query  475  ---GGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLK  356
               G +G DRVR T IG     L +FEEVF++ HWM+RIY+++
Sbjct  438  RQFGQRGMDRVRGTLIGNFDVSLKYFEEVFSSQHWMMRIYRVR  480



>emb|CDW54120.1| Argonaute 1 isoform B [Trichuris trichiura]
Length=1646

 Score =   202 bits (515),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 7/170 (4%)
 Frame = -3

Query  829   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
             Q TAMANRTV+VDNNTWNNTHI+ VG AM+SPE+ A++I   LDV YVLV+FGG++GY S
Sbjct  1471  QITAMANRTVLVDNNTWNNTHISRVGQAMASPEEKAYEIMLELDVDYVLVIFGGMIGYSS  1530

Query  649   DDINKFLWMVRIGGGVFP--HIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF---  488
             DDINKFLWMVRIGG      HI E DYL   G+YRID +A+PTMLNSLMYKLSYYRF   
Sbjct  1531  DDINKFLWMVRIGGSTEKGRHIHEADYLSASGEYRIDREASPTMLNSLMYKLSYYRFGQV  1590

Query  487   -VETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
               E+   +G+DRVR  EIG K F+L H EEV+T+ HW+VRIY++KPP NR
Sbjct  1591  YTESSKPQGYDRVRHAEIGNKNFELDHLEEVYTSEHWLVRIYRVKPPANR  1640



>gb|KFD61424.1| hypothetical protein M514_06001 [Trichuris suis]
Length=1617

 Score =   201 bits (512),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 7/170 (4%)
 Frame = -3

Query  829   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
             Q TAMANRTV+VDNNTWNNTHI+ VG AM+SPE+ A++I Q LDV YVLV+FGG++GY S
Sbjct  1444  QITAMANRTVLVDNNTWNNTHISRVGQAMASPEEKAYEIMQELDVDYVLVIFGGMIGYSS  1503

Query  649   DDINKFLWMVRIGGGVFP--HIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF---  488
             DDINKFLWMVRIGG      HI E DYL   G+YRID +A+PTMLNSLMYKLSYY+F   
Sbjct  1504  DDINKFLWMVRIGGSTEKGRHIHEADYLSASGEYRIDREASPTMLNSLMYKLSYYKFGQV  1563

Query  487   -VETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
               E+   +G+DRVR  EIG K F+L H EEV+T+ HW+VRIY++K P NR
Sbjct  1564  YTESSKPQGYDRVRHAEIGNKNFELEHLEEVYTSEHWLVRIYRVKAPANR  1613



>gb|KFD53087.1| hypothetical protein M513_06001 [Trichuris suis]
Length=1665

 Score =   201 bits (512),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 133/170 (78%), Gaps = 7/170 (4%)
 Frame = -3

Query  829   QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
             Q TAMANRTV+VDNNTWNNTHI+ VG AM+SPE+ A++I Q LDV YVLV+FGG++GY S
Sbjct  1492  QITAMANRTVLVDNNTWNNTHISRVGQAMASPEEKAYEIMQELDVDYVLVIFGGMIGYSS  1551

Query  649   DDINKFLWMVRIGGGVFP--HIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF---  488
             DDINKFLWMVRIGG      HI E DYL   G+YRID +A+PTMLNSLMYKLSYY+F   
Sbjct  1552  DDINKFLWMVRIGGSTEKGRHIHEADYLSASGEYRIDREASPTMLNSLMYKLSYYKFGQV  1611

Query  487   -VETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
               E+   +G+DRVR  EIG K F+L H EEV+T+ HW+VRIY++K P NR
Sbjct  1612  YTESSKPQGYDRVRHAEIGNKNFELEHLEEVYTSEHWLVRIYRVKAPANR  1661



>ref|XP_639887.1| oligosaccharyl transferase, STT3 subunit [Dictyostelium discoideum 
AX4]
 sp|Q54NM9.1|STT3_DICDI RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3; Short=Oligosaccharyl transferase 
subunit STT3 [Dictyostelium discoideum]
 gb|EAL64892.1| oligosaccharyl transferase, STT3 subunit [Dictyostelium discoideum 
AX4]
Length=714

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AMANRTV+VDNNTWNN+HIA VG A +S E+ A+   ++LDV YVLV+FGGL GY S
Sbjct  547  QLSAMANRTVLVDNNTWNNSHIAQVGKAFASTEEDAYIQMKALDVDYVLVIFGGLTGYSS  606

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGG   P+IKE DYL +GQYRID  A+PTMLNSLMYKLSYYRF  V TD
Sbjct  607  DDINKFLWMVRIGGSCDPNIKEQDYLTNGQYRIDKGASPTMLNSLMYKLSYYRFSEVHTD  666

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
              +  GFDRVR  EIG K F LT+ EE FT+ HW+VR+YK+K   NR
Sbjct  667  YQRPTGFDRVRNVEIGNKNFDLTYLEEAFTSVHWLVRVYKVKDFDNR  713



>ref|XP_002956920.1| hypothetical protein VOLCADRAFT_83836 [Volvox carteri f. nagariensis]
 gb|EFJ42045.1| hypothetical protein VOLCADRAFT_83836 [Volvox carteri f. nagariensis]
Length=738

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AM+S E  A+ I + LDV Y LV+FGG+ GY S
Sbjct  571  QITAMGNRTVIVDNNTWNNTHIATVGRAMASNETEAYKIMRQLDVDYALVIFGGMSGYSS  630

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF----VE  482
            DDINKFLWMVRIGGGVFP IKE DYL +G Y + S+ T TMLNSLMYKLSYY F     E
Sbjct  631  DDINKFLWMVRIGGGVFPVIKESDYLANGDYTVSSRGTQTMLNSLMYKLSYYDFGNIMTE  690

Query  481  TDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
               G G+DRVR  EIG K  KL H  E FT+ HW+VRIY++K  +NR
Sbjct  691  QGKGTGYDRVRNYEIGNKDVKLDHLYEAFTSEHWIVRIYRVKDLENR  737



>gb|EFA77669.1| oligosaccharyl transferase [Polysphondylium pallidum PN500]
Length=703

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AMANRTV+VDNNTWNN+HIA VG A +S E+ A+ + + LDV YVLV+FGGL GY S
Sbjct  536  QLSAMANRTVLVDNNTWNNSHIAQVGKAFASSEEDAYKLMKELDVDYVLVIFGGLTGYSS  595

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGG   P IKE DYL +G YRID  A+P MLN+LMYKL YYRF E  TD
Sbjct  596  DDINKFLWMVRIGGSTDPSIKEADYLANGHYRIDKGASPKMLNTLMYKLCYYRFSEINTD  655

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  G+DRVR  EIG K F+LT+ EE FT+ HW+VR+YK+K  +NR
Sbjct  656  YGKPSGYDRVRNVEIGYKNFQLTYLEEAFTSLHWLVRVYKVKDLENR  702



