BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4358

Length=969
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004231883.1|  PREDICTED: probable cadmium/zinc-transportin...    240   1e-68   Solanum lycopersicum
ref|XP_006339845.1|  PREDICTED: probable cadmium/zinc-transportin...    240   1e-68   Solanum tuberosum [potatoes]
ref|XP_002278549.1|  PREDICTED: probable cadmium/zinc-transportin...    226   1e-63   Vitis vinifera
ref|XP_011099314.1|  PREDICTED: probable cadmium/zinc-transportin...    222   5e-62   Sesamum indicum [beniseed]
ref|XP_002310116.2|  hypothetical protein POPTR_0007s104801g            217   8e-62   
emb|CDP02541.1|  unnamed protein product                                221   1e-61   Coffea canephora [robusta coffee]
ref|XP_010095321.1|  putative cadmium/zinc-transporting ATPase HMA1     219   6e-61   
gb|EYU44446.1|  hypothetical protein MIMGU_mgv1a001251mg                217   4e-60   Erythranthe guttata [common monkey flower]
ref|NP_001237439.1|  SOYCTA protein                                     206   1e-59   
ref|XP_011006989.1|  PREDICTED: probable cadmium/zinc-transportin...    214   2e-59   Populus euphratica
gb|AJA36488.1|  heavy metal transporter                                 199   8e-58   Prosopis juliflora [algorrobo]
ref|XP_004287993.1|  PREDICTED: probable cadmium/zinc-transportin...    210   9e-58   Fragaria vesca subsp. vesca
ref|XP_012079313.1|  PREDICTED: probable cadmium/zinc-transportin...    209   1e-57   Jatropha curcas
gb|ADB28919.1|  ATPase cadmium transporter                              197   2e-57   Zea mays subsp. mays [corn]
gb|EEC81219.1|  hypothetical protein OsI_24259                          209   2e-57   Oryza sativa Indica Group [Indian rice]
gb|KJB43825.1|  hypothetical protein B456_007G218200                    205   3e-57   Gossypium raimondii
gb|EEE66260.1|  hypothetical protein OsJ_22445                          208   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058417.1|  Os06g0690700                                       207   5e-57   
gb|KEH31492.1|  cadmium/zinc-transporting ATPase, putative              207   7e-57   Medicago truncatula
ref|XP_006466544.1|  PREDICTED: probable cadmium/zinc-transportin...    207   1e-56   Citrus sinensis [apfelsine]
emb|CAE45019.1|  putative P1B-type metal ATPase                         193   1e-56   Arabidopsis halleri subsp. halleri
ref|XP_009367661.1|  PREDICTED: probable cadmium/zinc-transportin...    206   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_008391510.1|  PREDICTED: LOW QUALITY PROTEIN: probable cad...    205   3e-56   
gb|KJB43826.1|  hypothetical protein B456_007G218200                    205   4e-56   Gossypium raimondii
ref|XP_006656409.1|  PREDICTED: probable cadmium/zinc-transportin...    205   4e-56   Oryza brachyantha
gb|KHN02627.1|  Putative cadmium/zinc-transporting ATPase HMA1, c...    205   4e-56   Glycine soja [wild soybean]
dbj|BAJ33604.1|  unnamed protein product                                201   4e-56   Eutrema halophilum
ref|XP_006425990.1|  hypothetical protein CICLE_v10024910mg             204   6e-56   Citrus clementina [clementine]
gb|KDO79066.1|  hypothetical protein CISIN_1g003598mg                   204   6e-56   Citrus sinensis [apfelsine]
ref|XP_009137459.1|  PREDICTED: probable cadmium/zinc-transportin...    204   6e-56   Brassica rapa
gb|KFK30352.1|  hypothetical protein AALP_AA7G250400                    204   7e-56   Arabis alpina [alpine rockcress]
gb|AAY34978.1|  chloroplast heavy metal P-type ATPase precursor         204   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195444.1|  putative cadmium/zinc-transporting ATPase HMA1        204   7e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69288.1|  BnaC01g01650D                                          204   7e-56   
ref|XP_009417706.1|  PREDICTED: probable cadmium/zinc-transportin...    204   8e-56   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75636.1|  BnaA01g00660D                                          204   9e-56   
ref|XP_004509102.1|  PREDICTED: probable cadmium/zinc-transportin...    204   9e-56   Cicer arietinum [garbanzo]
ref|XP_010271184.1|  PREDICTED: probable cadmium/zinc-transportin...    204   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010271194.1|  PREDICTED: probable cadmium/zinc-transportin...    204   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009798582.1|  PREDICTED: LOW QUALITY PROTEIN: probable cad...    204   1e-55   Nicotiana sylvestris
ref|XP_006411908.1|  hypothetical protein EUTSA_v10024415mg             204   1e-55   Eutrema salsugineum [saltwater cress]
ref|XP_007047396.1|  Heavy metal atpase 1                               203   1e-55   
ref|XP_007155886.1|  hypothetical protein PHAVU_003G240100g             203   2e-55   Phaseolus vulgaris [French bean]
ref|XP_010526721.1|  PREDICTED: probable cadmium/zinc-transportin...    200   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_002866960.1|  hypothetical protein ARALYDRAFT_490893             202   4e-55   
ref|XP_010927512.1|  PREDICTED: probable cadmium/zinc-transportin...    202   4e-55   Elaeis guineensis
ref|XP_003550994.1|  PREDICTED: probable cadmium/zinc-transportin...    202   4e-55   Glycine max [soybeans]
ref|XP_008798716.1|  PREDICTED: probable cadmium/zinc-transportin...    201   6e-55   
ref|XP_002524927.1|  heavy metal cation transport atpase, putative      201   1e-54   Ricinus communis
emb|CAB90352.1|  putative metal ATPase                                  201   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AHW50672.1|  cadmium/zinc-transporting ATPase HMA1                   201   2e-54   Nicotiana tabacum [American tobacco]
ref|XP_009588513.1|  PREDICTED: LOW QUALITY PROTEIN: probable cad...    200   2e-54   
ref|XP_008462846.1|  PREDICTED: probable cadmium/zinc-transportin...    199   3e-54   Cucumis melo [Oriental melon]
ref|XP_010526719.1|  PREDICTED: probable cadmium/zinc-transportin...    199   4e-54   Tarenaya hassleriana [spider flower]
gb|EMS55611.1|  putative cadmium/zinc-transporting ATPase HMA1, c...    197   1e-53   Triticum urartu
ref|XP_008238762.1|  PREDICTED: probable cadmium/zinc-transportin...    198   1e-53   Prunus mume [ume]
dbj|BAK06002.1|  predicted protein                                      197   4e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007208172.1|  hypothetical protein PRUPE_ppa001453mg             196   4e-53   Prunus persica
emb|CCC14999.1|  heavy metal ATPase 1                                   196   5e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY67922.1|  BnaC08g49210D                                          185   5e-53   Brassica napus [oilseed rape]
ref|XP_003560477.1|  PREDICTED: probable cadmium/zinc-transportin...    196   6e-53   Brachypodium distachyon [annual false brome]
dbj|BAJ89769.1|  predicted protein                                      196   6e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004966187.1|  PREDICTED: probable cadmium/zinc-transportin...    196   7e-53   Setaria italica
ref|XP_008681454.1|  PREDICTED: uncharacterized protein LOC100273...    195   1e-52   Zea mays [maize]
ref|XP_011623222.1|  PREDICTED: probable cadmium/zinc-transportin...    194   1e-52   
gb|ERN05712.1|  hypothetical protein AMTR_s00006p00237340               194   1e-52   Amborella trichopoda
gb|AID81882.1|  heavy metal ATPase transporter 1                        195   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010432073.1|  PREDICTED: probable cadmium/zinc-transportin...    195   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004151907.1|  PREDICTED: probable cadmium/zinc-transportin...    195   2e-52   Cucumis sativus [cucumbers]
ref|XP_011623223.1|  PREDICTED: probable cadmium/zinc-transportin...    194   2e-52   
ref|XP_010437243.1|  PREDICTED: probable cadmium/zinc-transportin...    194   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010446681.1|  PREDICTED: probable cadmium/zinc-transportin...    194   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_011623220.1|  PREDICTED: probable cadmium/zinc-transportin...    194   3e-52   Amborella trichopoda
gb|EPS71968.1|  hypothetical protein M569_02788                         193   4e-52   Genlisea aurea
ref|XP_002878674.1|  hypothetical protein ARALYDRAFT_343887             193   6e-52   
ref|XP_008462778.1|  PREDICTED: probable cadmium/zinc-transportin...    193   8e-52   Cucumis melo [Oriental melon]
gb|KFK32755.1|  hypothetical protein AALP_AA6G284800                    192   9e-52   Arabis alpina [alpine rockcress]
ref|XP_010429275.1|  PREDICTED: probable cadmium/zinc-transportin...    191   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010432071.1|  PREDICTED: probable cadmium/zinc-transportin...    190   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006283120.1|  hypothetical protein CARUB_v10004142mg             189   2e-50   
emb|CDY46080.1|  BnaA09g42040D                                          186   1e-49   Brassica napus [oilseed rape]
ref|XP_006404810.1|  hypothetical protein EUTSA_v10000049mg             186   2e-49   Eutrema salsugineum [saltwater cress]
gb|KCW59485.1|  hypothetical protein EUGRSUZ_H02227                     185   4e-49   Eucalyptus grandis [rose gum]
ref|XP_010070608.1|  PREDICTED: probable cadmium/zinc-transportin...    185   4e-49   Eucalyptus grandis [rose gum]
ref|XP_010531262.1|  PREDICTED: probable cadmium/zinc-transportin...    184   1e-48   
ref|XP_010679546.1|  PREDICTED: probable cadmium/zinc-transportin...    178   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006295445.1|  hypothetical protein CARUB_v10024548mg             176   9e-46   Capsella rubella
gb|KGN63370.1|  hypothetical protein Csa_2G433360                       173   9e-45   Cucumis sativus [cucumbers]
ref|XP_002986489.1|  hypothetical protein SELMODRAFT_182418             172   1e-44   
ref|XP_002964908.1|  hypothetical protein SELMODRAFT_167322             172   1e-44   
ref|XP_010417082.1|  PREDICTED: probable cadmium/zinc-transportin...    167   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010927513.1|  PREDICTED: probable cadmium/zinc-transportin...    168   4e-43   Elaeis guineensis
ref|XP_010417081.1|  PREDICTED: probable cadmium/zinc-transportin...    167   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010652768.1|  PREDICTED: probable cadmium/zinc-transportin...    149   2e-36   Vitis vinifera
ref|XP_001762609.1|  predicted protein                                  147   1e-35   
gb|KDO79067.1|  hypothetical protein CISIN_1g003598mg                   146   2e-35   Citrus sinensis [apfelsine]
ref|NP_001141444.1|  uncharacterized protein LOC100273554               144   8e-35   Zea mays [maize]
gb|AFW69218.1|  hypothetical protein ZEAMMB73_697863                    144   2e-34   
gb|EMS57324.1|  putative cadmium/zinc-transporting ATPase HMA1, c...    139   6e-33   Triticum urartu
ref|XP_001780815.1|  predicted protein                                  135   1e-31   
ref|WP_006341401.1|  ATPase                                             127   4e-29   Parachlamydia acanthamoebae
ref|XP_008338386.1|  PREDICTED: probable cadmium/zinc-transportin...    124   1e-27   
gb|KIC72628.1|  putative cadmium/zinc-transporting ATPase HMA1, c...    122   2e-27   Neochlamydia sp. EPS4
ref|WP_042240439.1|  ATPase                                             122   2e-27   Neochlamydia sp. S13
ref|WP_039383686.1|  ATPase                                             122   2e-27   Neochlamydia sp. TUME1
ref|WP_044882722.1|  ATPase                                             122   2e-27   Neochlamydia sp. EPS4
gb|EMT13424.1|  Putative cadmium/zinc-transporting ATPase HMA1, c...    119   3e-26   
emb|CDZ80832.1|  putative cadmium-transporting ATPase                   115   5e-25   Candidatus Rubidus massiliensis
ref|WP_041941913.1|  ATPase                                             115   5e-25   
gb|ADI38979.1|  heavy metal translocating ATPase, P-type                115   5e-25   Waddlia chondrophila WSU 86-1044
ref|WP_042103685.1|  ATPase                                             114   1e-24   Parachlamydiaceae bacterium HS-T3
ref|WP_013942882.1|  ATPase                                             110   4e-23   Simkania negevensis
ref|WP_020355591.1|  MULTISPECIES: cadmium-translocating P-type A...    110   4e-23   Chlamydia
gb|AEB41191.1|  cadmium-translocating P-type ATPase                     107   2e-22   Chlamydia pecorum E58
ref|WP_021756909.1|  cadmium-translocating P-type ATPase                108   2e-22   Chlamydia pecorum
ref|WP_021757537.1|  cadmium-translocating P-type ATPase                107   2e-22   Chlamydia pecorum
ref|WP_024010970.1|  cadmium-translocating P-type ATPase                107   3e-22   Chlamydia pecorum
gb|EYE60727.1|  cadmium-translocating P-type ATPase                     107   4e-22   Bacteroides fragilis str. S6L5
gb|EPJ33233.1|  cadmium-translocating P-type ATPase                     104   5e-22   Chlamydia psittaci 06-1683
ref|WP_021828664.1|  cadmium-translocating P-type ATPase                107   5e-22   Chlamydia gallinacea
gb|EPP31529.1|  cadmium-translocating P-type ATPase                     104   5e-22   Chlamydia psittaci 84-8471/1
ref|WP_034734702.1|  HAD family hydrolase                               107   5e-22   
ref|WP_014518218.1|  HAD family hydrolase                               105   1e-21   Chlamydia pneumoniae
ref|WP_011097388.1|  HAD family hydrolase                               105   1e-21   Chlamydia abortus
ref|WP_006344470.1|  HAD family hydrolase                               105   1e-21   Chlamydia abortus
gb|ETR79629.1|  Lead, cadmium, zinc and mercury transporting ATPase     105   1e-21   Chlamydia pneumoniae B21
ref|WP_020370598.1|  MULTISPECIES: cadmium-translocating P-type A...    105   1e-21   Chlamydia ibidis
ref|WP_010883503.1|  HAD family hydrolase                               105   1e-21   Chlamydia pneumoniae
ref|WP_010892244.1|  HAD family hydrolase                               105   1e-21   
ref|WP_014946276.1|  HAD family hydrolase                               105   2e-21   Chlamydia psittaci
gb|EPJ19566.1|  cadmium-translocating P-type ATPase                     104   2e-21   Chlamydia psittaci 02DC23
ref|WP_014947277.1|  HAD family hydrolase                               105   2e-21   Chlamydia psittaci
ref|WP_014946930.1|  HAD family hydrolase                               105   2e-21   Chlamydia psittaci
gb|AEB55908.1|  cadmium-translocating P-type ATPase                     104   2e-21   Chlamydia psittaci 6BC
ref|WP_006343557.1|  HAD family hydrolase                               104   3e-21   Chlamydia psittaci
ref|WP_011457672.1|  HAD family hydrolase                               104   3e-21   Chlamydia felis
ref|WP_014945350.1|  HAD family hydrolase                               104   3e-21   Chlamydia psittaci
ref|WP_011006853.1|  HAD family hydrolase                               103   6e-21   Chlamydia caviae
ref|WP_044640179.1|  cadmium transporter                                102   1e-20   Risungbinella massiliensis
ref|WP_015506573.1|  zinc/cadmium/mercury/lead-transporting ATPase      101   4e-20   Chlamydia trachomatis
ref|WP_012263550.1|  HAD family hydrolase                               101   4e-20   Chlamydia trachomatis
ref|WP_009873330.1|  HAD family hydrolase                               100   5e-20   Chlamydia trachomatis
ref|WP_020753778.1|  Lead, cadmium, zinc and mercury transporting...  95.1    6e-20   Geobacillus sp. WSUCF1
ref|WP_041018267.1|  ATPase                                             100   6e-20   Criblamydia sequanensis
ref|WP_035345963.1|  cadmium transporter                                100   8e-20   Bacillus hemicellulosilyticus
ref|WP_045554656.1|  cadmium transporter                              98.2    8e-20   
ref|WP_010232691.1|  HAD family hydrolase                               100   1e-19   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_033827061.1|  cadmium transporter                                100   1e-19   Bacillus andreraoultii
gb|KJR46509.1|  Lead, cadmium, zinc and mercury transporting ATPase   94.0    1e-19   Desulfosporosinus sp. I2
ref|WP_018924362.1|  hypothetical protein                             99.8    1e-19   