>ref|XP_001690442.1| oligsaccharyl transferase STT3 subunit [Chlamydomonas reinhardtii]
 gb|EDP05701.1| oligsaccharyl transferase STT3 subunit [Chlamydomonas reinhardtii]
Length=716

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 127/168 (76%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AM+S E  A+ I + LDV Y LV+FGG+ GY S
Sbjct  548  QITAMGNRTVIVDNNTWNNTHIATVGRAMASNETEAYKIMRQLDVDYALVIFGGMSGYSS  607

Query  649  DDINKFLWMVRIGGGVFP-HIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF----V  485
            DDINKFLWMVRIGGGV+P HIKE +YL +G Y +  + TPTMLNSLMYK+SYY F     
Sbjct  608  DDINKFLWMVRIGGGVYPDHIKEANYLNNGDYTVSERGTPTMLNSLMYKMSYYDFGNIMT  667

Query  484  ETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
            E + G G+DRVR  EIG+K   L H +E FT+ HW+VRIYK+K  +NR
Sbjct  668  EHNKGTGYDRVRGYEIGQKDISLDHLDEAFTSEHWIVRIYKVKDLENR  715



>ref|XP_001439477.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72080.1| unnamed protein product [Paramecium tetraurelia]
Length=745

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T M+NRTV+VDNNTWNNTHIATVG AM+S E+ A++I + LDV YVLV+FGG++ Y  
Sbjct  536  QITGMSNRTVLVDNNTWNNTHIATVGMAMASSEEDAFEICEKLDVDYVLVIFGGILNYSG  595

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGGGV+PHIKE DY   G YR+D  AT TM NSLMY+LSYYRF  V+T 
Sbjct  596  DDINKFLWMVRIGGGVYPHIKEEDYYGKGTYRVDQYATETMTNSLMYRLSYYRFDEVQTA  655

Query  475  GG--KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             G  KG+D VR+  IG K +KL HFEE FT+ +W+VRI+K K  +NR
Sbjct  656  YGQPKGYDTVRQAVIGVKGYKLRHFEEAFTSENWIVRIFKRKQRENR  702



>dbj|GAM28549.1| hypothetical protein SAMD00019534_117250 [Acytostelium subglobosum 
LB1]
Length=698

 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AMANRTV+VDNNTWNN+HIA VG A +SPE+ A+ I + LDV YVLV+FGGL GY S
Sbjct  531  QLSAMANRTVLVDNNTWNNSHIAQVGKAFASPEEDAYKIMKDLDVDYVLVIFGGLTGYSS  590

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGG   P I E DYL +G YRID+  +P ML +LMYKL YYRF  V TD
Sbjct  591  DDINKFLWMVRIGGSTDPSIIESDYLANGHYRIDAGGSPKMLQTLMYKLCYYRFSEVHTD  650

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  GFDRVR  EIG K F+L + EE FT+ HW+VR+YK+K  +NR
Sbjct  651  YGKPPGFDRVRNVEIGNKNFQLNYLEEAFTSVHWLVRVYKVKDFENR  697



>ref|XP_008813461.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Phoenix dactylifera]
Length=725

 Score =   193 bits (491),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 124/165 (75%), Gaps = 7/165 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I QSLDV YVLVVFGG+ GY S
Sbjct  565  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMQSLDVDYVLVVFGGVTGYSS  624

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKL YYRF E  T+
Sbjct  625  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLCYYRFGELTTE  684

Query  475  GGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK        E G  +      EE FTT +W+VRIYK+KPPKNR
Sbjct  685  YGKP-TGCTGQEFGTDL----ELEEAFTTSNWIVRIYKVKPPKNR  724



>ref|XP_001016052.1| Oligosaccharyl transferase STT3 subunit family protein [Tetrahymena 
thermophila]
 gb|EAR95807.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A [Tetrahymena thermophila SB210]
Length=793

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T M+NRTV+VDNNTWNNTHIATV  A++S E  A+++   LDV Y+L++FGG   +  
Sbjct  578  QITGMSNRTVMVDNNTWNNTHIATVAMALASSESDAYEVCDKLDVDYILMIFGGYSYFSG  637

Query  649  DDINKFLWMVRIGGGVFPHIKEPD-YLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDG  473
            DDINKFLWMVRI GGV+PH+KE D Y ++ QYRIDSQA+ TMLNSLM++LS+YRF E   
Sbjct  638  DDINKFLWMVRIAGGVYPHVKEEDFYSKNNQYRIDSQASETMLNSLMFRLSFYRFDEIQT  697

Query  472  G----KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
                 KG+D VR  E+G K FKL +FEE FT+ +W+VRIY+ KP KNR
Sbjct  698  AYQKPKGWDNVRNQEVGLKKFKLEYFEEAFTSENWIVRIYRRKPRKNR  745



>gb|ADB65765.1| oligosaccharyl transferase [Dunaliella salina]
Length=726

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 127/168 (76%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QT+AM+NRTV+VDNNTWNNTHIATVG AMSS E   W I++SLDV YVLVVFGG VGYPS
Sbjct  544  QTSAMSNRTVLVDNNTWNNTHIATVGRAMSSSEYKGWKIYRSLDVDYVLVVFGGAVGYPS  603

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDG-QYRIDSQATPTMLNSLMYKLSYYRFVE---  482
            DDINKFLWMVRIGGGV+P I E DYL  G  YR+D+  T TM +SLMY+L Y+ F +   
Sbjct  604  DDINKFLWMVRIGGGVYPDIVESDYLAGGTDYRVDAAGTKTMHSSLMYRLCYHEFADESQ  663

Query  481  -TDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             + G +G DRVR T IGK   KL +FEE FT+ HWM+RIY+++    R
Sbjct  664  MSSGQRGLDRVRGTVIGKTNIKLQYFEEAFTSQHWMMRIYRVRDAPVR  711



>ref|XP_003286566.1| STT3 subunit of oligosaccharyl transferase [Dictyostelium purpureum]
 gb|EGC36923.1| STT3 subunit of oligosaccharyl transferase [Dictyostelium purpureum]
Length=706

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AMANRT++VDNNTWNN+HIA VG A +S E+ A+   ++LDV YVLV+FGGL GY S
Sbjct  539  QLSAMANRTILVDNNTWNNSHIAQVGKAFASSEEDAYYQMKALDVDYVLVIFGGLTGYSS  598

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGG   P +KE DYL D QYRID  A+PTMLNSL+YKLSYYRF  V TD
Sbjct  599  DDINKFLWMVRIGGSCDPTLKEEDYLTDKQYRIDKGASPTMLNSLIYKLSYYRFSEVHTD  658

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
              +  GFDRVR  EIG K F LT+ EE FT+ HW+VR+Y++K  +NR
Sbjct  659  YQRPAGFDRVRGVEIGYKGFDLTYLEEAFTSVHWLVRVYRVKDFENR  705



>ref|XP_002668944.1| predicted protein [Naegleria gruberi]
 gb|EFC36200.1| predicted protein [Naegleria gruberi]
Length=711

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTV+VDNNTWNNTHIATVG AM+S E  A+ I + LDV YVLV+FGG+ GY S
Sbjct  543  QLTAMANRTVLVDNNTWNNTHIATVGRAMASNEAKAYKIMRGLDVDYVLVIFGGVTGYAS  602

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRD-GQYRIDSQATPTMLNSLMYKLSYYRF----V  485
            DDINKFLWMVRIGG  +  IKE DYL   G+YRID+  + TMLNSLMYKLSYY+F     
Sbjct  603  DDINKFLWMVRIGGSCYSEIKEADYLSPRGEYRIDAGGSQTMLNSLMYKLSYYKFGEMTT  662

Query  484  ETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
            E     GFDRVR+ EIG K F+L H EE FT+ H++VRI+K+K   NR
Sbjct  663  EYQRPPGFDRVRQVEIGNKQFELEHMEEAFTSEHYIVRIFKVKKESNR  710



>dbj|GAM26838.1| hypothetical protein SAMD00019534_100130, partial [Acytostelium 
subglobosum LB1]
Length=713

 Score =   190 bits (483),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 126/167 (75%), Gaps = 4/167 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AM+NRT +VDNNTWNN+HIA VG A +S E+ A+ I + LDV YVLV+FGGL GY S
Sbjct  546  QLSAMSNRTTLVDNNTWNNSHIALVGKAFASTEEDAYKIMRELDVDYVLVLFGGLTGYSS  605

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDINKFLWMVRIGG     I E DYL +G YRIDS A+P MLN+LMYKL YYRF  V TD
Sbjct  606  DDINKFLWMVRIGGSTDKSIVESDYLANGHYRIDSGASPKMLNTLMYKLCYYRFSEVHTD  665

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             GK  GFDRVR  EIG K F+L + EE FT+ HW+VR+YK+K  +NR
Sbjct  666  YGKPSGFDRVRNVEIGNKNFQLKYLEEAFTSLHWLVRVYKVKDLENR  712



>dbj|BAM19801.1| oligosaccharyl transferase [Papilio xuthus]
Length=168

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 125/166 (75%), Gaps = 7/166 (4%)
 Frame = -3

Query  817  MANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPSDDIN  638
            MANRTVIVDNNTWNNTHI+ VG AM+S E+ A+DI + LDV YVLV+FGGLVGY SDDIN
Sbjct  1    MANRTVIVDNNTWNNTHISRVGQAMASSEERAYDIMRELDVDYVLVIFGGLVGYSSDDIN  60

Query  637  KFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--VETDG  473
            KFLWMVRIGG      HI+E DY    G++R+D+   PT+LN LMYK+SYY+F  V T+G
Sbjct  61   KFLWMVRIGGSTERGAHIREADYYTPAGEFRVDADGAPTLLNCLMYKMSYYKFGLVYTEG  120

Query  472  GK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
            G+  GFDRVR  EIG K F     EE +TT HW+VRIYK+KP  NR
Sbjct  121  GRPPGFDRVRGAEIGNKDFNPDVLEEAYTTEHWLVRIYKVKPLPNR  166



>ref|XP_004353930.1| integral membrane protein 1 isoform 5, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR24259.1| integral membrane protein 1 isoform 5, putative [Acanthamoeba 
castellanii str. Neff]
Length=718

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q +AMANRTVIVDNNTWNN+HIA VG AMS+ E  A+D+ Q LDV YVLV+FGGL GY S
Sbjct  550  QLSAMANRTVIVDNNTWNNSHIAQVGKAMSAYEDVAYDVMQKLDVNYVLVIFGGLTGYSS  609

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--VET  479
            DDINKFLWMVRIGG   P IKE DY  +D ++ ID   +  MLN LMYKL YYRF  V T
Sbjct  610  DDINKFLWMVRIGGSTDPSIKEEDYYSKDKRFTIDRHGSDKMLNCLMYKLCYYRFGQVYT  669

Query  478  DGG--KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
            + G  +G+DRVR  EIG K F+L H EE +TT HW+VRIYK+ PP NR
Sbjct  670  EQGQPQGYDRVRNVEIGNKNFELEHLEEAYTTQHWLVRIYKVLPPMNR  717



>ref|XP_001897932.1| ITM1 protein [Brugia malayi]
 emb|CDP94203.1| Protein Bm9516, isoform a [Brugia malayi]
Length=673

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AMSS E+ A++I + LDV YVLV+FGG++GY S
Sbjct  501  QITAMANRTVIVDNNTWNNTHISRVGQAMSSKEEDAYEIMRELDVDYVLVIFGGVIGYSS  560

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY  + G++R+D + +PTMLN LMYKL YYRF  +
Sbjct  561  DDINKFLWMVRIGGSTPEGTHIKEMDYFSKSGEFRVDREGSPTMLNCLMYKLCYYRFGGL  620

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T  G+  GFDRVR  EIG K F+L   EE +TT HW+VRIYK+KP  NR
Sbjct  621  YTQHGQVTGFDRVRHAEIGNKDFELDFLEEAYTTEHWIVRIYKVKPLDNR  670



>emb|CDP94204.1| Protein Bm9516, isoform b [Brugia malayi]
Length=706

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 130/171 (76%), Gaps = 9/171 (5%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AMSS E+ A++I + LDV YVLV+FGG++GY S
Sbjct  534  QITAMANRTVIVDNNTWNNTHISRVGQAMSSKEEDAYEIMRELDVDYVLVIFGGVIGYSS  593

Query  649  DDINKFLWMVRIGGGVFP---HIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--  488
            DDINKFLWMVRIGG   P   HIKE DY  + G++R+D + +PTMLN LMYKL YYRF  
Sbjct  594  DDINKFLWMVRIGGST-PEGTHIKEMDYFSKSGEFRVDREGSPTMLNCLMYKLCYYRFGG  652

Query  487  VETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
            + T  G+  GFDRVR  EIG K F+L   EE +TT HW+VRIYK+KP  NR
Sbjct  653  LYTQHGQVTGFDRVRHAEIGNKDFELDFLEEAYTTEHWIVRIYKVKPLDNR  703



>gb|EJW83386.1| hypothetical protein WUBG_05703, partial [Wuchereria bancrofti]
Length=778

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AMSS E+ A++I + LDV YVLV+FGG++GY S
Sbjct  606  QITAMANRTVIVDNNTWNNTHISRVGQAMSSKEEDAYEIMRELDVDYVLVIFGGVIGYSS  665

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY  + G++R+D + +PTMLN LMYKL YYRF  +
Sbjct  666  DDINKFLWMVRIGGSTPEGAHIKEMDYFSKSGEFRVDREGSPTMLNCLMYKLCYYRFGGL  725