ref|WP_027321941.1|  cadmium transporter                              99.8    1e-19   
ref|WP_010229366.1|  HAD family hydrolase                             99.4    2e-19   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_035407486.1|  HAD family hydrolase                             99.0    2e-19   Chlamydia suis
ref|WP_013119349.1|  cadmium transporter                              99.0    3e-19   Thermincola potens
ref|WP_009872104.1|  HAD family hydrolase                             98.6    3e-19   Chlamydia trachomatis
ref|WP_014541063.1|  HAD family hydrolase                             98.6    3e-19   Chlamydia trachomatis
ref|WP_012727986.1|  HAD family hydrolase                             98.6    3e-19   Chlamydia trachomatis
ref|WP_009872881.1|  HAD family hydrolase                             98.6    3e-19   Chlamydia trachomatis
ref|WP_034285888.1|  cadmium transporter                              99.0    3e-19   Bacillus sp. 72
ref|WP_018393724.1|  cadmium transporter                              98.6    3e-19   Bacillus sp. 37MA
gb|EGL48480.1|  HAD ATPase, P-type, family IC domain protein          94.0    3e-19   Streptococcus dysgalactiae subsp. equisimilis SK1249
ref|WP_020755401.1|  Lead, cadmium, zinc and mercury transporting...  92.8    3e-19   Geobacillus sp. WSUCF1
ref|WP_007786745.1|  cadmium transporter                              98.2    4e-19   Brevibacillus sp. CF112
ref|WP_031644883.1|  cadmium-transporting ATPase                      98.2    5e-19   Listeria monocytogenes
ref|WP_003728466.1|  MULTISPECIES: cadmium-transporting ATPase        98.2    5e-19   Listeria
ref|WP_035066778.1|  cadmium transporter                              98.2    5e-19   Carnobacterium maltaromaticum
ref|WP_015076936.1|  cadmium-translocating P-type ATPase              98.2    5e-19   Carnobacterium maltaromaticum
ref|WP_044394570.1|  cadmium transporter                              97.8    5e-19   Bacillus
ref|WP_016838775.1|  hypothetical protein                             97.8    5e-19   Ureibacillus thermosphaericus
ref|WP_033543579.1|  cadmium transporter                              97.8    5e-19   Planococcus sp. CAU13
ref|WP_025038999.1|  hypothetical protein                             94.7    6e-19   
ref|WP_036184416.1|  cadmium transporter                              97.8    6e-19   Lysinibacillus manganicus
ref|WP_009225275.1|  cadmium transporter                              97.8    6e-19   Paenibacillus sp. oral taxon 786
dbj|GAJ60133.1|  cadmium-transporting ATPase                          94.4    6e-19   Geobacillus thermoleovorans B23
ref|WP_033845577.1|  cadmium transporter                              94.7    6e-19   
ref|WP_034626912.1|  cadmium transporter                              97.8    7e-19   Bacillus okhensis
ref|WP_021322493.1|  hypothetical protein                             94.7    7e-19   Geobacillus sp. A8
ref|WP_015592581.1|  cadmium transporter                              97.1    8e-19   
emb|CKH65593.1|  cadmium translocating P-type ATPase CadA%2C puta...  91.7    9e-19   Staphylococcus aureus
ref|WP_011245132.1|  cadmium transporter                              97.1    1e-18   Bacillus clausii
ref|WP_010750087.1|  heavy metal translocating P-type ATPase          96.7    1e-18   Enterococcus villorum
ref|WP_002406005.1|  cadmium transporter                              96.7    1e-18   Enterococcus faecalis
ref|WP_002372033.1|  MULTISPECIES: cadmium transporter                96.7    1e-18   Bacilli
ref|WP_016612417.1|  cadmium-exporting ATPase                         96.7    2e-18   
ref|WP_034678530.1|  cadmium transporter                              96.3    2e-18   Bacillus megaterium
ref|WP_035202397.1|  cadmium transporter                              96.3    2e-18   Bacillus
dbj|GAE26891.1|  cadmium-transporting ATPase                          96.3    2e-18   Bacillus wakoensis JCM 9140
gb|ETT40493.1|  cadmium efflux P-type ATPase                          96.3    2e-18   Paenibacillus sp. FSL R5-808
ref|WP_004436784.1|  cadmium transporter                              96.3    2e-18   
ref|WP_036638569.1|  cadmium transporter                              96.3    2e-18   Paenibacillus
ref|WP_034274569.1|  cadmium transporter                              96.3    2e-18   Bacillus sp. J13
ref|WP_008300244.1|  putative cadmium-transporting ATPase             96.3    2e-18   Bhargavaea cecembensis
ref|WP_044337850.1|  cadmium transporter                              95.9    2e-18   
ref|WP_033567369.1|  cadmium transporter                              93.2    2e-18   
gb|KIY23838.1|  cadmium transporter                                   95.9    2e-18   Bacillus subterraneus
ref|WP_044124828.1|  cadmium transporter                              93.2    2e-18   
ref|WP_044118888.1|  cadmium transporter                              93.2    2e-18   
ref|WP_036807509.1|  cadmium transporter                              95.9    2e-18   Planomicrobium glaciei
ref|WP_027410416.1|  cadmium transporter                              95.9    2e-18   Anoxybacillus tepidamans
ref|WP_036174038.1|  cadmium transporter                              95.9    3e-18   Lysinibacillus massiliensis
ref|WP_021290516.1|  MULTISPECIES: hypothetical protein               95.9    3e-18   Virgibacillus
ref|WP_040285593.1|  cadmium transporter                              95.9    3e-18   Sporosarcina koreensis
ref|WP_035301102.1|  cadmium transporter                              95.1    3e-18   
emb|CCO07049.1|  putative cadmium-transporting ATPase                 95.9    3e-18   Desulfotomaculum hydrothermale Lam5 = DSM 18033
ref|WP_019380955.1|  cadmium transporter                              95.5    3e-18   Bacillus oceanisediminis
ref|WP_007502121.1|  ATPase                                           95.5    3e-18   
ref|WP_035040546.1|  metal ABC transporter ATPase                     95.9    3e-18   
ref|WP_014097067.1|  cadmium transporter                              95.5    3e-18   Bacillus coagulans
ref|WP_017473047.1|  hypothetical protein                             95.5    3e-18   
ref|WP_023508362.1|  cadmium transporter                              95.5    3e-18   Sporolactobacillus laevolacticus
ref|WP_017552366.1|  cadmium transporter                              95.5    3e-18   Bacillus coagulans
ref|WP_013860498.1|  cadmium transporter                              95.5    3e-18   Bacillus coagulans
ref|WP_018131873.1|  ATPase                                           95.5    3e-18   Effusibacillus pohliae
ref|WP_026700046.1|  cadmium transporter                              95.5    4e-18   
ref|WP_009374038.1|  MULTISPECIES: Cadmium-transporting ATPase CadA   95.5    4e-18   Lysinibacillus
ref|WP_044116546.1|  cadmium transporter                              93.2    4e-18   
ref|WP_044116778.1|  cadmium transporter                              93.2    4e-18   
ref|WP_040037563.1|  MULTISPECIES: cadmium transporter                95.5    4e-18   Quasibacillus thermotolerans
ref|WP_044120432.1|  cadmium transporter                              93.2    4e-18   
ref|WP_044120700.1|  cadmium transporter                              92.8    4e-18   
ref|WP_020279842.1|  cadmium-transporting ATPase                      94.4    4e-18   Geobacillus kaustophilus
ref|WP_041305724.1|  cadmium transporter                              95.1    4e-18   
ref|WP_044118635.1|  cadmium transporter                              93.2    4e-18   
ref|WP_026575931.1|  cadmium transporter                              94.7    4e-18   
dbj|GAE92807.1|  lead, cadmium, zinc and mercury transporting ATPase  94.7    4e-18   Gracilibacillus boraciitolerans JCM 21714
gb|EAO63130.1|  cation-transporting ATPase, E1-E2 family              92.8    5e-18   Streptococcus agalactiae 18RS21
ref|WP_021322558.1|  hypothetical protein                             92.0    5e-18   Geobacillus sp. A8
ref|WP_034781872.1|  cadmium transporter                              92.8    5e-18   
dbj|GAE27699.1|  lead, cadmium, zinc and mercury transporting ATPase  94.7    5e-18   Bacillus wakoensis JCM 9140
ref|WP_034799686.1|  cadmium transporter                              92.8    5e-18   
ref|WP_039069840.1|  cadmium transporter                              94.7    5e-18   
gb|ADG06775.1|  heavy metal translocating P-type ATPase               94.7    5e-18   Kyrpidia tusciae DSM 2912
ref|WP_035385747.1|  cadmium transporter                              92.8    6e-18   
ref|WP_033013733.1|  cadmium transporter                              94.7    6e-18   Geobacillus stearothermophilus
emb|CDN41322.1|  Probable cadmium-transporting ATPase                 94.7    7e-18   Paenibacillus sp. P22
ref|WP_042411719.1|  cadmium transporter                              94.4    7e-18   Parageobacillus caldoxylosilyticus
ref|WP_035666842.1|  cadmium transporter                              94.4    7e-18   
ref|WP_031879516.1|  cadmium transporter                              91.3    7e-18   
ref|WP_012749257.1|  cadmium transporter                              94.4    7e-18   Geobacillus sp. WCH70
ref|WP_016621962.1|  cadmium-exporting ATPase                         94.4    7e-18   
ref|WP_035067453.1|  cadmium transporter                              94.4    7e-18   Anoxybacillus gonensis
dbj|GAE36673.1|  cadmium-transporting ATPase                          94.4    7e-18   Bacillus akibai JCM 9157
ref|WP_035333303.1|  cadmium transporter                              94.4    7e-18   Bacillus firmus
ref|WP_004577738.1|  MULTISPECIES: cadmium-transporting ATPase        94.4    8e-18   Bacillaceae
ref|WP_011230089.1|  MULTISPECIES: cadmium transporter                94.4    8e-18   Bacillaceae
ref|XP_005645930.1|  heavy metal translocatin                         94.4    8e-18   Coccomyxa subellipsoidea C-169
ref|WP_029194015.1|  cadmium transporter                              94.4    8e-18   Paenibacillus alginolyticus
gb|EFB58003.1|  cadmium-translocating P-type ATPase                   93.6    8e-18   Staphylococcus aureus subsp. aureus WW2703/97
ref|WP_010989665.1|  cadmium-transporting ATPase                      94.4    8e-18   Listeria monocytogenes
ref|WP_039670424.1|  cadmium transporter                              94.4    8e-18   Streptococcus
ref|WP_041845738.1|  cadmium transporter                              94.4    8e-18   Bacillus thermoamylovorans
gb|EFV75082.1|  heavy metal translocating P-type ATPase               94.4    8e-18   Bacillus sp. 2_A_57_CT2
emb|CEN29602.1|  Cadmium-transporting ATPase CadA                     94.4    9e-18   Lactococcus piscium MKFS47
ref|WP_034297639.1|  cadmium transporter                              94.0    9e-18   Bacillus sp. 2_A_57_CT2
gb|ADM43461.1|  cadmium resistance protein B                          94.0    9e-18   Staphylococcus cohnii
ref|WP_012958720.1|  cadmium transporter                              94.0    9e-18   Bacillus pseudofirmus
ref|WP_010942791.1|  cadmium transporter                              94.0    9e-18   Geobacter sulfurreducens
ref|WP_035333333.1|  hypothetical protein                             89.4    1e-17   
ref|WP_034782044.1|  cadmium transporter                              94.4    1e-17   Exiguobacterium mexicanum
ref|WP_029595500.1|  cadmium transporter                              94.0    1e-17   Exiguobacterium chiriqhucha
ref|WP_041967951.1|  cadmium transporter                              93.6    1e-17   
ref|WP_004225351.1|  cadmium transporter                              94.0    1e-17   Lysinibacillus fusiformis
gb|EPT59614.1|  hypothetical protein SAG0058_05635                    91.7    1e-17   Streptococcus agalactiae CCUG 37430
ref|WP_041071676.1|  cadmium transporter                              94.0    1e-17   Bacillus sp. OxB-1
ref|WP_037996620.1|  cadmium transporter                              93.6    1e-17   
ref|WP_036190230.1|  cadmium transporter                              94.0    1e-17   Lysinibacillus manganicus
ref|WP_041854310.1|  cadmium transporter                              93.6    1e-17   
gb|EPV10021.1|  hypothetical protein SAG0330_01055                    93.2    1e-17   Streptococcus agalactiae GB00561
ref|WP_034748576.1|  cadmium transporter                              93.6    1e-17   Bacillus wakoensis
gb|EFV74594.1|  E1-E2 family Cation-transporting ATPase               93.6    1e-17   Bacillus sp. 2_A_57_CT2
emb|CCB84770.1|  nitrogenase Fe protein                               89.7    1e-17   Bosea massiliensis 63287
ref|WP_007083429.1|  cadmium-transporting ATPase                      93.6    1e-17   
ref|WP_013486817.1|  cadmium transporter                              93.6    1e-17   Bacillus cellulosilyticus
ref|WP_035195825.1|  cadmium transporter                              93.6    1e-17   
ref|WP_034558144.1|  cadmium transporter                              93.6    1e-17   Carnobacterium gallinarum
gb|AGA57781.1|  copper/silver-translocating P-type ATPase,heavy m...  93.6    1e-17   Thermobacillus composti KWC4
ref|WP_019381806.1|  MULTISPECIES: cadmium transporter                93.6    1e-17   
ref|WP_034626353.1|  cadmium transporter                              93.6    1e-17   Bacillus okhensis
gb|KEF38420.1|  copper/silver-translocating P-type ATPase,heavy m...  93.6    1e-17   Bacillus azotoformans MEV2011
ref|WP_029336151.1|  cadmium transporter                              93.6    1e-17   
ref|WP_044124868.1|  cadmium transporter                              90.9    1e-17   
gb|EHT85738.1|  copper-translocating P-type ATPase                    93.6    1e-17   
ref|WP_042426700.1|  cadmium transporter                              93.6    2e-17   
gb|EFB48349.1|  cadmium-transporting ATPase                           93.6    2e-17   
ref|WP_014194838.1|  MULTISPECIES: cadmium transporter                93.6    2e-17   
ref|WP_000378397.1|  cadmium transporter                              93.6    2e-17   
ref|WP_033396528.1|  cadmium transporter                              93.2    2e-17   
ref|WP_000254753.1|  hypothetical protein                             93.2    2e-17   
ref|WP_000378396.1|  cadmium-transporting ATPase                      93.2    2e-17   
ref|WP_000378398.1|  cadmium transporter                              93.2    2e-17   
emb|CFU06420.1|  cadmium-transporting ATPase%2C CadA                  93.2    2e-17   
ref|WP_019169405.1|  cadmium transporter                              93.2    2e-17   
ref|WP_025039411.1|  cadmium transporter                              93.2    2e-17   
ref|WP_044118897.1|  cadmium transporter                              90.9    2e-17   
ref|WP_010281875.1|  cadmium transporter                              93.2    2e-17   
gb|AJP19252.1|  cadmium transporter                                   93.2    2e-17   
ref|WP_031880737.1|  cadmium-transporting ATPase                      93.2    2e-17   
gb|ADA81011.1|  Cadmium-transporting ATPase                           90.9    2e-17   
gb|EFB46302.1|  cadmium-transporting ATPase                           93.2    2e-17   
ref|WP_031895053.1|  cadmium transporter                              93.2    2e-17   
gb|EGL82753.1|  heavy metal translocating P-type ATPase               93.2    2e-17   
emb|CEG24019.1|  putative cadmium-transporting ATPase                 93.2    2e-17   
ref|WP_029566897.1|  cadmium transporter                              93.2    2e-17   
ref|WP_011229856.1|  cadmium transporter                              93.2    2e-17   
ref|WP_039957696.1|  cadmium transporter                              93.2    2e-17   
ref|WP_006379652.1|  HAD ATPase, P-type, family IC domain protein     87.8    2e-17   
ref|WP_017474135.1|  MULTISPECIES: ATPase                             93.2    2e-17   
ref|WP_044116572.1|  cadmium transporter                              90.9    2e-17   
ref|WP_027971247.1|  cadmium transporter                              93.2    2e-17   
ref|WP_000378395.1|  cadmium-transporting ATPase                      93.2    2e-17   
ref|WP_031536501.1|  cadmium transporter                              93.2    2e-17   
ref|WP_001137196.1|  hypothetical protein                             93.2    2e-17   
ref|WP_000086363.1|  MULTISPECIES: cadmium transporter                93.2    2e-17   
ref|WP_002926019.1|  MULTISPECIES: cadmium transporter                93.2    2e-17   
ref|WP_034782012.1|  cadmium transporter                              92.8    2e-17   
ref|WP_003783705.1|  MULTISPECIES: cadmium transporter                92.8    2e-17   
ref|WP_005606284.1|  cadmium transporter                              92.8    2e-17   
ref|WP_010194585.1|  cadmium transporter                              92.8    2e-17   
ref|WP_044679566.1|  cadmium transporter                              92.8    2e-17   
ref|WP_017646487.1|  cadmium transporter                              92.8    2e-17   
dbj|GAF11666.1|  LOW QUALITY PROTEIN: lead, cadmium, zinc and mer...  92.8    2e-17   
gb|EKN63472.1|  ATPase P                                              92.8    2e-17   
ref|WP_028598741.1|  cadmium transporter                              92.8    2e-17   
ref|WP_043903637.1|  cadmium transporter                              92.8    2e-17   
ref|WP_040928537.1|  cadmium transporter                              93.2    2e-17   
dbj|GAF18074.1|  LOW QUALITY PROTEIN: lead, cadmium, zinc and mer...  92.8    2e-17   
ref|WP_031536232.1|  cadmium transporter                              92.8    2e-17   
ref|WP_020977317.1|  cadmium translocating P-type ATPase CadA, pu...  93.2    2e-17   
ref|WP_035413050.1|  cadmium transporter                              92.8    2e-17   
ref|WP_032603665.1|  cadmium transporter                              92.8    2e-17   
ref|WP_037541462.1|  cadmium transporter                              92.8    2e-17   
dbj|GAJ97686.1|  LOW QUALITY PROTEIN: lead, cadmium, zinc and mer...  92.8    2e-17   
ref|WP_015863925.1|  cadmium transporter                              92.8    3e-17   
ref|WP_044118709.1|  cadmium transporter                              90.9    3e-17   
ref|WP_014196255.1|  cadmium transporter                              92.8    3e-17   
ref|WP_003140660.1|  cadmium transporter                              92.8    3e-17   
ref|WP_008432347.1|  cadmium transporter                              92.8    3e-17   
ref|WP_041098637.1|  cadmium transporter                              92.8    3e-17   
ref|WP_031644256.1|  cadmium transporter                              92.4    3e-17   
ref|WP_029284514.1|  cadmium transporter                              92.4    3e-17   
ref|WP_012875088.1|  cadmium transporter                              92.4    3e-17   
ref|WP_040037815.1|  cadmium transporter                              92.4    3e-17   
ref|WP_035384476.1|  metal ABC transporter ATPase                     92.8    3e-17   
gb|EPW90052.1|  cadmium transporter                                   92.0    3e-17   
ref|WP_036305497.1|  metal ABC transporter ATPase                     92.4    3e-17   
ref|WP_025948427.1|  cadmium transporter                              92.4    3e-17   
gb|KHF26890.1|  putative cadmium-transporting ATPase                  92.0    3e-17   
ref|WP_013292905.1|  ATPase                                           92.4    3e-17   
dbj|BAQ35726.1|  cadmium-transporting ATPase, CadA                    92.4    3e-17   
ref|WP_003322823.1|  cadmium transporter                              92.4    3e-17   
ref|WP_010900160.1|  cadmium transporter                              92.4    4e-17   
ref|WP_000378486.1|  cadmium transporter                              92.4    4e-17   
ref|WP_000378487.1|  cadmium-transporting ATPase                      92.4    4e-17   
ref|WP_009384768.1|  cadmium resistance protein B                     92.4    4e-17   
ref|WP_026583997.1|  cadmium transporter                              92.4    4e-17   
ref|WP_033011421.1|  cadmium transporter                              92.4    4e-17   
ref|WP_021094326.1|  cadmium-transporting ATPase                      92.4    4e-17   
ref|WP_002485759.1|  cadmium transporter                              92.4    4e-17   
ref|WP_015374837.1|  putative cadmium-transporting ATPase             92.0    4e-17   
ref|WP_017175362.1|  cadmium transporter                              92.4    4e-17   
ref|WP_000378485.1|  MULTISPECIES: cadmium-transporting ATPase        92.4    4e-17   
ref|WP_002504087.1|  cadmium transporter                              92.4    4e-17   
ref|WP_033533404.1|  cadmium transporter                              92.0    4e-17   
ref|WP_038702519.1|  cadmium transporter                              92.0    4e-17   
ref|WP_006323324.1|  cadmium-transporting ATPase                      92.0    4e-17   
ref|WP_000086364.1|  hypothetical protein                             92.0    4e-17   
ref|WP_034616810.1|  cadmium transporter                              92.0    4e-17   
ref|WP_000086362.1|  hypothetical protein                             92.0    4e-17   
ref|WP_043966686.1|  cadmium transporter                              92.0    4e-17   
ref|WP_000086366.1|  hypothetical protein                             92.0    4e-17   
ref|WP_000086361.1|  hypothetical protein                             92.0    4e-17   
ref|WP_036179504.1|  cadmium transporter                              92.0    4e-17   
emb|CFQ48335.1|  cation transporter E1-E2 family ATPase               92.0    4e-17   
ref|WP_038812429.1|  cadmium transporter                              92.0    4e-17   
ref|WP_016117823.1|  heavy metal translocating P-type ATPase          92.0    4e-17   
ref|WP_018367269.1|  cadmium transporter                              92.0    5e-17   
ref|WP_044164369.1|  cadmium transporter                              92.0    5e-17   
dbj|GAM98994.1|  lead, cadmium, zinc and mercury transporting ATPase  91.7    5e-17   
ref|WP_019007669.1|  cadmium transporter                              91.7    5e-17   
ref|WP_041114487.1|  cadmium transporter                              91.7    5e-17   
ref|WP_041514095.1|  metal ABC transporter ATPase                     92.0    5e-17   
ref|WP_013559178.1|  heavy metal translocating P-type ATPase          91.7    5e-17   
ref|WP_035416501.1|  MULTISPECIES: cadmium transporter                91.7    6e-17   
ref|WP_035422964.1|  cadmium transporter                              91.7    6e-17   
ref|WP_010027496.1|  cadmium transporter                              91.7    6e-17   
ref|WP_034772565.1|  cadmium transporter                              91.7    6e-17   
ref|WP_041903016.1|  cadmium transporter                              91.7    7e-17   
ref|WP_004434559.1|  cadmium transporter                              91.3    7e-17   
ref|WP_043461627.1|  ATPase                                           91.7    7e-17   
ref|WP_041845572.1|  cadmium transporter                              91.3    7e-17   
emb|CEE02748.1|  putative cadmium-transporting ATPase                 91.3    7e-17   
ref|WP_031438797.1|  metal ABC transporter ATPase                     91.3    7e-17   
gb|KIO62779.1|  Cadmium-transporting ATPase                           91.3    7e-17   
ref|WP_043988686.1|  cadmium transporter                              91.3    7e-17   
ref|WP_022627418.1|  cadmium transporter                              91.3    8e-17   
ref|WP_044116802.1|  cadmium transporter                              90.9    8e-17   
dbj|GAD14273.1|  cation-transporting ATPase                           91.3    8e-17   
emb|CEG29707.1|  cadmium efflux P-type ATPase                         90.9    8e-17   
ref|WP_039044580.1|  cadmium transporter                              91.3    8e-17   
ref|WP_041056111.1|  cadmium transporter                              91.3    8e-17   
gb|EWG11261.1|  cation transport ATPase                               91.3    8e-17   
ref|WP_011064678.1|  cadmium transporter                              91.3    8e-17   
dbj|GAM07475.1|  hypothetical protein MBENS4_4471                     87.4    8e-17   
ref|WP_043058066.1|  HAD family hydrolase                             90.9    8e-17   
ref|WP_019156316.1|  cadmium transporter                              90.9    9e-17   
ref|WP_024536755.1|  cadmium transporter                              91.3    9e-17   
ref|WP_016427018.1|  heavy metal translocating P-type ATPase          91.3    9e-17   
ref|WP_036152696.1|  cadmium transporter                              91.3    9e-17   
ref|WP_002454667.1|  cadmium transporter                              91.3    9e-17   
ref|WP_003543034.1|  MULTISPECIES: cadmium transporter                91.3    9e-17   
ref|WP_033013785.1|  cadmium transporter                              90.9    9e-17   
ref|WP_044736099.1|  cadmium transporter                              90.9    9e-17   
ref|WP_037555532.1|  cadmium transporter                              91.3    9e-17   
ref|WP_010652181.1|  cadmium transporter                              91.3    9e-17   
ref|WP_044732108.1|  cadmium transporter                              90.9    1e-16   
ref|WP_033101035.1|  cadmium transporter                              90.9    1e-16   
ref|WP_009498383.1|  P-ATPase superfamily P-type ATPase cadmium t...  87.8    1e-16   
ref|WP_029761838.1|  cadmium transporter                              90.9    1e-16   
ref|WP_041264253.1|  cadmium transporter                              90.9    1e-16   
ref|WP_025785475.1|  cadmium transporter                              90.9    1e-16   
ref|WP_011928313.1|  cadmium transporter                              90.9    1e-16   
ref|WP_026859794.1|  cadmium transporter                              90.9    1e-16   
gb|EYR22510.1|  cadmium-translocating P-type ATPase                   90.9    1e-16   
ref|WP_016174047.1|  cadmium-translocating P-type ATPase              90.9    1e-16   
ref|WP_021322548.1|  MULTISPECIES: cadmium transporter                90.9    1e-16   
ref|WP_031767496.1|  cadmium transporter                              90.5    1e-16   
ref|WP_017755395.1|  cadmium transporter                              90.9    1e-16   
ref|WP_019156599.1|  cadmium transporter                              90.9    1e-16   
gb|ABO66017.1|  Cation-transporting ATPase, E1-E2 family              90.9    1e-16   
ref|WP_015008899.1|  cadmium transporter                              90.9    1e-16   
ref|WP_008879033.1|  cadmium transporter                              90.9    1e-16   
ref|WP_011230252.1|  MULTISPECIES: cadmium transporter                90.9    1e-16   
ref|WP_019156604.1|  MULTISPECIES: cadmium transporter                90.5    1e-16   
ref|WP_014829538.1|  cadmium transporter                              90.5    1e-16   
ref|WP_040225462.1|  cadmium transporter                              90.5    1e-16   
ref|WP_014283104.1|  ATPase, P-type, heavy metal-(Cd/Co/Hg/Pb/Zn)...  90.5    1e-16   
ref|WP_034782039.1|  cadmium transporter                              90.5    1e-16   
ref|WP_008550717.1|  heavy metal translocating P-type ATPase          90.5    1e-16   
ref|WP_033859478.1|  cadmium transporter                              90.5    1e-16   
ref|WP_032100687.1|  cadmium transporter                              90.5    1e-16   
ref|WP_042353999.1|  cadmium transporter                              90.1    1e-16   
gb|ADA80815.1|  Cadmium-transporting ATPase                           90.5    2e-16   
emb|CAB96929.1|  CadA protein                                         90.5    2e-16   
ref|WP_000003267.1|  cadmium-transporting ATPase                      90.5    2e-16   
ref|WP_000003268.1|  cadmium transporter                              90.5    2e-16   
ref|WP_000003266.1|  MULTISPECIES: cadmium transporter                90.5    2e-16   
ref|WP_012816553.1|  Cadmium-transporting ATPase                      90.5    2e-16   
ref|WP_031405187.1|  cadmium transporter                              90.1    2e-16   
ref|WP_042144388.1|  cadmium transporter                              90.1    2e-16   
ref|WP_000003262.1|  cadmium transporter                              90.1    2e-16   
ref|WP_035839285.1|  metal ABC transporter ATPase                     90.1    2e-16   
ref|WP_000003265.1|  cadmium transporter                              90.1    2e-16   
ref|WP_026937551.1|  HAD family hydrolase                             90.1    2e-16   
ref|WP_000003263.1|  cadmium transporter                              90.1    2e-16   
ref|WP_000003264.1|  cadmium transporter                              90.1    2e-16   
ref|WP_042140035.1|  ATPase                                           90.1    2e-16   
gb|ADA80426.1|  Cadmium-transporting ATPase                           90.1    2e-16   
ref|WP_013523124.1|  MULTISPECIES: cadmium transporter                90.1    2e-16   
gb|ADI27741.1|  heavy metal translocating P-type ATPase               90.1    2e-16   
ref|WP_017187523.1|  cadmium transporter                              90.1    2e-16   
ref|WP_022870911.1|  HAD family hydrolase                             90.1    2e-16   
ref|WP_012961265.1|  cadmium-transporting ATPase                      90.1    2e-16   
gb|AIQ32426.1|  ATPase                                                89.7    2e-16   
ref|WP_034817436.1|  cadmium-transporting ATPase                      90.1    2e-16   
ref|WP_040980506.1|  cadmium transporter                              90.1    2e-16   
ref|WP_003322300.1|  MULTISPECIES: cadmium-transporting ATPase        90.1    2e-16   
ref|WP_044893150.1|  cadmium transporter                              90.1    2e-16   
ref|WP_020958886.1|  cadmium transporter                              90.1    2e-16   
ref|WP_041468536.1|  cadmium transporter                              90.1    2e-16   
ref|WP_023180052.1|  Cadmium-transporting ATPase                      90.1    2e-16   
ref|WP_009335236.1|  MULTISPECIES: cadmium transporter                89.7    2e-16   
ref|WP_044979928.1|  cadmium transporter                              90.1    2e-16   
ref|WP_027752553.1|  metal ABC transporter ATPase                     89.7    2e-16   
dbj|BAE19653.1|  putative cadmium-transporting ATPase                 90.1    2e-16   
ref|WP_039806463.1|  cadmium transporter                              90.1    2e-16   
ref|WP_028987965.1|  cadmium transporter                              89.7    2e-16   
ref|WP_041785032.1|  cadmium transporter                              90.1    2e-16   
ref|WP_019467776.1|  cadmium transporter                              90.1    2e-16   
ref|WP_041636177.1|  cadmium transporter                              89.7    2e-16   
ref|WP_021459094.1|  cadmium transporter                              90.1    2e-16   
ref|WP_017755007.1|  cadmium transporter                              89.7    2e-16   
dbj|BAH18386.1|  conserved hypothetical protein                       89.7    2e-16   
ref|WP_041080738.1|  cadmium transporter                              90.1    2e-16   
ref|WP_035663097.1|  cadmium transporter                              89.7    2e-16   
ref|WP_013730038.1|  cadmium efflux ATPase                            90.1    2e-16   
ref|WP_034676499.1|  cadmium transporter                              89.7    2e-16   
ref|WP_041098405.1|  cadmium transporter                              89.7    2e-16   
ref|WP_042128017.1|  cadmium transporter                              89.7    2e-16   
ref|WP_041114258.1|  cadmium transporter                              89.7    2e-16   
ref|WP_007272311.1|  heavy metal translocating P-type ATPase          89.7    2e-16   
ref|WP_036711081.1|  ATPase                                           89.7    2e-16   
ref|WP_036144997.1|  cadmium transporter                              89.7    2e-16   
ref|WP_029341717.1|  cadmium-transporting ATPase                      89.7    2e-16   
ref|WP_035349337.1|  cadmium transporter                              89.7    3e-16   
ref|WP_008612731.1|  ATPase                                           89.4    3e-16   
gb|KIL73765.1|  Lead, cadmium, zinc and mercury transporting ATPase   89.7    3e-16   
gb|KIL77250.1|  Lead, cadmium, zinc and mercury transporting ATPase   89.7    3e-16   
ref|WP_019380901.1|  cadmium transporter                              89.7    3e-16   
ref|WP_042533111.1|  cadmium transporter                              89.7    3e-16   
ref|WP_040047917.1|  cadmium transporter                              89.7    3e-16   