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T  G+  GFDRVR  EIG K F+L   EE +TT HW+VRIYK+KP  NR
Sbjct  726  YTQHGQVTGFDRVRHAEIGNKDFELDFLEEAYTTEHWIVRIYKVKPLDNR  775



>ref|XP_003144530.1| ITM1 protein [Loa loa]
Length=565

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AMS  E+ A++I + LDV YVLV+FGG++GY S
Sbjct  393  QITAMANRTVIVDNNTWNNTHISRVGQAMSLKEEDAYEIMRELDVNYVLVIFGGVIGYSS  452

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY  + G++R+D + +PTMLN +MYKL YYRF  +
Sbjct  453  DDINKFLWMVRIGGSTPEGAHIKEMDYFSKSGEFRVDREGSPTMLNCMMYKLCYYRFGGL  512

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T  G+  GFDRVR  EIG K F+L + EE +TT HW+VRIYK+KP  NR
Sbjct  513  YTQHGQVTGFDRVRHAEIGNKDFELDYLEEAYTTEHWIVRIYKVKPLDNR  562



>ref|XP_004991063.1| oligosaccharyl transferase [Salpingoeca rosetta]
 gb|EGD76691.1| oligosaccharyl transferase [Salpingoeca rosetta]
Length=730

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMA+RTVIVDNNTWNNTHI+ VG AM+SPE  A++I + LDV YVLV+FGGL G+ S
Sbjct  559  QITAMADRTVIVDNNTWNNTHISRVGQAMASPEDHAYEIMRELDVDYVLVLFGGLTGFAS  618

Query  649  DDINKFLWMVRIGGGVFP--HIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG   P  HIKE DY    G++RIDS  + TMLN LMYK+ YYRF  V
Sbjct  619  DDINKFLWMVRIGGSTPPGAHIKEADYFTPSGEFRIDSSGSQTMLNCLMYKMCYYRFGEV  678

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+ GK  G+DRVR+ EIG K F+L   EE FTT HW+VRIYK+K   NR
Sbjct  679  HTEPGKPSGWDRVRQAEIGNKDFQLDVLEEAFTTEHWLVRIYKVKDLPNR  728



>gb|KJB73166.1| hypothetical protein B456_011G219600 [Gossypium raimondii]
Length=700

 Score =   187 bits (476),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 118/163 (72%), Gaps = 16/163 (10%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A +I +SLDV YVLVVFGG+ GY S
Sbjct  553  QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAIEIIRSLDVDYVLVVFGGVTGYSS  612

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDGG  470
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN L+Y             
Sbjct  613  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLIY-------------  659

Query  469  KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
               DR R  EIG K  KL H EE FTT +W+VRIY++KPP NR
Sbjct  660  ---DRARGVEIGNKDVKLEHLEEAFTTSNWIVRIYRVKPPNNR  699



>ref|XP_004037041.1| hypothetical protein IMG5_062800 [Ichthyophthirius multifiliis]
 gb|EGR33055.1| hypothetical protein IMG5_062800 [Ichthyophthirius multifiliis]
Length=762

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T M+NRTV+VDNNTWNNTHIATV  A++S E  A+++   LDV Y+L++FGG   +  
Sbjct  549  QITGMSNRTVLVDNNTWNNTHIATVAMALASSESDAYEVCDKLDVDYILMIFGGFSYFSG  608

Query  649  DDINKFLWMVRIGGGVFPHIKEPD-YLRDGQYRIDSQATPTMLNSLMYKLSYYRFVETDG  473
            DDINKFLWMVRI GGV+PH+KE D Y + GQY+ID QA+ TM NSLMY+LSYYRF E   
Sbjct  609  DDINKFLWMVRIAGGVYPHVKEEDFYGKGGQYKIDGQASITMQNSLMYRLSYYRFNEILT  668

Query  472  G----KGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
                 KG+D VR  E+G K FKL +FEE FT+ +W+VRIY+ KP KNR
Sbjct  669  AIGKPKGWDTVRNQEMGLKNFKLDYFEEAFTSENWIVRIYRRKPRKNR  716



>ref|XP_009059058.1| hypothetical protein LOTGIDRAFT_164315 [Lottia gigantea]
 gb|ESO90389.1| hypothetical protein LOTGIDRAFT_164315 [Lottia gigantea]
Length=695

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TA+ANRTV+VDNNTWNNTHI+ VG AM+SPE  A++I + LDV YVLV+FGGL GY S
Sbjct  524  QITAIANRTVLVDNNTWNNTHISRVGQAMASPEDKAYEIMRELDVDYVLVIFGGLTGYSS  583

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++R+D   +P +LN LMYK+ YYRF  V
Sbjct  584  DDINKFLWMVRIGGSTDRGAHIKESDYFTPQGEFRVDKDGSPILLNCLMYKMCYYRFGSV  643

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR TEIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  644  YTEGGKPTGYDRVRNTEIGNKDFELEVLEEAYTTEHWLVRIYKVKDLENR  693



>ref|XP_002423620.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, putative [Pediculus humanus corporis]
 gb|EEB10882.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, putative [Pediculus humanus corporis]
Length=623

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  452  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMKELDVDYVLVIFGGLTGYSS  511

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY  + G++RID + +PT+LN LMYK+ YY+F  V
Sbjct  512  DDINKFLWMVRIGGSTDRGSHIREADYYSQSGEFRIDKEGSPTLLNCLMYKMCYYKFGQV  571

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  572  FTEGGKPQGYDRVRSAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLQNR  621



>gb|EJD76555.1| dolichyl-diphosphooligosaccharide-protein glycosyltransferase 
subunit STT3A [Loa loa]
Length=704

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AMS  E+ A++I + LDV YVLV+FGG++GY S
Sbjct  532  QITAMANRTVIVDNNTWNNTHISRVGQAMSLKEEDAYEIMRELDVNYVLVIFGGVIGYSS  591

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY  + G++R+D + +PTMLN +MYKL YYRF  +
Sbjct  592  DDINKFLWMVRIGGSTPEGAHIKEMDYFSKSGEFRVDREGSPTMLNCMMYKLCYYRFGGL  651

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T  G+  GFDRVR  EIG K F+L + EE +TT HW+VRIYK+KP  NR
Sbjct  652  YTQHGQVTGFDRVRHAEIGNKDFELDYLEEAYTTEHWIVRIYKVKPLDNR  701



>gb|ERG82441.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit stt3a [Ascaris suum]
Length=702

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AMSS E+ A++I + LDV YVLV+FGG+ GY S
Sbjct  530  QITAMANRTVIVDNNTWNNTHISRVGQAMSSKEEDAYEIMRELDVDYVLVIFGGVTGYSS  589

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY  + G++R+D + + TMLN LMYKL YYRF  +
Sbjct  590  DDINKFLWMVRIGGSTPEGAHIKEMDYFTKSGEFRVDREGSSTMLNCLMYKLCYYRFGGL  649

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T  G+  GFDRVR  EIG K F L + +E FT+ HW+VRIYK+KP  NR
Sbjct  650  YTQQGRPTGFDRVRHAEIGNKGFSLDYLDEAFTSEHWIVRIYKVKPQDNR  699



>ref|XP_011177440.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Bactrocera cucurbitae]
Length=715

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  544  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  603

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  V
Sbjct  604  DDINKFLWMVRIGGSTDRGAHIKERDYYAPNGEFRVDKEGSPTLLNCLMYKMCYYRFGQV  663

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  664  YTEGGKPPGYDRVRSAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLRNR  713



>ref|XP_004536915.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X3 [Ceratitis capitata]
Length=619

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  448  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  507

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D   +PT+LN LMYK+ YYRF  V
Sbjct  508  DDINKFLWMVRIGGSTDRGAHIKERDYYAPNGEFRVDKDGSPTLLNCLMYKMCYYRFGQV  567

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  568  YTEGGKPPGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLRNR  617



>ref|XP_011200722.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Bactrocera dorsalis]
 ref|XP_011200723.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Bactrocera dorsalis]
Length=715

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  544  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  603

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  V
Sbjct  604  DDINKFLWMVRIGGSTDRGAHIKERDYYAPNGEFRVDKEGSPTLLNCLMYKMCYYRFGQV  663

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  664  YTEGGKPPGYDRVRSAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLRNR  713



>ref|XP_001175790.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Strongylocentrotus purpuratus]
Length=710

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+SPE  A++I + LDV YVLV+FGGL+GY S
Sbjct  539  QITAMANRTILVDNNTWNNTHISRVGQAMASPEDHAYEIMRELDVDYVLVIFGGLIGYSS  598

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++RID   +PT+LN LMYK+ YYRF  V
Sbjct  599  DDINKFLWMVRIGGSTEEGKHIKESDYYTPHGEFRIDRDGSPTLLNCLMYKMCYYRFGRV  658

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+ GK  G+DRVR TEIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  659  YTEAGKPTGYDRVRNTEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLENR  708



>ref|XP_003747558.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform 3 [Metaseiulus occidentalis]
Length=717

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + +DV YVLV+FGGL GY S
Sbjct  545  QITAMANRTILVDNNTWNNTHISRVGQAMASDEHTAYEIMREMDVDYVLVIFGGLSGYSS  604

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++R+D + +PT+LN LMYKL YYRF  V
Sbjct  605  DDINKFLWMVRIGGSTEKGKHIKEHDYYTPSGEFRVDKEGSPTLLNCLMYKLCYYRFGDV  664

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+G K  G+DRVR  EIG K FKL   EE +TT HW+VRIYK+K P NR
Sbjct  665  YTEGDKPAGYDRVRNAEIGNKQFKLDVLEEAYTTEHWLVRIYKVKDPPNR  714



>ref|XP_667452.1| oligosaccharyl transferase stt3 protein [Cryptosporidium hominis 
TU502]
Length=722

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T + +RTVIVDNNTWNNTHIATVG A++SPE  A+ I + LDV YV VVFGG   Y S
Sbjct  558  QCTELGDRTVIVDNNTWNNTHIATVGLALASPEDEAYKIIEKLDVDYVFVVFGGFAKYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRD-GQYRIDSQATPTMLNSLMYKLSYYRFVETDG  473
            DDINKFLWMVRI  G++PHI++ DYL D G Y +   A+  MLNSL+YKLSYYRF +   
Sbjct  618  DDINKFLWMVRIASGIYPHIQQNDYLSDSGHYTVGKDASNAMLNSLIYKLSYYRFSDLQ-  676

Query  472  GKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
              GFD VR   IGK  F LTHFEE +TT +W++RIYK+K   NR
Sbjct  677  KDGFDLVRNYHIGKTQFSLTHFEEAYTTDNWVIRIYKVKKQSNR  720



>ref|XP_003747556.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform 1 [Metaseiulus occidentalis]
Length=716

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + +DV YVLV+FGGL GY S
Sbjct  544  QITAMANRTILVDNNTWNNTHISRVGQAMASDEHTAYEIMREMDVDYVLVIFGGLSGYSS  603

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++R+D + +PT+LN LMYKL YYRF  V
Sbjct  604  DDINKFLWMVRIGGSTEKGKHIKEHDYYTPSGEFRVDKEGSPTLLNCLMYKLCYYRFGDV  663

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+G K  G+DRVR  EIG K FKL   EE +TT HW+VRIYK+K P NR
Sbjct  664  YTEGDKPAGYDRVRNAEIGNKQFKLDVLEEAYTTEHWLVRIYKVKDPPNR  713



>ref|XP_627564.1| oligosaccharyl transferase STT3 protein [Cryptosporidium parvum 
Iowa II]
 emb|CAD98493.1| oligosaccharyl transferase stt3 protein, probable [Cryptosporidium 
parvum]
 gb|EAK89828.1| oligosaccharyl transferase STT3 protein [Cryptosporidium parvum 
Iowa II]
Length=722

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 119/164 (73%), Gaps = 2/164 (1%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T + +RTVIVDNNTWNNTHIATVG A++SPE  A+ I + LDV YV VVFGG   Y S
Sbjct  558  QCTELGDRTVIVDNNTWNNTHIATVGLALASPEDEAYKIIEKLDVDYVFVVFGGFAKYSS  617

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRD-GQYRIDSQATPTMLNSLMYKLSYYRFVETDG  473
            DDINKFLWMVRI  G++PHI++ DYL D G Y +   A+  MLNSL+YKLSYYRF +   
Sbjct  618  DDINKFLWMVRIASGIYPHIQQNDYLSDSGHYTVGKDASNAMLNSLIYKLSYYRFSDLQ-  676

Query  472  GKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
              GFD VR   IGK  F LTHFEE +TT +W++RIYK+K   NR
Sbjct  677  KDGFDLVRNYHIGKTQFSLTHFEEAYTTDNWVIRIYKVKKQSNR  720



>ref|XP_004536913.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X1 [Ceratitis capitata]
 ref|XP_004536914.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform X2 [Ceratitis capitata]
Length=715

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  544  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  603

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D   +PT+LN LMYK+ YYRF  V
Sbjct  604  DDINKFLWMVRIGGSTDRGAHIKERDYYAPNGEFRVDKDGSPTLLNCLMYKMCYYRFGQV  663

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K  +NR
Sbjct  664  YTEGGKPPGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLRNR  713



>ref|XP_003747557.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like isoform 2 [Metaseiulus occidentalis]
Length=727

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + +DV YVLV+FGGL GY S
Sbjct  555  QITAMANRTILVDNNTWNNTHISRVGQAMASDEHTAYEIMREMDVDYVLVIFGGLSGYSS  614