>ref|XP_004231883.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Solanum lycopersicum]
Length=821

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ASA RVAK VGIKEV+CSLKPEDKLYHVTSISRD GGLIMVGDGINDAPALAAATVG
Sbjct  635  DHKASAKRVAKTVGIKEVNCSLKPEDKLYHVTSISRDTGGLIMVGDGINDAPALAAATVG  694

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            IVLAERASAAA+AVAD+LLLQDNISGVPFCVAK+RQTTSLIKQNV LAL SI +ASLTSV
Sbjct  695  IVLAERASAAAVAVADVLLLQDNISGVPFCVAKSRQTTSLIKQNVVLALCSIILASLTSV  754

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNNS  429
            +GFLPLWLTVLLHEGGTLLVCLNS+RALN PT SW++ I Q+++RLRS+IM L RHG   
Sbjct  755  MGFLPLWLTVLLHEGGTLLVCLNSVRALNPPTWSWREDISQIIDRLRSLIMFL-RHG-TL  812

Query  428  QSTIEAA  408
             STI+AA
Sbjct  813  PSTIQAA  819



>ref|XP_006339845.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Solanum tuberosum]
Length=817

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 171/187 (91%), Gaps = 2/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHEASA RVAK VGIKEV+CSLKPEDKLYHVTSISRD GGLIMVGDGINDAPALAAATVG
Sbjct  631  DHEASARRVAKTVGIKEVNCSLKPEDKLYHVTSISRDTGGLIMVGDGINDAPALAAATVG  690

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            IVLAERASAAAIAVAD+LLLQDNISGVPFCVAK+RQTTSLIKQNV LAL SI +ASLTSV
Sbjct  691  IVLAERASAAAIAVADVLLLQDNISGVPFCVAKSRQTTSLIKQNVVLALCSIILASLTSV  750

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNNS  429
            +GFLPLWLTVLLHEGGTLLVCLNS+RALN PT SW++ I Q+++R+RS++M L RHG   
Sbjct  751  MGFLPLWLTVLLHEGGTLLVCLNSVRALNPPTWSWREDISQIIDRMRSLVMFL-RHG-TL  808

Query  428  QSTIEAA  408
             STI+AA
Sbjct  809  PSTIQAA  815



>ref|XP_002278549.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI33768.3| unnamed protein product [Vitis vinifera]
Length=829

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 165/191 (86%), Gaps = 3/191 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGIKEV+CSLKPEDKL HV SISR+ GG LIMVGDGINDAPALAAATV
Sbjct  641  DHESSAWRVANAVGIKEVYCSLKPEDKLNHVKSISREAGGGLIMVGDGINDAPALAAATV  700

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RAS  AIAVAD+LLL+DNIS VPFCV+K+RQTTSL+KQNVALALS I +ASL S
Sbjct  701  GIVLAQRASGTAIAVADVLLLRDNISAVPFCVSKSRQTTSLVKQNVALALSCILLASLPS  760

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN+PT SW+  ++ +V++ +S IM LRRH   
Sbjct  761  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNEPTWSWKQDLVPVVDKFKSTIMFLRRHTTT  820

Query  431  SQSTIEAAAPL  399
            S ST   AAPL
Sbjct  821  SSST--RAAPL  829



>ref|XP_011099314.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Sesamum indicum]
Length=812

 Score =   222 bits (565),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 169/188 (90%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE SA RVA AVGIKEVHCSLKPEDKLYHVTSISRD GG LIMVGDGINDAPALAAATV
Sbjct  624  DHELSARRVANAVGIKEVHCSLKPEDKLYHVTSISRDTGGGLIMVGDGINDAPALAAATV  683

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLAERASA AIAVAD+LLLQDNISGVPFCVAK+RQTTSL+KQNVALAL SI +ASLTS
Sbjct  684  GIVLAERASATAIAVADVLLLQDNISGVPFCVAKSRQTTSLVKQNVALALCSIVLASLTS  743

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW+  I+QLVNRL+S+++ L+  G+ 
Sbjct  744  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNAPTWSWKHDILQLVNRLKSLLLRLKNEGSE  803

Query  431  SQSTIEAA  408
               TI+AA
Sbjct  804  -HGTIQAA  810



>ref|XP_002310116.2| hypothetical protein POPTR_0007s104801g, partial [Populus trichocarpa]
 gb|EEE90566.2| hypothetical protein POPTR_0007s104801g, partial [Populus trichocarpa]
Length=541

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 166/191 (87%), Gaps = 3/191 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAVGI EV+CSLKPEDKL  V  ISRD GG L+MVG+GINDAPALAAATV
Sbjct  353  DHESSAWRVAKAVGISEVYCSLKPEDKLNQVKGISRDMGGGLVMVGEGINDAPALAAATV  412

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+D ISGVPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  413  GIVLAQRASATAIAVADVLLLRDTISGVPFCIAKSRQTTSLIKQNVALALTSIFLASLPS  472

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP  SW+  + Q+V +L+S +M L+  G+ 
Sbjct  473  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPKWSWRYDLQQVVEKLKSRVM-LKVTGDT  531

Query  431  SQSTIEAAAPL  399
            S ST+E AAPL
Sbjct  532  SSSTVE-AAPL  541



>emb|CDP02541.1| unnamed protein product [Coffea canephora]
Length=820

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+CSLKPEDKLYHVTSISR+ GG LIMVGDGINDAPALAAATV
Sbjct  629  DHKSSARRVANAVGIDEVYCSLKPEDKLYHVTSISRNTGGGLIMVGDGINDAPALAAATV  688

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASAAA+ VAD+LLLQDNISGVPFC+AK+ QTTSL+KQNVALAL SI VASLTS
Sbjct  689  GIVLAGRASAAAVGVADVLLLQDNISGVPFCIAKSWQTTSLVKQNVALALCSIVVASLTS  748

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVL  450
            VLG+LPLWLTVLLHEGGTLLVCLNSIRALN PT SW+D I QLVN+ RSV+M +
Sbjct  749  VLGYLPLWLTVLLHEGGTLLVCLNSIRALNPPTWSWRDDIPQLVNKWRSVVMFV  802



>ref|XP_010095321.1| putative cadmium/zinc-transporting ATPase HMA1 [Morus notabilis]
 gb|EXB59532.1| putative cadmium/zinc-transporting ATPase HMA1 [Morus notabilis]
Length=830

 Score =   219 bits (557),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 161/188 (86%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SALRVA AVGI EVHCSLKPEDKL HV  ISRD GG LIMVG+GINDAPALAAAT+
Sbjct  642  DHKSSALRVANAVGINEVHCSLKPEDKLSHVKEISRDMGGGLIMVGEGINDAPALAAATI  701

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLL+DNISGVPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  702  GIVLAQRASATAVAVADVLLLRDNISGVPFCIAKSRQTTSLIKQNVALALTSIVLASLPS  761

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            V+GFLPLWLTVLLHEGGTLLVCLNSIRALN+PT SW+     L+N L+  ++  R H N 
Sbjct  762  VMGFLPLWLTVLLHEGGTLLVCLNSIRALNNPTWSWRQDFWHLINELKCRLVFFREH-NT  820

Query  431  SQSTIEAA  408
            S   I+AA
Sbjct  821  SAGNIQAA  828



>gb|EYU44446.1| hypothetical protein MIMGU_mgv1a001251mg [Erythranthe guttata]
Length=853

 Score =   217 bits (552),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 159/183 (87%), Gaps = 6/183 (3%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE SA RVA AVGIKEVHCSLKPEDKL+HVT ISRD GG LIMVGDGINDAPALAAATV
Sbjct  673  DHELSAQRVANAVGIKEVHCSLKPEDKLFHVTRISRDTGGGLIMVGDGINDAPALAAATV  732

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLLQDNISGVPF VAK+RQTTSL+KQNVALAL SI +ASLTS
Sbjct  733  GIVLADRASATAIAVADILLLQDNISGVPFSVAKSRQTTSLVKQNVALALGSIFLASLTS  792

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLG LPLWLTVLLHEGGTLLVCLNSIRALN PT SW+  ++QL++RL+S +      G N
Sbjct  793  VLGVLPLWLTVLLHEGGTLLVCLNSIRALNSPTWSWRSDLVQLIHRLKSFVT-----GGN  847

Query  431  SQS  423
             Q+
Sbjct  848  YQA  850



>ref|NP_001237439.1| SOYCTA protein [Glycine max]
 gb|AAB81947.1| putative cadmium-transporting ATPase [Glycine max]
Length=329

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI E HC+LKPEDKL HV  ISRD GG LIMVG+GINDAPALAAATV
Sbjct  136  DHESSARRVASAVGINEFHCNLKPEDKLSHVKDISRDMGGGLIMVGEGINDAPALAAATV  195

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL++NIS VPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  196  GIVLAHRASATAIAVADVLLLRENISAVPFCIAKSRQTTSLIKQNVALALTSIVMASLPS  255

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN+P+ SW+  I  L++ ++S ++ L+ +   
Sbjct  256  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNEPSWSWKHDISHLISEIKSRLLSLKTNITG  315

Query  431  SQSTIEA  411
            S S + A
Sbjct  316  SNSIMTA  322



>ref|XP_011006989.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Populus euphratica]
Length=830

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 163/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAVGI EV+CSLKPEDKL  V  ISRD GG L+MVG+GINDAPALAAATV
Sbjct  642  DHESSAWRVAKAVGISEVYCSLKPEDKLNQVKGISRDMGGGLVMVGEGINDAPALAAATV  701

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+D ISGVPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  702  GIVLAQRASATAIAVADVLLLRDTISGVPFCIAKSRQTTSLIKQNVALALTSIFLASLPS  761

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP  SW+  + Q+V +L+S +M L+   + 
Sbjct  762  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPKWSWRYDLQQVVEKLKSRVM-LKVTDDT  820

Query  431  SQSTIEAA  408
            S ST+EAA
Sbjct  821  SSSTVEAA  828



>gb|AJA36488.1| heavy metal transporter [Prosopis juliflora]
Length=269

 Score =   199 bits (505),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV  ISRD GG LIMVG+GINDAPALAAATV
Sbjct  81   DHDSSARRVAGAVGINEVYCNLKPEDKLSHVKDISRDMGGGLIMVGEGINDAPALAAATV  140

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL+++IS VPFC+AK+RQT SLIKQNVALALSSI + SL S
Sbjct  141  GIVLAHRASATAIAVADVLLLREDISAVPFCIAKSRQTNSLIKQNVALALSSIFMPSLPS  200

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIR L++P  SW+  ++QL+N+++S ++ L  + N 
Sbjct  201  VLGFLPLWLTVLLHEGGTLLVCLNSIRGLHEPAWSWKQDVLQLINKVKSRLLPLTTN-NT  259

Query  431  SQSTIEAA  408
            S S ++ A
Sbjct  260  SSSALDTA  267



>ref|XP_004287993.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=874

 Score =   210 bits (534),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+CSLKPEDKL HV  +SRD GG LIMVG+GINDAPALAAATV
Sbjct  683  DHESSAWRVANAVGINEVYCSLKPEDKLSHVKGVSRDMGGGLIMVGEGINDAPALAAATV  742

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A AVAD+LLL+DNISGVPFC+AK+RQTTSL+KQNV LALS I +ASL S
Sbjct  743  GIVLAQRASATATAVADVLLLRDNISGVPFCIAKSRQTTSLVKQNVVLALSCIVLASLPS  802

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN P+ SW+  +  L N+L+S +   RR   +
Sbjct  803  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNHPSWSWRQDLWDLFNQLKSRLEFSRRLATS  862

Query  431  SQSTIEAAAPL  399
            S  T +AA P+
Sbjct  863  SNPT-QAAPPV  872



>ref|XP_012079313.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Jatropha curcas]
 gb|KDP31998.1| hypothetical protein JCGZ_12459 [Jatropha curcas]
Length=839

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 159/189 (84%), Gaps = 2/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAVGI EVHCSLKPEDKL HV  ISRD GG LIMVG+GINDAPALAAATV
Sbjct  651  DHESSAWRVAKAVGITEVHCSLKPEDKLNHVKGISRDMGGGLIMVGEGINDAPALAAATV  710

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+D IS VPFC+AK+RQTTSL+KQNVALAL+ I +AS  S
Sbjct  711  GIVLAQRASATAIAVADVLLLRDTISSVPFCIAKSRQTTSLVKQNVALALTCIVLASFPS  770

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP  SW++ +   V  L+S  + L + G +
Sbjct  771  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPKWSWREDLWHSVKELKSKQISLEKEGTS  830

Query  431  SQSTIEAAA  405
            S S ++AA+
Sbjct  831  S-SNMQAAS  838



>gb|ADB28919.1| ATPase cadmium transporter [Zea mays subsp. mays]
Length=223

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 157/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  35   DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  94

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G+VLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  95   GMVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  154

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT S  D I +LV+ LR+         N+
Sbjct  155  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNTPTWSLVDDIRKLVDSLRN---YFPSKFNS  211

Query  431  SQSTIEA-AAPL  399
            S S+  A  APL
Sbjct  212  SPSSYTANTAPL  223



>gb|EEC81219.1| hypothetical protein OsI_24259 [Oryza sativa Indica Group]
Length=827

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  639  DHESSALRVAKAVCIDEVHCCLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  698

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALALS I  A+L S
Sbjct  699  GIVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALSCIVFAALPS  758

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QL+N LR  I    +  + 
Sbjct  759  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNSPTWSWVDDIRQLINSLRKYIS--SKLQST  816

Query  431  SQSTIEAAAPL  399
            S + +  A PL
Sbjct  817  SSNYVADAVPL  827



>gb|KJB43825.1| hypothetical protein B456_007G218200 [Gossypium raimondii]
Length=576

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 3/188 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH+ SA RVA AVGI EV+CSLKPEDKL HV  IS D GG LIMVG+GINDAPALAAATV
Sbjct  389  DHKLSAWRVANAVGINEVYCSLKPEDKLNHVKRISGDMGGGLIMVGEGINDAPALAAATV  448

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQNVALAL+ I +ASL S
Sbjct  449  GIVLAHRASATAIAVADVLLLQDNISGVPFSIAKARQTTSLVKQNVALALTCIILASLPS  508

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP+ SW   +  L+ +L+S + +LR   N 
Sbjct  509  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPSWSWGQDLRNLIGKLKSKLALLRH--NA  566

Query  431  SQSTIEAA  408
            + STI+ A
Sbjct  567  TSSTIQTA  574



>gb|EEE66260.1| hypothetical protein OsJ_22445 [Oryza sativa Japonica Group]
Length=803

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  615  DHESSALRVAKAVCIDEVHCCLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  674

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALALS I  A+L S
Sbjct  675  GIVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALSCIVFAALPS  734

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVI  459
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QL+N LR  I
Sbjct  735  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNSPTWSWVDDIRQLINSLRKYI  785


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRD  858
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++SR+
Sbjct  531  DHESSALRVAKAVCIDEVHCCLKPEDKLNKVKAVSRE  567



>ref|NP_001058417.1| Os06g0690700 [Oryza sativa Japonica Group]
 dbj|BAD45628.1| putative cadmium resistance protein [Oryza sativa Japonica Group]
 dbj|BAD54505.1| putative cadmium resistance protein [Oryza sativa Japonica Group]
 dbj|BAF20331.1| Os06g0690700 [Oryza sativa Japonica Group]
Length=822

 Score =   207 bits (528),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  634  DHESSALRVAKAVCIDEVHCCLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  693

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALALS I  A+L S
Sbjct  694  GIVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALSCIVFAALPS  753

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVI  459
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QL+N LR  I
Sbjct  754  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNSPTWSWVDDIRQLINSLRKYI  804



>gb|KEH31492.1| cadmium/zinc-transporting ATPase, putative [Medicago truncatula]
Length=818

 Score =   207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 1/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE SA RVA AVGIKE HC+LKPEDKL HV  ISRD GG LIMVG+GINDAPALAAATV
Sbjct  630  DHEYSARRVASAVGIKEFHCNLKPEDKLRHVKDISRDMGGGLIMVGEGINDAPALAAATV  689

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL++NIS VPFC+AK+RQTTSLIKQNVALALSSI +ASL S
Sbjct  690  GIVLAHRASATAIAVADVLLLRENISAVPFCIAKSRQTTSLIKQNVALALSSIFLASLPS  749

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLW+TVLLHEGGTLLVCLNSIR LN+P+ SW+  I+QL+  ++S +  LR++   
Sbjct  750  VLGFLPLWITVLLHEGGTLLVCLNSIRGLNEPSWSWKHDILQLIGEVKSRLPSLRKNITG  809

Query  431  SQSTIEA  411
            S S   A
Sbjct  810  SSSITTA  816



>ref|XP_006466544.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Citrus sinensis]
Length=808