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++R+D + +PT+LN LMYKL YYRF  V
Sbjct  615  DDINKFLWMVRIGGSTEKGKHIKEHDYYTPSGEFRVDKEGSPTLLNCLMYKLCYYRFGDV  674

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+G K  G+DRVR  EIG K FKL   EE +TT HW+VRIYK+K P NR
Sbjct  675  YTEGDKPAGYDRVRNAEIGNKQFKLDVLEEAYTTEHWLVRIYKVKDPPNR  724



>gb|KFB38788.1| AGAP000434-PA-like protein [Anopheles sinensis]
Length=713

 Score =   185 bits (470),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  542  QITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMKELDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY  + G +RID + +PT+LN LMYK+ YYRF  V
Sbjct  602  DDINKFLWMVRIGGSTDRGAHIKEVDYYAQSGDFRIDKEGSPTLLNCLMYKMCYYRFGQV  661

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  662  YTEGGKAPGYDRVRGAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLSNR  711



>ref|XP_001991867.1| GH12900 [Drosophila grimshawi]
 gb|EDW00492.1| GH12900 [Drosophila grimshawi]
Length=719

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  548  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  607

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  608  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  667

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR +EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  668  YTEGGKAQGYDRVRASEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  717



>ref|XP_005185991.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Musca domestica]
Length=715

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  544  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  603

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  V
Sbjct  604  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQV  663

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIY++K   NR
Sbjct  664  YTEGGKPPGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYRVKDLSNR  713



>ref|XP_011201044.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like [Bactrocera dorsalis]
Length=223

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 120/166 (72%), Gaps = 6/166 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q   MANRT +VDNNTWNN+HIA VG AMSS E+ +++I  SLDV YVLV+FGG++GY  
Sbjct  9    QIAGMANRTTLVDNNTWNNSHIALVGKAMSSTEEKSYEIMTSLDVDYVLVIFGGVIGYSG  68

Query  649  DDINKFLWMVRIGGGVFPH-IKEPDYLRD-GQYRIDSQATPTMLNSLMYKLSYYRFVETD  476
            DDINKFLWMVRI  G  P  IKE DY  D G++RIDS+  P +LN LMYKLSYYRF E  
Sbjct  69   DDINKFLWMVRIAEGEHPKDIKESDYFTDRGEFRIDSEGAPALLNCLMYKLSYYRFGELK  128

Query  475  ----GGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPP  350
                G  G+DR R   IG K F+LT+ EE +TT HW+VRIY++K P
Sbjct  129  LDYRGPAGYDRTRNAIIGNKDFELTYLEEAYTTEHWLVRIYRVKKP  174



>emb|CDW81938.1| dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit stt3a [Stylonychia lemnae]
Length=980

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 120/166 (72%), Gaps = 4/166 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T M NRTV+VDNNTWNNTHIATVG  M S E+ A+ + + LD  YVLV+FGG+  Y  
Sbjct  601  QITGMGNRTVLVDNNTWNNTHIATVGRTMGSEEEEAYKLARYLDANYVLVIFGGVSYYSG  660

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDI+KFLWM+RIG GVFP IKE +Y  +G YRID++A+PTM N LMYKL YYRF  V T 
Sbjct  661  DDISKFLWMIRIGAGVFPQIKENNYYSNGVYRIDAEASPTMKNCLMYKLCYYRFDEVTTQ  720

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKN  344
             GK  G+D VR  EIG K FKL HF E +T+  W+VRIY++ P  N
Sbjct  721  QGKPTGYDTVRNAEIGHKGFKLKHFREAYTSERWIVRIYEVMPLAN  766



>gb|EHJ63188.1| oligosaccharyl transferase [Danaus plexippus]
Length=697

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGLVGY S
Sbjct  526  QITAMANRTVIVDNNTWNNTHISRVGQAMASSEEHAYEIMRELDVDYVLVIFGGLVGYSS  585

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLRD-GQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++R+D+   P +LN LMYK+SYY+F  V
Sbjct  586  DDINKFLWMVRIGGSTDRGAHIKEADYYTGAGEFRVDAHGAPALLNCLMYKMSYYKFGLV  645

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GG+  G+DRVR  EIG K F L   EE +TT HW+VR+YK+KP  NR
Sbjct  646  YTEGGRPPGYDRVRGAEIGNKDFNLDVLEEAYTTEHWLVRVYKVKPLPNR  695



>gb|EKC29997.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Crassostrea gigas]
Length=684

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + LDV YVLV+FGGL GY S
Sbjct  513  QITAMANRTILVDNNTWNNTHISRVGQAMASTEDKAYEIMRELDVNYVLVIFGGLTGYSS  572

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++RID + +PT+LN LMYK+ YYRF  V
Sbjct  573  DDINKFLWMVRIGGSTDRGAHIKEADYYTPQGEFRIDKEGSPTLLNCLMYKMCYYRFGEV  632

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F L   EE +TT HW+VRIYK+K   NR
Sbjct  633  YTEGGKPTGYDRVRNAEIGNKNFDLDVLEEAYTTEHWLVRIYKVKDLDNR  682



>ref|XP_002071638.1| GK10089 [Drosophila willistoni]
 gb|EDW82624.1| GK10089 [Drosophila willistoni]
Length=709

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  538  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  597

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  598  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  657

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  658  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  707



>ref|XP_009014673.1| hypothetical protein HELRODRAFT_98643 [Helobdella robusta]
 gb|ESO07295.1| hypothetical protein HELRODRAFT_98643 [Helobdella robusta]
Length=693

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AMSS E+ A++I + LDV YVLV+FGGL GY S
Sbjct  522  QITAMANRTILVDNNTWNNTHISRVGQAMSSTEEKAYEIMRELDVSYVLVIFGGLTGYSS  581

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++R+D + +PT+LN LMYK+ YYRF  V
Sbjct  582  DDINKFLWMVRIGGSTDRGAHIKETDYYTPQGEFRVDKEGSPTLLNCLMYKMCYYRFGSV  641

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+ GK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  642  YTESGKPTGYDRVRNVEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLSNR  691



>ref|XP_001648748.1| AAEL004228-PA [Aedes aegypti]
 gb|EAT44394.1| AAEL004228-PA [Aedes aegypti]
Length=710

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + LDV YVLV+FGGL GY S
Sbjct  539  QITAMANRTILVDNNTWNNTHISRVGQAMASTEDKAYEIMKELDVDYVLVIFGGLTGYSS  598

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G +RID + +PT+LN LMYK+ YYRF  V
Sbjct  599  DDINKFLWMVRIGGSTDRGAHIKETDYYASSGDFRIDKEGSPTLLNCLMYKMCYYRFGQV  658

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  659  YTEGGKAPGYDRVRGAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLSNR  708



>ref|XP_001865872.1| oligosaccharyl transferase [Culex quinquefasciatus]
 gb|EDS42369.1| oligosaccharyl transferase [Culex quinquefasciatus]
Length=715

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + LDV YVLV+FGGL GY S
Sbjct  544  QITAMANRTILVDNNTWNNTHISRVGQAMASTEDKAYEIMKELDVDYVLVIFGGLTGYSS  603

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G +RID + +PT+LN LMYK+ YYRF  V
Sbjct  604  DDINKFLWMVRIGGSTDRGAHIKETDYYASSGDFRIDKEGSPTLLNCLMYKMCYYRFGQV  663

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  664  YTEGGKAPGYDRVRGAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLSNR  713



>ref|XP_002055439.1| GJ18789 [Drosophila virilis]
 gb|EDW65640.1| GJ18789 [Drosophila virilis]
Length=719

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  548  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  607

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  608  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  667

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  668  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  717



>ref|XP_002011908.1| GI14454 [Drosophila mojavensis]
 gb|EDW08029.1| GI14454 [Drosophila mojavensis]
Length=719

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  548  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  607

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  608  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  667

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  668  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  717



>ref|XP_011434154.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Crassostrea gigas]
Length=710

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + LDV YVLV+FGGL GY S
Sbjct  539  QITAMANRTILVDNNTWNNTHISRVGQAMASTEDKAYEIMRELDVNYVLVIFGGLTGYSS  598

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++RID + +PT+LN LMYK+ YYRF  V
Sbjct  599  DDINKFLWMVRIGGSTDRGAHIKEADYYTPQGEFRIDKEGSPTLLNCLMYKMCYYRFGEV  658

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F L   EE +TT HW+VRIYK+K   NR
Sbjct  659  YTEGGKPTGYDRVRNAEIGNKNFDLDVLEEAYTTEHWLVRIYKVKDLDNR  708



>ref|XP_002023018.1| GL16584 [Drosophila persimilis]
 gb|EDW27123.1| GL16584 [Drosophila persimilis]
Length=672

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  501  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  560

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  561  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  620

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  621  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  670



>ref|XP_004923047.1| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A-like [Bombyx mori]
Length=707

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRTVIVDNNTWNNTHI+ VG AM+S E  A++I + LDV YVLV+FGGLVGY S
Sbjct  536  QITAMANRTVIVDNNTWNNTHISRVGQAMASTEDKAYEIMRELDVDYVLVIFGGLVGYSS  595

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E  Y    G++R+DS   P +LN LMYK+SYY+F  V
Sbjct  596  DDINKFLWMVRIGGSTERGAHIREAQYYTAAGEFRVDSAGAPALLNCLMYKMSYYKFGLV  655

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GG+  GFDRVR  EIG K F L   EE +TT HW+VRIYK+KP  NR
Sbjct  656  YTEGGRPPGFDRVRGAEIGNKDFNLDVLEEAYTTEHWLVRIYKVKPLPNR  705



>ref|XP_001695034.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02186.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=424

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 123/163 (75%), Gaps = 15/163 (9%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            QTTAMANRTVIVDNNTWN +HIATVG AMSSPE  AW I++SLDV+YV VVFGGLVGYPS
Sbjct  247  QTTAMANRTVIVDNNTWNTSHIATVGRAMSSPEAKAWQIYRSLDVEYVFVVFGGLVGYPS  306

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRFVE---  482
            DDINKFLWM          IKE DYL  DG YR+D+    TMLNSLMYKLSYY F +   
Sbjct  307  DDINKFLWM----------IKEKDYLTPDGDYRVDAAGAKTMLNSLMYKLSYYDFADESQ  356

Query  481  -TDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLK  356
             + G +G DRVR  +IG+   KL +FEEVFT+ HWM+RIY+++
Sbjct  357  LSTGQRGIDRVRGYQIGRLNVKLNYFEEVFTSQHWMMRIYRVR  399



>ref|XP_002134555.1| GA22298 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY73182.1| GA22298 [Drosophila pseudoobscura pseudoobscura]
Length=720

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  549  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  608

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  609  DDINKFLWMVRIGGSTDRGAHIKEKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  668

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  669  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  718



>gb|KFM62989.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A, partial [Stegodyphus mimosarum]
Length=475

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANR+++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  304  QITAMANRSILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVNYVLVIFGGLTGYSS  363

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G++RID + +P +LN LMYK+ YYRF  V
Sbjct  364  DDINKFLWMVRIGGSTERGKHIKENDYYTSSGEFRIDREGSPVLLNCLMYKMCYYRFGSV  423

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+ GK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  424  YTEAGKPPGYDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  473



>gb|EJY69225.1| Oligosaccharyl transferase STT3 subunit family protein [Oxytricha 
trifallax]
Length=797

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 119/163 (73%), Gaps = 4/163 (2%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q T M NRTV+VDNNTWNNTHIATVG  M S E+ A+ + + LD  YVLV+FGG+  Y  
Sbjct  604  QITGMGNRTVLVDNNTWNNTHIATVGRTMGSEEEEAYKLARYLDANYVLVIFGGVSYYSG  663

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRF--VETD  476
            DDI+KFLWM+RIG GVFP IKE +Y  +G YRIDS+A+PTM N LMYKL YYRF  V T 
Sbjct  664  DDISKFLWMIRIGAGVFPQIKENNYYNNGVYRIDSEASPTMKNCLMYKLCYYRFDEVTTT  723

Query  475  GGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKP  353
             GK  G+D VR  EIG K FKL HF E +T+  W+VRIY++ P
Sbjct  724  QGKPTGWDTVRNAEIGHKGFKLKHFREAYTSERWIVRIYEVMP  766



>ref|XP_002039599.1| GM22642 [Drosophila sechellia]
 gb|EDW56341.1| GM22642 [Drosophila sechellia]
Length=713

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  542  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  602  DDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  661

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  662  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  711



>ref|XP_002101953.1| GE15319 [Drosophila yakuba]
 gb|EDX03061.1| GE15319 [Drosophila yakuba]
Length=713

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  542  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  602  DDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  661

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  662  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  711



>ref|XP_001978657.1| GG17558 [Drosophila erecta]
 gb|EDV47584.1| GG17558 [Drosophila erecta]
Length=713

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  542  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  602  DDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  661

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  662  YTEGGKAQGYDRVRAAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLPNR  711



>gb|ETN61504.1| oligosaccharyl transferase [Anopheles darlingi]
Length=713

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  542  QITAMANRTILVDNNTWNNTHISRVGQAMASTEERAYEIMKELDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY    G +RID + +PT+LN LMYK+ YYRF  V
Sbjct  602  DDINKFLWMVRIGGSTDRGAHIREMDYYASSGDFRIDKEGSPTLLNCLMYKMCYYRFGQV  661

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  662  YTEGGKAPGYDRVRGAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLSNR  711