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+CSLKPEDKL HV S SRD GG LIMVG+GINDAPALAAATV
Sbjct  620  DHESSAQRVANAVGINEVYCSLKPEDKLNHVKSTSRDMGGGLIMVGEGINDAPALAAATV  679

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL++NISGVPFCVAK+RQTTSL+KQNVALALS I +ASL S
Sbjct  680  GIVLAQRASATAIAVADVLLLRNNISGVPFCVAKSRQTTSLVKQNVALALSCIILASLPS  739

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTL+VCLNS+RALNDP+ SW+  I  L+N+ +S   VL++    
Sbjct  740  VLGFLPLWLTVLLHEGGTLVVCLNSVRALNDPSWSWRQDIQHLINQFKSKHSVLQKKDAR  799

Query  431  SQSTIEAAA  405
            S +T+ AA+
Sbjct  800  S-NTMPAAS  807



>emb|CAE45019.1| putative P1B-type metal ATPase [Arabidopsis halleri subsp. halleri]
Length=182

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  953  ALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATVGivla  777
            A RVA AVGI EV+C+LKPEDKL HV +ISR+ GG LIMVG+GINDAPALAAAT+GIVLA
Sbjct  1    AWRVANAVGITEVYCNLKPEDKLNHVKNISREAGGGLIMVGEGINDAPALAAATIGIVLA  60

Query  776  erasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsvLGFL  597
            +RASA AIAVADILLL+D I+GVPFCVAK+RQTTSL+KQNVALAL+SI VA+L SVLGF+
Sbjct  61   QRASATAIAVADILLLRDTITGVPFCVAKSRQTTSLVKQNVALALTSIFVAALPSVLGFV  120

Query  596  PLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I+ L+N+L S
Sbjct  121  PLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIVHLINKLSS  164



>ref|XP_009367661.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Pyrus x bretschneideri]
Length=830

 Score =   206 bits (523),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA +VGI EV+CSLKPEDKL HV  +SRD GG LIMVG+GINDAPALAAATV
Sbjct  642  DHDSSAWRVANSVGINEVYCSLKPEDKLSHVKDVSRDTGGGLIMVGEGINDAPALAAATV  701

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A AVAD+LLL+DNIS VPFC+AK+RQTT+L+KQ+VALALS I +ASL S
Sbjct  702  GIVLAQRASATATAVADVLLLRDNISAVPFCIAKSRQTTALVKQSVALALSCIILASLPS  761

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW+  ++ LVN L+S  ++  R   +
Sbjct  762  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNHPTWSWRQDLLHLVNELKSK-LISPRTLKS  820

Query  431  SQSTIEAAA  405
            S +TI+AAA
Sbjct  821  SGNTIQAAA  829



>ref|XP_008391510.1| PREDICTED: LOW QUALITY PROTEIN: probable cadmium/zinc-transporting 
ATPase HMA1, chloroplastic [Malus domestica]
Length=835

 Score =   205 bits (522),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA +VGI EV+CSLKPEDKL HV  +SRD GG LIMVG+GINDAPALAAATV
Sbjct  647  DHDSSAWRVANSVGINEVYCSLKPEDKLSHVKDVSRDTGGGLIMVGEGINDAPALAAATV  706

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+DNIS VPFC+AK+RQTT+L+KQ+VALALS I +ASL S
Sbjct  707  GIVLAQRASATAIAVADVLLLRDNISAVPFCIAKSRQTTALVKQSVALALSCIILASLPS  766

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW+  ++ LVN L+S  ++  R   +
Sbjct  767  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNHPTWSWRQDLLHLVNELKSK-LISPRTLQS  825

Query  431  SQSTIEAAA  405
            S +TI+AAA
Sbjct  826  SGNTIQAAA  834



>gb|KJB43826.1| hypothetical protein B456_007G218200 [Gossypium raimondii]
Length=826

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 3/188 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH+ SA RVA AVGI EV+CSLKPEDKL HV  IS D GG LIMVG+GINDAPALAAATV
Sbjct  639  DHKLSAWRVANAVGINEVYCSLKPEDKLNHVKRISGDMGGGLIMVGEGINDAPALAAATV  698

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQNVALAL+ I +ASL S
Sbjct  699  GIVLAHRASATAIAVADVLLLQDNISGVPFSIAKARQTTSLVKQNVALALTCIILASLPS  758

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP+ SW   +  L+ +L+S + +LR   N 
Sbjct  759  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPSWSWGQDLRNLIGKLKSKLALLRH--NA  816

Query  431  SQSTIEAA  408
            + STI+ A
Sbjct  817  TSSTIQTA  824



>ref|XP_006656409.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Oryza brachyantha]
Length=831

 Score =   205 bits (522),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++SR+  GGLIMVGDGINDAPALAAATV
Sbjct  643  DHESSALRVAKAVCINEVHCCLKPEDKLNKVKAVSREGVGGLIMVGDGINDAPALAAATV  702

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALALS I  A+L S
Sbjct  703  GIVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALSCIVFAALPS  762

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR  468
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QL++ LR
Sbjct  763  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNSPTWSWVDDIRQLIDSLR  810



>gb|KHN02627.1| Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Glycine soja]
Length=824

 Score =   205 bits (521),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI E HC+LKPEDKL HV  ISRD GG LIMVG+GINDAPALAAATV
Sbjct  636  DHESSARRVASAVGINEFHCNLKPEDKLSHVKDISRDMGGGLIMVGEGINDAPALAAATV  695

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL++NIS VPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  696  GIVLAHRASATAIAVADVLLLRENISAVPFCIAKSRQTTSLIKQNVALALTSIVMASLPS  755

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN+P+ SW+  I  L++ ++S ++ L+ +   
Sbjct  756  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNEPSWSWKHDISHLISEIKSRLLSLKTNITG  815

Query  431  SQSTIEA  411
            S S + A
Sbjct  816  SNSIMTA  822



>dbj|BAJ33604.1| unnamed protein product [Thellungiella halophila]
Length=497

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDK  HV +I+RD GG LIMVG+GINDAPALAAATV
Sbjct  312  DHDSSAWRVANAVGITEVYCNLKPEDKPNHVKNIARDAGGGLIMVGEGINDAPALAAATV  371

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  372  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  431

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+N+L S
Sbjct  432  VLGFLPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIAHLINKLSS  480



>ref|XP_006425990.1| hypothetical protein CICLE_v10024910mg [Citrus clementina]
 gb|ESR39230.1| hypothetical protein CICLE_v10024910mg [Citrus clementina]
Length=808

 Score =   204 bits (520),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+CSLKPEDKL HV   SRD GG LIMVG+GINDAPALAAATV
Sbjct  620  DHESSAQRVANAVGINEVYCSLKPEDKLNHVKRTSRDMGGGLIMVGEGINDAPALAAATV  679

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL++NISGVPFCVAK+RQTTSL+KQNVALALS I +ASL S
Sbjct  680  GIVLAQRASATAIAVADVLLLRNNISGVPFCVAKSRQTTSLVKQNVALALSCIILASLPS  739

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTL+VCLNS+RALNDP+ SW+  I  L+N+ +S   VL++    
Sbjct  740  VLGFLPLWLTVLLHEGGTLVVCLNSVRALNDPSWSWRQDIQHLINQFKSKHSVLQKKDAR  799

Query  431  SQSTIEAAA  405
            S +T+ AA+
Sbjct  800  S-NTMPAAS  807



>gb|KDO79066.1| hypothetical protein CISIN_1g003598mg [Citrus sinensis]
Length=808

 Score =   204 bits (520),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 161/189 (85%), Gaps = 2/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+CSLKPEDKL HV   SRD GG LIMVG+GINDAPALAAATV
Sbjct  620  DHESSAQRVANAVGINEVYCSLKPEDKLNHVKRTSRDMGGGLIMVGEGINDAPALAAATV  679

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL++NISGVPFCVAK+RQTTSL+KQNVALALS I +ASL S
Sbjct  680  GIVLAQRASATAIAVADVLLLRNNISGVPFCVAKSRQTTSLVKQNVALALSCIILASLPS  739

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTL+VCLNS+RALNDP+ SW+  I  L+N+ +S   VL++    
Sbjct  740  VLGFLPLWLTVLLHEGGTLVVCLNSVRALNDPSWSWRQDIQHLINQFKSKHSVLQKKDAR  799

Query  431  SQSTIEAAA  405
            S +T+ AA+
Sbjct  800  S-NTMPAAS  807



>ref|XP_009137459.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Brassica rapa]
Length=818

 Score =   204 bits (520),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+RD GG LIMVG+GINDAPALAAATV
Sbjct  633  DHDSSAWRVANAVGISEVYCNLKPEDKLNHVKNIARDAGGGLIMVGEGINDAPALAAATV  692

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  693  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  752

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  LVN+L S
Sbjct  753  VLGFLPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIAHLVNKLSS  801



>gb|KFK30352.1| hypothetical protein AALP_AA7G250400 [Arabis alpina]
Length=823

 Score =   204 bits (520),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+RD GG LIMVG+GINDAPALAAATV
Sbjct  636  DHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIARDAGGGLIMVGEGINDAPALAAATV  695

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  696  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  755

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNSIR LNDP+ SW+  I  L+N+L S
Sbjct  756  VLGFLPLWLTVLLHEGGTLLVCLNSIRGLNDPSWSWKQDIAHLINKLSS  804



>gb|AAY34978.1| chloroplast heavy metal P-type ATPase precursor [Arabidopsis 
thaliana]
Length=819

 Score =   204 bits (520),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+R+ GG LIMVG+GINDAPALAAATV
Sbjct  636  DHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATV  695

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  696  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  755

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I+ L+N+LRS
Sbjct  756  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIVHLINKLRS  804



>ref|NP_195444.1| putative cadmium/zinc-transporting ATPase HMA1 [Arabidopsis thaliana]
 sp|Q9M3H5.2|HMA1_ARATH RecName: Full=Probable cadmium/zinc-transporting ATPase HMA1, 
chloroplastic; AltName: Full=Protein HEAVY METAL ATPASE 1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB16773.1| Cu2+-transporting ATPase-like protein [Arabidopsis thaliana]
 emb|CAB80393.1| Cu2+-transporting ATPase-like protein [Arabidopsis thaliana]
 emb|CAI43274.1| putative metal-transporting ATPase [Arabidopsis thaliana]
 gb|AEE86775.1| putative cadmium/zinc-transporting ATPase HMA1 [Arabidopsis thaliana]
Length=819

 Score =   204 bits (519),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+R+ GG LIMVG+GINDAPALAAATV
Sbjct  636  DHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATV  695

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  696  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  755

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I+ L+N+LRS
Sbjct  756  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIVHLINKLRS  804



>emb|CDX69288.1| BnaC01g01650D [Brassica napus]
Length=819

 Score =   204 bits (519),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+RD GG LIMVG+GINDAPALAAATV
Sbjct  634  DHDSSAWRVANAVGISEVYCNLKPEDKLNHVKNIARDAGGGLIMVGEGINDAPALAAATV  693

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSLIKQNVALAL+SI +A+L S
Sbjct  694  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLIKQNVALALTSIFLAALPS  753

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+N+L S
Sbjct  754  VLGFLPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIAHLINKLSS  802



>ref|XP_009417706.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=861

 Score =   204 bits (519),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE SA+R+AK VGI EV+C LKPE+KL  V + SRD+GG LIMVGDGINDAPALAAATV
Sbjct  672  DHELSAMRIAKIVGIDEVYCCLKPEEKLNRVKTTSRDRGGGLIMVGDGINDAPALAAATV  731

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A AVAD+LLLQDNI+GVPFC+AKARQTTSL+KQ+VALALS I  ASL S
Sbjct  732  GIVLAQRASATATAVADVLLLQDNITGVPFCIAKARQTTSLVKQSVALALSCIVFASLPS  791

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            V G+LPLWLTVLLHEGGTLLVCLNS+RALN+PT SW++ + Q + +L+ V++ L +   +
Sbjct  792  VFGYLPLWLTVLLHEGGTLLVCLNSVRALNNPTWSWKEDLRQALYQLKKVLVDLTKWRPS  851

Query  431  SQSTIEAAA  405
              STI+ +A
Sbjct  852  WNSTIQPSA  860



>emb|CDX75636.1| BnaA01g00660D [Brassica napus]
Length=817

 Score =   204 bits (519),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+RD GG LIMVG+GINDAPALAAATV
Sbjct  632  DHDSSAWRVANAVGISEVYCNLKPEDKLNHVKNIARDAGGGLIMVGEGINDAPALAAATV  691

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  692  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  751

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+N+L S
Sbjct  752  VLGFLPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIAHLINKLSS  800



>ref|XP_004509102.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Cicer arietinum]
Length=839

 Score =   204 bits (519),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE SA RVAKAVGI E HC+LKPEDKL HV   SRD GG LIMVG+GINDAPALAAATV
Sbjct  651  DHEYSARRVAKAVGINEFHCNLKPEDKLSHVKDTSRDMGGGLIMVGEGINDAPALAAATV  710

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL++NI+ VPFC+AK+RQTTSLIKQNVALAL  I +ASL S
Sbjct  711  GIVLAHRASATAIAVADVLLLRENITAVPFCIAKSRQTTSLIKQNVALALFCIVMASLPS  770

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RAL++P+ SW+  I+QL+  ++S +  LR +  +
Sbjct  771  VLGFLPLWLTVLLHEGGTLLVCLNSVRALHEPSWSWKHDILQLIGEVKSTLPSLRTNITS  830

Query  431  SQSTIEA  411
            S S   A
Sbjct  831  SSSVTTA  837



>ref|XP_010271184.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=831

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+ A RVA +VGI EV+  LKPEDKL  V +ISRD GG LIMVGDGINDAPALAAATV
Sbjct  643  DHESIAWRVANSVGINEVYSGLKPEDKLNQVKTISRDAGGGLIMVGDGINDAPALAAATV  702

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPFC+AKARQTTSL+KQ+V LALS I  ASL S
Sbjct  703  GIVLAQRASATAIAVADVLLLQDNISGVPFCIAKARQTTSLVKQSVVLALSCIVFASLPS  762

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPT SW+  +  +++RL+S I    R    
Sbjct  763  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTWSWKQDLQHILDRLKSTISCFCRRLPT  822

Query  431  SQSTIEA  411
            S STI+A
Sbjct  823  S-STIQA  828



>ref|XP_010271194.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=793

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+ A RVA +VGI EV+  LKPEDKL  V +ISRD GG LIMVGDGINDAPALAAATV
Sbjct  605  DHESIAWRVANSVGINEVYSGLKPEDKLNQVKTISRDAGGGLIMVGDGINDAPALAAATV  664

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPFC+AKARQTTSL+KQ+V LALS I  ASL S
Sbjct  665  GIVLAQRASATAIAVADVLLLQDNISGVPFCIAKARQTTSLVKQSVVLALSCIVFASLPS  724

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPT SW+  +  +++RL+S I    R    
Sbjct  725  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTWSWKQDLQHILDRLKSTISCFCRRLPT  784

Query  431  SQSTIEA  411
            S STI+A
Sbjct  785  S-STIQA  790



>ref|XP_009798582.1| PREDICTED: LOW QUALITY PROTEIN: probable cadmium/zinc-transporting 
ATPase HMA1, chloroplastic [Nicotiana sylvestris]
Length=802

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = -2

Query  911  CSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVGivlaerasaaaiavadill  732
            CSLKPEDKL+HVTSISRD GGLIMVGDGINDAPALAAATVGIVLAERASAAAIAVAD+LL
Sbjct  635  CSLKPEDKLFHVTSISRDTGGLIMVGDGINDAPALAAATVGIVLAERASAAAIAVADVLL  694

Query  731  LQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsvLGFLPLWLTVLLHEGGTLL  552
            LQDNISGVPFCVAK+RQTTSLIKQNVALALSSI +ASLTSVLG LPLWLTVLLHEGGTLL
Sbjct  695  LQDNISGVPFCVAKSRQTTSLIKQNVALALSSILLASLTSVLGVLPLWLTVLLHEGGTLL  754

Query  551  VCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNNSQSTIEAA  408
            VCLNS+RALN PT SW++ + Q++++L S+IM L RHG    STI+AA
Sbjct  755  VCLNSVRALNPPTWSWREDVSQMIDKLHSLIMFL-RHG-TLPSTIQAA  800