>gb|AAH15880.1| STT3B protein [Homo sapiens]
 gb|AIC61518.1| STT3B, partial [synthetic construct]
Length=225

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 118/169 (70%), Gaps = 6/169 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q   MANRT +VDNNTWNN+HIA VG AMSS E AA+ I ++LDV YVLV+FGG++GY  
Sbjct  9    QIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVIFGGVIGYSG  68

Query  649  DDINKFLWMVRIGGGVFPH-IKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRFVETD  476
            DDINKFLWMVRI  G  P  I+E DY    G++R+D   +PT+LN LMYK+SYYRF E  
Sbjct  69   DDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQ  128

Query  475  ----GGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
                   GFDR R  EIG K  K  H EE FT+ HW+VRIYK+K P NR
Sbjct  129  LDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNR  177



>ref|XP_002162870.2| PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3B-like, partial [Hydra vulgaris]
Length=603

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q   MANRT +VDNNTWNN+HIA VG AMSS E AA++I + LDV YVLV+FGG++GY  
Sbjct  382  QIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEIMRKLDVDYVLVIFGGVIGYSG  441

Query  649  DDINKFLWMVRIGGGVFPH-IKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF----  488
            DDINKFLWMVRI  G  P  I+E DY    G++R+D   +PT+LN LMYKL YYRF    
Sbjct  442  DDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKGGSPTLLNCLMYKLCYYRFGDLR  501

Query  487  VETDGGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNRI  338
            ++     G+DR R TEIG K FKLTH EE FT+ HW+VRIYK+KP ++R+
Sbjct  502  LDHRSPSGYDRTRNTEIGNKNFKLTHLEEAFTSEHWLVRIYKVKPLESRV  551



>ref|XP_006376693.1| hypothetical protein POPTR_0012s033201g, partial [Populus trichocarpa]
 gb|ERP54490.1| hypothetical protein POPTR_0012s033201g, partial [Populus trichocarpa]
Length=227

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 111/138 (80%), Gaps = 4/138 (3%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAM NRTVIVDNNTWNNTHIATVG AMSS E  A++I +SLDV YVLVVFGG+ GY S
Sbjct  88   QITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMKSLDVDYVLVVFGGVTGYSS  147

Query  649  DDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNSLMYKLSYYRFVE--TD  476
            DDINKFLWMVRIGGGVFP IKEPDYL +G+YR+D  A P MLN LMYKLSYYRF E  T+
Sbjct  148  DDINKFLWMVRIGGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELVTE  207

Query  475  GGK--GFDRVRRTEIGKK  428
             GK  G+DR R  EIG K
Sbjct  208  YGKPPGYDRARGVEIGNK  225



>gb|ACD81859.1| LD39332p [Drosophila melanogaster]
Length=721

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  550  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  609

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  610  DDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  669

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  670  YTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNR  719



>ref|NP_608425.1| CG1518, isoform A [Drosophila melanogaster]
 ref|NP_001259751.2| CG1518, isoform C [Drosophila melanogaster]
 gb|AAF50861.1| CG1518, isoform A [Drosophila melanogaster]
 gb|AGB95589.2| CG1518, isoform C [Drosophila melanogaster]
Length=713

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  542  QITAMANRTILVDNNTWNNTHISRVGQAMASSEEKAYEIMRELDVDYVLVIFGGLTGYSS  601

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HI+E DY   +G++R+D + +PT+LN LMYK+ YYRF  +
Sbjct  602  DDINKFLWMVRIGGSTDRGAHIREKDYYAANGEFRVDKEGSPTLLNCLMYKMCYYRFGQM  661

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  662  YTEGGKAQGYDRVRAAEIGNKDFELDVMEEAYTTEHWLVRIYKVKDLPNR  711



>gb|KDR18262.1| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 
subunit STT3A [Zootermopsis nevadensis]
Length=706

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E  A++I + LDV YVLV+FGGL GY S
Sbjct  535  QITAMANRTILVDNNTWNNTHISRVGQAMASTEDRAYEIMRELDVDYVLVIFGGLTGYSS  594

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY     ++R+D + +P +LN LMYK+ YYRF  V
Sbjct  595  DDINKFLWMVRIGGSTERGSHIKEYDYYSSSAEFRVDKEGSPALLNCLMYKMCYYRFGQV  654

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  GFDRVR  EIG K F+L   EE FT+ HW+VRIYK+K  +NR
Sbjct  655  YTEGGKPPGFDRVRNAEIGNKDFELDVLEEAFTSEHWLVRIYKVKDLRNR  704



>ref|XP_310665.3| AGAP000434-PA [Anopheles gambiae str. PEST]
 gb|EAA06273.4| AGAP000434-PA [Anopheles gambiae str. PEST]
Length=712

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q TAMANRT++VDNNTWNNTHI+ VG AM+S E+ A++I + LDV YVLV+FGGL GY S
Sbjct  541  QITAMANRTILVDNNTWNNTHISRVGQAMASTEEKAYEIMKELDVDYVLVIFGGLTGYSS  600

Query  649  DDINKFLWMVRIGGGV--FPHIKEPDYLR-DGQYRIDSQATPTMLNSLMYKLSYYRF--V  485
            DDINKFLWMVRIGG      HIKE DY    G +RID + +P +LN LMYK+ YYRF  V
Sbjct  601  DDINKFLWMVRIGGSTDRGAHIKEMDYYAPSGDFRIDKEGSPVLLNCLMYKMCYYRFGQV  660

Query  484  ETDGGK--GFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
             T+GGK  G+DRVR  EIG K F+L   EE +TT HW+VRIYK+K   NR
Sbjct  661  YTEGGKAPGYDRVRGAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLSNR  710



>gb|AAH13054.2| Stt3b protein, partial [Mus musculus]
Length=317

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 119/169 (70%), Gaps = 6/169 (4%)
 Frame = -3

Query  829  QTTAMANRTVIVDNNTWNNTHIATVGTAMSSPEKAAWDIFQSLDvkyvlvvfgglvgYPS  650
            Q   MANRT +VDNNTWNN+HIA VG AMSS E AA+ I +SLDV YVLV+FGG++GY  
Sbjct  101  QIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRSLDVDYVLVIFGGVIGYSG  160

Query  649  DDINKFLWMVRIGGGVFPH-IKEPDYL-RDGQYRIDSQATPTMLNSLMYKLSYYRFVETD  476
            DDINKFLWMVRI  G  P  I+E DY  + G++R+D   +PT+LN LMYK+SYYRF E  
Sbjct  161  DDINKFLWMVRIAEGEHPKDIREGDYFTQQGEFRVDKAGSPTLLNCLMYKMSYYRFGEMQ  220

Query  475  ----GGKGFDRVRRTEIGKKVFKLTHFEEVFTTHHWMVRIYKLKPPKNR  341
                   GFDR R  EIG K  K  H EE FT+ HW+VRIYK+K P NR
Sbjct  221  LDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNR  269



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520