>ref|XP_006411908.1| hypothetical protein EUTSA_v10024415mg [Eutrema salsugineum]
 gb|ESQ53361.1| hypothetical protein EUTSA_v10024415mg [Eutrema salsugineum]
Length=822

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+RD GG LIMVG+GINDAPALAAATV
Sbjct  637  DHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIARDAGGGLIMVGEGINDAPALAAATV  696

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  697  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  756

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+N+L S
Sbjct  757  VLGFLPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIAHLINKLSS  805



>ref|XP_007047396.1| Heavy metal atpase 1 [Theobroma cacao]
 gb|EOX91553.1| Heavy metal atpase 1 [Theobroma cacao]
Length=813

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 4/191 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+CSLKPEDKL HV  ISR+ GG L MVG+GINDAPALAAATV
Sbjct  626  DHKSSAWRVANAVGINEVYCSLKPEDKLNHVKRISRETGGGLSMVGEGINDAPALAAATV  685

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL+DNIS VPF +AKARQTTSL+KQNVALAL+ I +ASL S
Sbjct  686  GIVLAHRASATAIAVADVLLLRDNISCVPFSIAKARQTTSLVKQNVALALTCIILASLPS  745

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALNDP+ SW+  ++ L+++L+S + +LR   +N
Sbjct  746  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNDPSWSWKQDLLHLISKLKSELTLLR---HN  802

Query  431  SQSTIEAAAPL  399
            + S+    APL
Sbjct  803  TSSSTTQPAPL  813



>ref|XP_007155886.1| hypothetical protein PHAVU_003G240100g [Phaseolus vulgaris]
 gb|ESW27880.1| hypothetical protein PHAVU_003G240100g [Phaseolus vulgaris]
Length=826

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI E HC+LKPEDKL HV   SRD GG LIMVG+GINDAPALAAATV
Sbjct  643  DHESSARRVASAVGINEFHCNLKPEDKLSHVKDTSRDMGGGLIMVGEGINDAPALAAATV  702

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVADILLL++NIS VPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  703  GIVLAHRASATAIAVADILLLRENISAVPFCIAKSRQTTSLIKQNVALALTSIVMASLPS  762

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRR  444
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN+P+ SW+  I+ L+++++S ++ L++
Sbjct  763  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNEPSWSWKHDILHLISQIKSSLLSLKQ  818



>ref|XP_010526721.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=569

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA +VGI EV+C+LKPEDKL HV +ISRD GG LIMVG+GINDAPALAAATV
Sbjct  387  DHQSSAWRVANSVGINEVYCNLKPEDKLNHVKNISRDAGGGLIMVGEGINDAPALAAATV  446

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+DNISGVPFCVAK+RQTT L+KQNVALALSSI +A+L S
Sbjct  447  GIVLAQRASATAIAVADVLLLRDNISGVPFCVAKSRQTTFLVKQNVALALSSIFLAALPS  506

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNSIR LNDP+ SW+  I  L  + RS
Sbjct  507  VLGFLPLWLTVLLHEGGTLLVCLNSIRGLNDPSWSWRQDISHLFGKFRS  555



>ref|XP_002866960.1| hypothetical protein ARALYDRAFT_490893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43219.1| hypothetical protein ARALYDRAFT_490893 [Arabidopsis lyrata subsp. 
lyrata]
Length=826

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+R+ GG LIMVG+GINDAPALAAATV
Sbjct  640  DHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATV  699

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQN+ALAL+SI +A+L S
Sbjct  700  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNIALALTSIFLAALPS  759

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I+ L+N+L S
Sbjct  760  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIVHLINKLSS  808



>ref|XP_010927512.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=836

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA  VGI EVHC LKPEDKL  V S SRD+GG LIMVGDGINDAPALAAATV
Sbjct  647  DHESSARRVANTVGINEVHCCLKPEDKLNQVKSASRDRGGGLIMVGDGINDAPALAAATV  706

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQ+VALAL+ I  ASL S
Sbjct  707  GIVLAQRASATAIAVADVLLLQDNISGVPFVIAKARQTTSLVKQSVALALTCIFFASLPS  766

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN+PT SW   + QLV+ LR  +  L  +   
Sbjct  767  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNNPTWSWLQDLRQLVDGLRKAVADL-LNKRP  825

Query  431  SQSTIEAAAPL  399
             +S I  AAPL
Sbjct  826  PRSHIIQAAPL  836



>ref|XP_003550994.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Glycine max]
 gb|KHN27067.1| Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Glycine soja]
Length=817

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA  VGI E HC+LKPEDKL HV  ISRD GG LIMVG+GINDAPALAAATV
Sbjct  629  DHESSARRVASGVGINEFHCNLKPEDKLSHVKDISRDMGGGLIMVGEGINDAPALAAATV  688

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA AIAVAD+LLL+++IS VPFC+AK+RQTTSLIKQNVALAL+SI +ASL S
Sbjct  689  GIVLAHRASATAIAVADVLLLRESISAVPFCIAKSRQTTSLIKQNVALALTSILMASLPS  748

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN+P+ SW+  I  L++ ++S ++ L+ +   
Sbjct  749  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNEPSWSWKHDIFHLISEIKSRLLSLKTNITG  808

Query  431  SQSTI  417
            S S I
Sbjct  809  SNSII  813



>ref|XP_008798716.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Phoenix dactylifera]
Length=673

 Score =   201 bits (510),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA  VGI EVHC LKPEDKL  V S SRD GG LIMVGDGINDAPALAAATV
Sbjct  484  DHESSARRVADTVGINEVHCCLKPEDKLNKVKSASRDTGGGLIMVGDGINDAPALAAATV  543

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RAS  AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQ+VALALS I  ASL S
Sbjct  544  GIVLAQRASGTAIAVADVLLLQDNISGVPFVIAKARQTTSLVKQSVALALSCIFFASLPS  603

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN+P  SW   + QLV+RLR  +  L      
Sbjct  604  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNNPAWSWLQDLQQLVDRLRKSVADLFNKRPP  663

Query  431  SQSTIEAA  408
                I+AA
Sbjct  664  RNHVIQAA  671



>ref|XP_002524927.1| heavy metal cation transport atpase, putative [Ricinus communis]
 gb|EEF37424.1| heavy metal cation transport atpase, putative [Ricinus communis]
Length=820

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAK+VGI EVH SLKPEDKL HV  I+RD GG LIMVG+GINDAPALAAATV
Sbjct  632  DHESSAWRVAKSVGISEVHYSLKPEDKLNHVKGITRDMGGGLIMVGEGINDAPALAAATV  691

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+D+ISG+PFC+AK+RQTTSL+KQNVALAL+ I +ASL S
Sbjct  692  GIVLAQRASATAIAVADILLLRDDISGIPFCIAKSRQTTSLVKQNVALALTCIVLASLPS  751

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP  SW++ +  +V    +  ++ R   N 
Sbjct  752  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPKWSWREDLSHVVKEF-NCRLIPRWTDNT  810

Query  431  SQSTIEAA  408
            S  +I+AA
Sbjct  811  SSGSIQAA  818



>emb|CAB90352.1| putative metal ATPase [Arabidopsis thaliana]
Length=819

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LK EDKL HV +I+R+ GG LIMVG+GINDAPALAAATV
Sbjct  636  DHDSSAWRVANAVGITEVYCNLKSEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATV  695

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  696  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  755

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I+ L+N+LRS
Sbjct  756  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDIVHLINKLRS  804



>gb|AHW50672.1| cadmium/zinc-transporting ATPase HMA1 [Nicotiana tabacum]
Length=805

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = -2

Query  926  IKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVGivlaerasaaaiav  747
            +   + SLKPEDKL+HVTSISRD GGLIMVGDGINDAPALAAATVGIVLAERASAAAIAV
Sbjct  633  VSRSYYSLKPEDKLFHVTSISRDTGGLIMVGDGINDAPALAAATVGIVLAERASAAAIAV  692

Query  746  adillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsvLGFLPLWLTVLLHE  567
            AD+LLLQDNISGVPFCVAK+RQTTSLIKQNVALALSSI +ASLTSVLG LPLWLTVLLHE
Sbjct  693  ADVLLLQDNISGVPFCVAKSRQTTSLIKQNVALALSSILLASLTSVLGVLPLWLTVLLHE  752

Query  566  GGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNNSQSTIEAA  408
            GGTLLVCLNS+RALN PT SW++ + Q++++L S+IM L RHG    STI+AA
Sbjct  753  GGTLLVCLNSVRALNPPTWSWREDVSQMIDKLHSLIMFL-RHG-TLPSTIQAA  803



>ref|XP_009588513.1| PREDICTED: LOW QUALITY PROTEIN: probable cadmium/zinc-transporting 
ATPase HMA1, chloroplastic [Nicotiana tomentosiformis]
Length=812

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = -2

Query  908  SLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVGivlaerasaaaiavadillL  729
            SLKPEDKL+HVTSISRD GGLIMVGDGINDAPALAAATVGIVLAERASAAAIAVAD+LLL
Sbjct  646  SLKPEDKLFHVTSISRDTGGLIMVGDGINDAPALAAATVGIVLAERASAAAIAVADVLLL  705

Query  728  QDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsvLGFLPLWLTVLLHEGGTLLV  549
            QDNISGVPFCVAK+RQTTSLIKQNVALALSSI +ASLTSVLG LPLWLTVLLHEGGTLLV
Sbjct  706  QDNISGVPFCVAKSRQTTSLIKQNVALALSSILLASLTSVLGVLPLWLTVLLHEGGTLLV  765

Query  548  CLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNNSQSTIEAA  408
            CLNS+RALN PT SW++ + Q++++L S+IM L RHG    STI+AA
Sbjct  766  CLNSVRALNPPTWSWREDVSQMIDKLHSLIMFL-RHG-TLPSTIQAA  810



>ref|XP_008462846.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Cucumis melo]
Length=823

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 16/198 (8%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGIKEVH SLKPEDKL HV SISR+ GG LIMVG+GINDAPALAAATV
Sbjct  634  DHESSARRVANAVGIKEVHFSLKPEDKLSHVKSISRENGGGLIMVGEGINDAPALAAATV  693

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+DNISGVPFC+AK+RQTT+L+KQN +LAL  I VASL +
Sbjct  694  GIVLAQRASATAIAVADVLLLRDNISGVPFCIAKSRQTTALVKQNASLALFFIFVASLPA  753

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSW---QDSIIQLVNRLRSVIMVLRRH  441
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN+P+ SW   QD        L+  +M L+  
Sbjct  754  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNNPSWSWSWGQD--------LKQFLMELKFK  805

Query  440  GN----NSQSTIEAAAPL  399
            G+    N+ ST   ++P+
Sbjct  806  GSQPRLNTSSTTVQSSPV  823



>ref|XP_010526719.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=826

 Score =   199 bits (507),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA +VGI EV+C+LKPEDKL HV +ISRD GG LIMVG+GINDAPALAAATV
Sbjct  644  DHQSSAWRVANSVGINEVYCNLKPEDKLNHVKNISRDAGGGLIMVGEGINDAPALAAATV  703

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+DNISGVPFCVAK+RQTT L+KQNVALALSSI +A+L S
Sbjct  704  GIVLAQRASATAIAVADVLLLRDNISGVPFCVAKSRQTTFLVKQNVALALSSIFLAALPS  763

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNSIR LNDP+ SW+  I  L  + RS
Sbjct  764  VLGFLPLWLTVLLHEGGTLLVCLNSIRGLNDPSWSWRQDISHLFGKFRS  812



>gb|EMS55611.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Triticum urartu]
Length=715

 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++SR  G LIMVGDGINDAPALAAATVG
Sbjct  529  DHESSALRVAKAVCIDEVHCCLKPEDKLSKVKAVSRGGGSLIMVGDGINDAPALAAATVG  588

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            +VLA+RASA A+A AD+LLLQDNI GVPFC+AKARQTTSL+KQ+V LAL+ I +A+L+SV
Sbjct  589  VVLAQRASATAVAAADVLLLQDNICGVPFCIAKARQTTSLVKQSVGLALTCILLAALSSV  648

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVI  459
            LGFLPLWLTVL+HEGGTLLVCLNSI+ALN PT S  D I QLV+ LR  I
Sbjct  649  LGFLPLWLTVLVHEGGTLLVCLNSIQALNAPTWSLADEIRQLVDGLRKYI  698



>ref|XP_008238762.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Prunus mume]
Length=825

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+ SLKPEDKL HV  +SRD GG LIMVG+GINDAPALAAATV
Sbjct  629  DHESSAWRVANAVGINEVYSSLKPEDKLSHVKDVSRDMGGGLIMVGEGINDAPALAAATV  688

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A AVAD+LLL+DNIS VPFC+AK+RQTTSL+KQ+V LALS I +ASL S
Sbjct  689  GIVLAQRASATATAVADVLLLRDNISVVPFCIAKSRQTTSLVKQSVGLALSCIVLASLPS  748

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTL+VCLNSIRALN PT SW+  +  LV  L+S  +VL +  N 
Sbjct  749  VLGFLPLWLTVLLHEGGTLVVCLNSIRALNHPTWSWRQDLWHLVCELKSR-LVLPKKLNT  807

Query  431  SQSTIEAA  408
            S +T++ A
Sbjct  808  SSNTVQPA  815



>dbj|BAK06002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   197 bits (500),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  640  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  699

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDN+  VPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  700  GIVLAQRASATAVAVADVLLLQDNLCVVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  759

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVI  459
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QLV+ L++ +
Sbjct  760  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNPPTWSWADDIRQLVHSLKNYV  810



>ref|XP_007208172.1| hypothetical protein PRUPE_ppa001453mg [Prunus persica]
 gb|EMJ09371.1| hypothetical protein PRUPE_ppa001453mg [Prunus persica]
Length=825

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+ SLKPEDKL HV  +SRD GG LIMVG+GINDAPALAAATV
Sbjct  629  DHESSAWRVANAVGINEVYSSLKPEDKLSHVKDVSRDMGGGLIMVGEGINDAPALAAATV  688

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A AVAD+LLL+DNIS VPFC+AK+RQTTSL+KQ+V LALS I +ASL S
Sbjct  689  GIVLAQRASATATAVADVLLLRDNISVVPFCIAKSRQTTSLVKQSVGLALSCIVLASLPS  748

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTL+VCLNSIRALN PT SW+  +  LV  L+S  +VL +  N 
Sbjct  749  VLGFLPLWLTVLLHEGGTLVVCLNSIRALNHPTWSWRQDLWHLVCELKSR-LVLPKKLNT  807

Query  431  SQSTIEAA  408
            S +T + A
Sbjct  808  SSNTAQPA  815



>emb|CCC14999.1| heavy metal ATPase 1 [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   196 bits (498),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  640  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  699

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDN+  VPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  700  GIVLAQRASATAVAVADVLLLQDNLCVVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  759

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVI  459
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QLV+ L++ +
Sbjct  760  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNPPTWSWADDIRQLVHSLKNYV  810



>emb|CDY67922.1| BnaC08g49210D [Brassica napus]
Length=238

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+C+LKPEDKL HV +ISRD  GGLIMVG+GIND PALAAATV
Sbjct  86   DHESSAWRVANAVGIDEVYCNLKPEDKLNHVKNISRDSGGGLIMVGEGINDGPALAAATV  145

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G VLA+RAS  AIAVAD+LLL+DNI+GVPFC+AK+RQTT+L+KQNVA+AL+ I +A+L S
Sbjct  146  GFVLAQRASGTAIAVADVLLLRDNITGVPFCIAKSRQTTTLVKQNVAIALTLILLAALPS  205

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPT  513
            VLG+LPLWLTVLLHEGGTLLVCLNSIR LNDP+
Sbjct  206  VLGYLPLWLTVLLHEGGTLLVCLNSIRGLNDPS  238



>ref|XP_003560477.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Brachypodium distachyon]
Length=819

 Score =   196 bits (498),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 152/187 (81%), Gaps = 4/187 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SALRVAKAV I EVH SLKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  631  DHESSALRVAKAVCIDEVHWSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  690

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDN+  VPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  691  GIVLAQRASATAVAVADVLLLQDNLCVVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  750

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT SW D I QL + +R     +    N+
Sbjct  751  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNPPTWSWADDIRQLFDAIRK---FMSEKLNS  807

Query  431  SQSTIEA  411
            S S   A
Sbjct  808  SSSNFSA  814



>dbj|BAJ89769.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=774

 Score =   196 bits (497),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE+SALRVAKAV I EVHC LKPEDKL  V ++S   G LIMVGDGINDAPALAAATVG
Sbjct  588  DHESSALRVAKAVCIDEVHCCLKPEDKLNKVKAVSSRGGSLIMVGDGINDAPALAAATVG  647

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            +VLA+RASA A+A AD+LLLQDNI GVPFC+AKARQTTSL+KQ+V LALS I +A+L+SV
Sbjct  648  VVLAQRASATAVAAADVLLLQDNICGVPFCIAKARQTTSLVKQSVGLALSCILLAALSSV  707

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVI  459
            LGFLPLWLTVL+HEGGTLLVCLNSIRALN PT S  D I QLV+ LR  I
Sbjct  708  LGFLPLWLTVLVHEGGTLLVCLNSIRALNAPTWSLADEIRQLVDVLRKYI  757



>ref|XP_004966187.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic-like 
[Setaria italica]
Length=828

 Score =   196 bits (498),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I EVH SLKPEDKL  V ++SR++GG LIMVGDGINDAPALAAATV
Sbjct  640  DHESSAQRVAKAVCIDEVHFSLKPEDKLDKVKAVSRERGGGLIMVGDGINDAPALAAATV  699

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G+VLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  700  GMVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  759

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT S  D I QL + LR+
Sbjct  760  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNTPTWSLVDDIRQLFDGLRN  808



>ref|XP_008681454.1| PREDICTED: uncharacterized protein LOC100273554 isoform X1 [Zea 
mays]
 gb|AFW69217.1| ATPase cadmium transporter [Zea mays]
Length=823

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 157/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+ GG LIMVGDGINDAPALAAATV
Sbjct  635  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  694

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G+VLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  695  GMVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  754

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN PT S  D I +LV+ LR+         N+
Sbjct  755  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNTPTWSLVDDIRKLVDSLRN---YFPSKFNS  811

Query  431  SQSTIEA-AAPL  399
            S S+  A  APL
Sbjct  812  SPSSYTANTAPL  823



>ref|XP_011623222.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Amborella trichopoda]
Length=667

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH +SA RVAKAVGI EV C LKPEDKL  V +ISR++GG LIMVGDGINDAPALAAATV
Sbjct  479  DHASSAWRVAKAVGINEVFCDLKPEDKLNQVKTISRERGGGLIMVGDGINDAPALAAATV  538

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQ+VALALS I +ASL S
Sbjct  539  GIVLAQRASATAIAVADVLLLQDNISGVPFVIAKARQTTSLVKQSVALALSCIILASLPS  598

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR-SVIMVLRRHGN  435
            V+GFLPLWLTVLLHEGGTL+VCLNSIRAL  PT SW+     ++N  + SVI  LR+   
Sbjct  599  VMGFLPLWLTVLLHEGGTLVVCLNSIRALKKPTWSWRHDFQLMLNDFKESVIGFLRK--P  656

Query  434  NSQSTIEAA  408
             ++++++AA
Sbjct  657  PTENSVQAA  665



>gb|ERN05712.1| hypothetical protein AMTR_s00006p00237340 [Amborella trichopoda]
Length=661

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH +SA RVAKAVGI EV C LKPEDKL  V +ISR++GG LIMVGDGINDAPALAAATV
Sbjct  473  DHASSAWRVAKAVGINEVFCDLKPEDKLNQVKTISRERGGGLIMVGDGINDAPALAAATV  532

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQ+VALALS I +ASL S
Sbjct  533  GIVLAQRASATAIAVADVLLLQDNISGVPFVIAKARQTTSLVKQSVALALSCIILASLPS  592

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR-SVIMVLRRHGN  435
            V+GFLPLWLTVLLHEGGTL+VCLNSIRAL  PT SW+     ++N  + SVI  LR+   
Sbjct  593  VMGFLPLWLTVLLHEGGTLVVCLNSIRALKKPTWSWRHDFQLMLNDFKESVIGFLRK--P  650

Query  434  NSQSTIEAA  408
             ++++++AA
Sbjct  651  PTENSVQAA  659



>gb|AID81882.1| heavy metal ATPase transporter 1 [Camelina sativa]
Length=819

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA  VGI EV+C+LKPEDKL H+ + +R+ GG LIMVG+GINDAPALAAATV
Sbjct  632  DHDSSAWRVANTVGITEVYCNLKPEDKLNHIKNFAREAGGGLIMVGEGINDAPALAAATV  691

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  692  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  751

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+++L S
Sbjct  752  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDISHLISKLSS  800



>ref|XP_010432073.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Camelina sativa]
Length=819

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA  VGI EV+C+LKPEDKL H+ + +R+ GG LIMVG+GINDAPALAAATV
Sbjct  632  DHDSSAWRVANTVGITEVYCNLKPEDKLNHIKNFAREAGGGLIMVGEGINDAPALAAATV  691

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  692  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  751

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+++L S
Sbjct  752  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDISHLISKLSS  800



>ref|XP_004151907.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Cucumis sativus]
Length=823

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA +VA AVGI EV+ SLKPEDKL HV  ISR+ GG LIMVG+GINDAPALAAATV
Sbjct  637  DHDSSAWKVANAVGINEVYYSLKPEDKLAHVKEISREMGGGLIMVGEGINDAPALAAATV  696

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA A AVAD+LLLQD+ISGVPFC+AK+RQTTSLIKQNV LAL+SI +ASL S
Sbjct  697  GIVLAHRASATATAVADVLLLQDSISGVPFCIAKSRQTTSLIKQNVTLALTSILLASLPS  756

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN P+ SW+  +  L++  RS    L     N
Sbjct  757  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNHPSWSWKQDLQNLIHDARS---KLNTTPEN  813

Query  431  SQSTIEAA  408
            S  TI+ A
Sbjct  814  SSGTIQTA  821



>ref|XP_011623223.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X3 [Amborella trichopoda]
Length=661

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH +SA RVAKAVGI EV C LKPEDKL  V +ISR++GG LIMVGDGINDAPALAAATV
Sbjct  473  DHASSAWRVAKAVGINEVFCDLKPEDKLNQVKTISRERGGGLIMVGDGINDAPALAAATV  532

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQ+VALALS I +ASL S
Sbjct  533  GIVLAQRASATAIAVADVLLLQDNISGVPFVIAKARQTTSLVKQSVALALSCIILASLPS  592

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR-SVIMVLRRHGN  435
            V+GFLPLWLTVLLHEGGTL+VCLNSIRAL  PT SW+     ++N  + SVI  LR+   
Sbjct  593  VMGFLPLWLTVLLHEGGTLVVCLNSIRALKKPTWSWRHDFQLMLNDFKESVIGFLRK--P  650

Query  434  NSQSTIEAA  408
             ++++++AA
Sbjct  651  PTENSVQAA  659



>ref|XP_010437243.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Camelina sativa]
Length=816

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA  VGI EV+C+LKPEDKL H+ + +R+ GG LIMVG+GINDAPALAAATV
Sbjct  632  DHDSSAWRVANTVGITEVYCNLKPEDKLNHIKNFAREAGGGLIMVGEGINDAPALAAATV  691

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  692  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  751

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+++L S
Sbjct  752  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDISHLISKLSS  800



>ref|XP_010446681.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Camelina sativa]
Length=821

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA  VGI EV+C+LKPEDKL H+ + +R+ GG LIMVG+GINDAPALAAATV
Sbjct  635  DHDSSAWRVANTVGITEVYCNLKPEDKLNHIKNFAREAGGGLIMVGEGINDAPALAAATV  694

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  695  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLVKQNVALALTSIFLAALPS  754

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRL  471
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+++L
Sbjct  755  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDISHLISKL  801



>ref|XP_011623220.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Amborella trichopoda]
Length=823

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH +SA RVAKAVGI EV C LKPEDKL  V +ISR++GG LIMVGDGINDAPALAAATV
Sbjct  635  DHASSAWRVAKAVGINEVFCDLKPEDKLNQVKTISRERGGGLIMVGDGINDAPALAAATV  694

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL+KQ+VALALS I +ASL S
Sbjct  695  GIVLAQRASATAIAVADVLLLQDNISGVPFVIAKARQTTSLVKQSVALALSCIILASLPS  754

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR-SVIMVLRRHGN  435
            V+GFLPLWLTVLLHEGGTL+VCLNSIRAL  PT SW+     ++N  + SVI  LR+   
Sbjct  755  VMGFLPLWLTVLLHEGGTLVVCLNSIRALKKPTWSWRHDFQLMLNDFKESVIGFLRK--P  812

Query  434  NSQSTIEAA  408
             ++++++AA
Sbjct  813  PTENSVQAA  821



>gb|EPS71968.1| hypothetical protein M569_02788, partial [Genlisea aurea]
Length=772

 Score =   193 bits (491),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE SA RVA AVGIKEV+C+L+PEDKLYHVT+ISRD  GGL+MVGDGINDAPALAAATV
Sbjct  619  DHELSAWRVANAVGIKEVYCNLRPEDKLYHVTTISRDAGGGLVMVGDGINDAPALAAATV  678

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVL+ERASA AIAVAD+LLLQD+I GVPFCV K+RQTTSL+KQNVALALSSI +ASLTS
Sbjct  679  GIVLSERASATAIAVADVLLLQDDIVGVPFCVEKSRQTTSLVKQNVALALSSIILASLTS  738

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSW  504
            V G LPLWLTVLLHEGGTLLVCLNSIRALNDP  SW
Sbjct  739  VFGALPLWLTVLLHEGGTLLVCLNSIRALNDP--SW  772



>ref|XP_002878674.1| hypothetical protein ARALYDRAFT_343887 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54933.1| hypothetical protein ARALYDRAFT_343887 [Arabidopsis lyrata subsp. 
lyrata]
Length=821

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 146/163 (90%), Gaps = 2/163 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG--LIMVGDGINDAPALAAAT  795
            DHE+SA RVA AVGI EV+C+LKPEDKL HV +IS   GG  LIMVG+GIND PALAAAT
Sbjct  641  DHESSAWRVANAVGIDEVYCNLKPEDKLDHVKNISEGSGGGGLIMVGEGINDGPALAAAT  700

Query  794  VGivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslt  615
            VGIVLA+RASA+AIAVAD+LLLQDNI+GVPFC+AK+RQTTSL+KQNVA+AL+SI +A+L 
Sbjct  701  VGIVLAQRASASAIAVADVLLLQDNITGVPFCIAKSRQTTSLVKQNVAIALTSIFLAALP  760

Query  614  svLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQ  486
            SVLGFLPLWLTVLLHEGGTLLVCLNSIR+LNDP+ SW+  I+ 
Sbjct  761  SVLGFLPLWLTVLLHEGGTLLVCLNSIRSLNDPSWSWKQDIVH  803



>ref|XP_008462778.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Cucumis melo]
Length=823

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 151/188 (80%), Gaps = 4/188 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA +VA AVGI EV+ SLKPEDKL HV  ISR+ GG LIMVG+GINDAPALAAATV
Sbjct  637  DHDSSAWKVANAVGINEVYYSLKPEDKLAHVKEISREMGGGLIMVGEGINDAPALAAATV  696

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA A AVAD+LLLQD+ISGVPFC+AK+RQTTSLIKQNV LAL+SI +ASL S
Sbjct  697  GIVLAHRASATATAVADVLLLQDSISGVPFCIAKSRQTTSLIKQNVTLALTSILLASLPS  756

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLGFLPLWLTVLLHEGGTLLVCLNS+RALN P+ SW+     L++  RS    L      
Sbjct  757  VLGFLPLWLTVLLHEGGTLLVCLNSVRALNHPSWSWKQDFQNLIHNARS---KLNTTPET  813

Query  431  SQSTIEAA  408
            S  TI+ A
Sbjct  814  SSGTIQTA  821



>gb|KFK32755.1| hypothetical protein AALP_AA6G284800 [Arabis alpina]
Length=804

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+ +LKPEDKL HV +ISRD GG LIMVG+GIND PALAAATV
Sbjct  622  DHESSAWRVANAVGIDEVYSNLKPEDKLNHVKNISRDSGGGLIMVGEGINDGPALAAATV  681

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL+DNI+G+PFC+AK+RQTTSL+KQNVA+AL+SI +A+L S
Sbjct  682  GIVLAQRASATAIAVADVLLLRDNITGIPFCIAKSRQTTSLVKQNVAIALTSIFLAALPS  741

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNSIR L++P+ SW+  I  ++N   S
Sbjct  742  VLGFLPLWLTVLLHEGGTLLVCLNSIRGLDNPSWSWKQDIAHVINNFNS  790



>ref|XP_010429275.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Camelina sativa]
Length=819

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 158/188 (84%), Gaps = 5/188 (3%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE+SA RVA +VGI EV+C+LKPEDKL HVT+IS D  GLIMVG+GIND PALAAATVG
Sbjct  635  DHESSARRVADSVGIDEVYCNLKPEDKLNHVTNISTD-SGLIMVGEGINDGPALAAATVG  693

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            IVLA+RASA+AIAVAD+LLLQDN++G+PFC+AK+RQTTSL+KQNVA+AL+SI +A+L SV
Sbjct  694  IVLAQRASASAIAVADVLLLQDNLTGIPFCIAKSRQTTSLVKQNVAIALTSILLATLPSV  753

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTG-SWQDSIIQLVNRLRSVIMVLRRHGNN  432
            LGFLPLWLTVLLHEGGTLLVCLNSIR LN+P+  SW+  I  +++ + S   +     +N
Sbjct  754  LGFLPLWLTVLLHEGGTLLVCLNSIRGLNNPSSWSWKQDIANVISNINSKRSI---SHHN  810

Query  431  SQSTIEAA  408
            S ST E A
Sbjct  811  SLSTAEPA  818



>ref|XP_010432071.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=821

 Score =   190 bits (482),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA  VGI EV+C+LKPEDKL H+ + +R+ GG LIMVG+GINDAPALAAATV
Sbjct  632  DHDSSAWRVANTVGITEVYCNLKPEDKLNHIKNFAREAGGGLIMVGEGINDAPALAAATV  691

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSL--IKQNvalalssiavasl  618
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL  +KQNVALAL+SI +A+L
Sbjct  692  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSLLQVKQNVALALTSIFLAAL  751

Query  617  tsvLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
             SVLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+++L S
Sbjct  752  PSVLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDISHLISKLSS  802



>ref|XP_006283120.1| hypothetical protein CARUB_v10004142mg [Capsella rubella]
 gb|EOA16018.1| hypothetical protein CARUB_v10004142mg [Capsella rubella]
Length=822

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EV+C+LKPEDKL HV +I+R+ GG LIMVG+GINDAPALAAATV
Sbjct  638  DHDSSAWRVANAVGITEVYCNLKPEDKLNHVKNIAREAGGGLIMVGEGINDAPALAAATV  697

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVADILLL+DNI+GVPFCVAK+RQTTSL  QNVALAL+SI +A+L S
Sbjct  698  GIVLAQRASATAIAVADILLLRDNITGVPFCVAKSRQTTSL--QNVALALTSIFLAALPS  755

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRL  471
            VLGF+PLWLTVLLHEGGTLLVCLNS+R LNDP+ SW+  I  L+ +L
Sbjct  756  VLGFVPLWLTVLLHEGGTLLVCLNSVRGLNDPSWSWKQDISHLIKKL  802



>emb|CDY46080.1| BnaA09g42040D [Brassica napus]
Length=675

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+C+LKPEDKL HV +ISRD  GGLIMVG+GIND PALAAATV
Sbjct  523  DHESSAWRVANAVGIDEVYCNLKPEDKLNHVKNISRDSGGGLIMVGEGINDGPALAAATV  582

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G VLA+RAS  AIAVAD+LLL+DNI+GVPFC+AK+RQTT+L+KQNVA+AL+SI +A+L S
Sbjct  583  GFVLAQRASGTAIAVADVLLLRDNITGVPFCIAKSRQTTTLVKQNVAIALTSILLAALPS  642

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPT  513
            VLG+LPLWLTVLLHEGGTLLVCLNSIR LNDP+
Sbjct  643  VLGYLPLWLTVLLHEGGTLLVCLNSIRGLNDPS  675



>ref|XP_006404810.1| hypothetical protein EUTSA_v10000049mg [Eutrema salsugineum]
 gb|ESQ46263.1| hypothetical protein EUTSA_v10000049mg [Eutrema salsugineum]
Length=812

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+ +LKPEDKL HV +ISRD GG LIMVG+GIND PALAAATV
Sbjct  630  DHESSARRVANAVGIDEVYYNLKPEDKLNHVKNISRDSGGGLIMVGEGINDGPALAAATV  689

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RAS  AIAVAD+LLL+DNI+GV FC+AK+ QTT L+KQNVA+AL SI +A+L S
Sbjct  690  GIVLAQRASGTAIAVADVLLLRDNITGVAFCIAKSHQTTLLVKQNVAIALISIFLAALPS  749

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRS  465
            VLGFLPLWLTVLLHEGGTLLVCLNSIR LNDP+ SW+  I  +++   S
Sbjct  750  VLGFLPLWLTVLLHEGGTLLVCLNSIRGLNDPSWSWKQDIAHMISNFNS  798



>gb|KCW59485.1| hypothetical protein EUGRSUZ_H02227 [Eucalyptus grandis]
Length=843

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA +V I EV+C LKPEDKL +V SISRD GG LIMVG+GINDAPALAAATV
Sbjct  655  DHESSAWRVANSVNIDEVYCGLKPEDKLNYVRSISRDTGGGLIMVGEGINDAPALAAATV  714

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLL+DNISGVPF +AK+R TTSL+KQNVALAL+ I +ASL S
Sbjct  715  GIVLAQRASATAVAVADVLLLRDNISGVPFSIAKSRHTTSLVKQNVALALTCIFLASLPS  774

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR  468
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN+PT S + ++  L+  L+
Sbjct  775  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNNPTWSLRQNLSHLLGELK  822



>ref|XP_010070608.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW59484.1| hypothetical protein EUGRSUZ_H02227 [Eucalyptus grandis]
Length=840

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA +V I EV+C LKPEDKL +V SISRD GG LIMVG+GINDAPALAAATV
Sbjct  652  DHESSAWRVANSVNIDEVYCGLKPEDKLNYVRSISRDTGGGLIMVGEGINDAPALAAATV  711

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLL+DNISGVPF +AK+R TTSL+KQNVALAL+ I +ASL S
Sbjct  712  GIVLAQRASATAVAVADVLLLRDNISGVPFSIAKSRHTTSLVKQNVALALTCIFLASLPS  771

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLR  468
            VLGFLPLWLTVLLHEGGTLLVCLNSIRALN+PT S + ++  L+  L+
Sbjct  772  VLGFLPLWLTVLLHEGGTLLVCLNSIRALNNPTWSLRQNLSHLLGELK  819



>ref|XP_010531262.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010531263.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=822

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA  VGIKEV+C+LKPEDKL HV +I+ + GG LIMVG+GINDAPALAAATV
Sbjct  637  DHESSAWRVANVVGIKEVYCNLKPEDKLNHVKNIAGEAGGGLIMVGEGINDAPALAAATV  696

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD LLL+DNISGVPFCVAK+RQTTSL+KQNVALALSSI +A+L S
Sbjct  697  GIVLAQRASATAIAVADALLLRDNISGVPFCVAKSRQTTSLVKQNVALALSSIFLAALPS  756

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSI--IQLVNRLRS  465
             LG LPLW+TVLLHEGGTLLVCLNS+R LNDPT SW+  I  + L N+LRS
Sbjct  757  GLGLLPLWVTVLLHEGGTLLVCLNSVRGLNDPTWSWKQDIAHVLLFNKLRS  807



>ref|XP_010679546.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=827

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKG-GLIMVGDGINDAPALAAATV  792
            DH++SA RVA AVGI EVH  LKPEDKL HV  ISR+ G  LIMVGDGINDAPALAAA V
Sbjct  638  DHKSSAFRVANAVGITEVHFGLKPEDKLNHVVRISRETGESLIMVGDGINDAPALAAAAV  697

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
             IV A+RASA A+AVAD+LLLQDNISGVPFC+AKA QTTSL+KQNVALALS+I +A+L S
Sbjct  698  SIVFAQRASATAVAVADVLLLQDNISGVPFCIAKAHQTTSLVKQNVALALSAIILAALPS  757

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSV  462
            VLGFLPLWLTVLLHEGGTLLVC NSIRALNDPT SW+  +  L++  ++V
Sbjct  758  VLGFLPLWLTVLLHEGGTLLVCANSIRALNDPTWSWKQDLHHLLDNCKAV  807



>ref|XP_006295445.1| hypothetical protein CARUB_v10024548mg [Capsella rubella]
 gb|EOA28343.1| hypothetical protein CARUB_v10024548mg [Capsella rubella]
Length=788

 Score =   176 bits (445),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKG-GLIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+ +LKPEDKL HV SIS D G GLIMVG+GIND PALAAATV
Sbjct  628  DHESSARRVADAVGIDEVYSNLKPEDKLNHVKSISADSGEGLIMVGEGINDGPALAAATV  687

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA+AIAVAD+LLLQDN++G+PFC+AK+RQTTSL+KQNVALAL+SI +A+L S
Sbjct  688  GIVLAQRASASAIAVADVLLLQDNLTGIPFCIAKSRQTTSLVKQNVALALTSICLAALPS  747

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
            VLGFLPLWLTVLLHEGGTLLVCLNSIR L
Sbjct  748  VLGFLPLWLTVLLHEGGTLLVCLNSIRGL  776



>gb|KGN63370.1| hypothetical protein Csa_2G433360 [Cucumis sativus]
Length=818

 Score =   173 bits (438),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 147/188 (78%), Gaps = 9/188 (5%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DH++SA +VA AVGI EV+ SLKPEDKL HV  ISR+ GG LIMVG+GINDAPALAAATV
Sbjct  637  DHDSSAWKVANAVGINEVYYSLKPEDKLAHVKEISREMGGGLIMVGEGINDAPALAAATV  696

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA RASA A AVAD+LLLQD+ISGVPFC+AK+RQTTSLIKQNV LAL+SI +ASL S
Sbjct  697  GIVLAHRASATATAVADVLLLQDSISGVPFCIAKSRQTTSLIKQNVTLALTSILLASLPS  756

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLG     L VLLHEGGTLLVCLNS+RALN P+ SW+  +  L++  RS    L     N
Sbjct  757  VLG-----LKVLLHEGGTLLVCLNSVRALNHPSWSWKQDLQNLIHDARS---KLNTTPEN  808

Query  431  SQSTIEAA  408
            S  TI+ A
Sbjct  809  SSGTIQTA  816



>ref|XP_002986489.1| hypothetical protein SELMODRAFT_182418 [Selaginella moellendorffii]
 gb|EFJ12346.1| hypothetical protein SELMODRAFT_182418 [Selaginella moellendorffii]
Length=807

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 7/173 (4%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-----GGLIMVGDGINDAPALA  804
            DH ASA RVA AVGI+EVH  L+PEDKL HV  ++R +     GGLIMVGDG+NDAPALA
Sbjct  622  DHPASAQRVANAVGIEEVHSDLRPEDKLLHVKKLARQRDEGNLGGLIMVGDGVNDAPALA  681

Query  803  AATVGivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiava  624
            AATVGIVLA  ASA A+AVAD+LLL+D I GVPF ++KARQTTSL+KQNV LA++SI VA
Sbjct  682  AATVGIVLARFASATAVAVADVLLLKDAIDGVPFVISKARQTTSLVKQNVILAMASIVVA  741

Query  623  sltsvLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP--TGSWQDSIIQLVNRL  471
            +L+SV G LPLW+TVLLHEGGTLLVC+NS+RALN+P  +  W+  ++  +  L
Sbjct  742  ALSSVGGLLPLWITVLLHEGGTLLVCVNSVRALNEPLWSSQWRRDMVSFIQGL  794



>ref|XP_002964908.1| hypothetical protein SELMODRAFT_167322 [Selaginella moellendorffii]
 gb|EFJ33746.1| hypothetical protein SELMODRAFT_167322 [Selaginella moellendorffii]
Length=817

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 7/173 (4%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-----GGLIMVGDGINDAPALA  804
            DH ASA RVA AVGI+EVH  L+PEDKL HV  ++R +     GGLIMVGDG+NDAPALA
Sbjct  632  DHPASAQRVANAVGIEEVHSDLRPEDKLLHVKKLARQRDEGNLGGLIMVGDGVNDAPALA  691

Query  803  AATVGivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiava  624
            AATVGIVLA  ASA A+AVAD+LLL+D I GVPF ++KARQTTSL+KQNV LA++SI VA
Sbjct  692  AATVGIVLARFASATAVAVADVLLLKDAIDGVPFVISKARQTTSLVKQNVILAMASIVVA  751

Query  623  sltsvLGFLPLWLTVLLHEGGTLLVCLNSIRALNDP--TGSWQDSIIQLVNRL  471
            +L+SV G LPLW+TVLLHEGGTLLVC+NS+RALN+P  +  W+  ++  +  L
Sbjct  752  ALSSVGGLLPLWITVLLHEGGTLLVCVNSVRALNEPLWSSQWRRDMVSFIQGL  804



>ref|XP_010417082.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Camelina sativa]
Length=652

 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 4/191 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+C+LKPEDKL HVT+IS D GG LIMVG+GIND PALAAATV
Sbjct  461  DHESSARRVADAVGIDEVYCNLKPEDKLNHVTNISTDSGGGLIMVGEGINDGPALAAATV  520

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA+AIAVAD+LLLQDN++ +PFC+AK+RQTTSL+KQNVA+AL+SI +A+L S
Sbjct  521  GIVLAQRASASAIAVADVLLLQDNLTVIPFCIAKSRQTTSLVKQNVAIALTSILLATLPS  580

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLG LPLWLTVLLHEGGTLLVCLNSIR LN+P+ SW+  I  +++ + S   +     +N
Sbjct  581  VLGLLPLWLTVLLHEGGTLLVCLNSIRGLNNPSWSWKQDIANVISNINSKRSISH---HN  637

Query  431  SQSTIEAAAPL  399
            S ST+  A  +
Sbjct  638  SLSTVSGACTI  648



>ref|XP_010927513.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=807

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 131/191 (69%), Gaps = 31/191 (16%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SA RVA  VGI EVHC LKPEDKL  V S SRD+ GGLIMVGDGINDAPALAAATV
Sbjct  647  DHESSARRVANTVGINEVHCCLKPEDKLNQVKSASRDRGGGLIMVGDGINDAPALAAATV  706

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLLQDNISGVPF +AKARQTTSL                   
Sbjct  707  GIVLAQRASATAIAVADVLLLQDNISGVPFVIAKARQTTSL-------------------  747

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
                      VLLHEGGTLLVCLNSIRALN+PT SW   + QLV+ LR  +  L  +   
Sbjct  748  ----------VLLHEGGTLLVCLNSIRALNNPTWSWLQDLRQLVDGLRKAVADL-LNKRP  796

Query  431  SQSTIEAAAPL  399
             +S I  AAPL
Sbjct  797  PRSHIIQAAPL  807



>ref|XP_010417081.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=824

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGG-LIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+C+LKPEDKL HVT+IS D GG LIMVG+GIND PALAAATV
Sbjct  633  DHESSARRVADAVGIDEVYCNLKPEDKLNHVTNISTDSGGGLIMVGEGINDGPALAAATV  692

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA+AIAVAD+LLLQDN++ +PFC+AK+RQTTSL+KQNVA+AL+SI +A+L S
Sbjct  693  GIVLAQRASASAIAVADVLLLQDNLTVIPFCIAKSRQTTSLVKQNVAIALTSILLATLPS  752

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSWQDSIIQLVNRLRSVIMVLRRHGNN  432
            VLG LPLWLTVLLHEGGTLLVCLNSIR LN+P+ SW+  I  +++ + S   +     +N
Sbjct  753  VLGLLPLWLTVLLHEGGTLLVCLNSIRGLNNPSWSWKQDIANVISNINSKRSISH---HN  809

Query  431  SQSTIEAA  408
            S ST+  A
Sbjct  810  SLSTVSGA  817



>ref|XP_010652768.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
isoform X2 [Vitis vinifera]
Length=770

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 118/130 (91%), Gaps = 1/130 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGIKEV+CSLKPEDKL HV SISR+  GGLIMVGDGINDAPALAAATV
Sbjct  641  DHESSAWRVANAVGIKEVYCSLKPEDKLNHVKSISREAGGGLIMVGDGINDAPALAAATV  700

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RAS  AIAVAD+LLL+DNIS VPFCV+K+RQTTSL+KQNVALALS I +ASL S
Sbjct  701  GIVLAQRASGTAIAVADVLLLRDNISAVPFCVSKSRQTTSLVKQNVALALSCILLASLPS  760

Query  611  vLGFLPLWLT  582
            VLGFLPLWLT
Sbjct  761  VLGFLPLWLT  770



>ref|XP_001762609.1| predicted protein [Physcomitrella patens]
 gb|EDQ72732.1| predicted protein, partial [Physcomitrella patens]
Length=743

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 124/161 (77%), Gaps = 5/161 (3%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK--GGLIMVGDGINDAPALAAAT  795
            D+  +A RVAK VGI E H  LKP+DKL  V  + ++K  GGL+MVGDGIND PALAAAT
Sbjct  553  DNATTAERVAKTVGIDEFHAGLKPDDKLSQVQRLRQEKDCGGLVMVGDGINDGPALAAAT  612

Query  794  VGivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslt  615
            +GIVLA+ ASA A+ VAD+LL+Q+ I GVPF + KA QT SL+KQNVALAL SI +A L 
Sbjct  613  IGIVLAQNASATAVQVADVLLVQNAIDGVPFVITKAHQTVSLVKQNVALALFSIILAGLP  672

Query  614  svLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPT---GSWQ  501
            SVLG LPLWL VL+HEGGTLLVC+NS+RA  +P+   G W+
Sbjct  673  SVLGVLPLWLAVLMHEGGTLLVCVNSVRAFRNPSYKLGRWK  713



>gb|KDO79067.1| hypothetical protein CISIN_1g003598mg [Citrus sinensis]
Length=750

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SA RVA AVGI EV+CSLKPEDKL HV   SRD  GGLIMVG+GINDAPALAAATV
Sbjct  620  DHESSAQRVANAVGINEVYCSLKPEDKLNHVKRTSRDMGGGLIMVGEGINDAPALAAATV  679

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA AIAVAD+LLL++NISGVPFCVAK+RQTTSL+KQNVALALS I +ASL S
Sbjct  680  GIVLAQRASATAIAVADVLLLRNNISGVPFCVAKSRQTTSLVKQNVALALSCIILASLPS  739

Query  611  vLGFLPLWLTV  579
            VLGFLPLWLTV
Sbjct  740  VLGFLPLWLTV  750



>ref|NP_001141444.1| uncharacterized protein LOC100273554 [Zea mays]
 gb|ACF86382.1| unknown [Zea mays]
Length=664

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRD-KGGLIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+  GGLIMVGDGINDAPALAAATV
Sbjct  531  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  590

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G+VLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  591  GMVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  650

Query  611  vLGFLPLWLTV  579
            VLGFLPLWLTV
Sbjct  651  VLGFLPLWLTV  661



>gb|AFW69218.1| hypothetical protein ZEAMMB73_697863 [Zea mays]
Length=768

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRD-KGGLIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+  GGLIMVGDGINDAPALAAATV
Sbjct  635  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  694

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G+VLA+RASA A+AVAD+LLLQDNI GVPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  695  GMVLAQRASATAVAVADVLLLQDNICGVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  754

Query  611  vLGFLPLWLTV  579
            VLGFLPLWLTV
Sbjct  755  VLGFLPLWLTV  765



>gb|EMS57324.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Triticum urartu]
Length=718

 Score =   139 bits (350),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRD-KGGLIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+  GGLIMVGDGINDAPALAAATV
Sbjct  530  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  589

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            GIVLA+RASA A+AVAD+LLLQDN+  VPFC+AKARQTTSL+KQ+VALAL+ I  A+L S
Sbjct  590  GIVLAQRASATAVAVADVLLLQDNLCVVPFCIAKARQTTSLVKQSVALALTCIVFAALPS  649

Query  611  vLGFLPLWLTVL  576
            VLGFLPLWLT+ 
Sbjct  650  VLGFLPLWLTIF  661



>ref|XP_001780815.1| predicted protein [Physcomitrella patens]
 gb|EDQ54372.1| predicted protein, partial [Physcomitrella patens]
Length=743

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 117/154 (76%), Gaps = 4/154 (3%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A RV   V I E H  +KPEDKL  V    +  GGL+MVGDGIND PALAAATV 
Sbjct  559  DNATAAERVVNLVEIDEFHAGVKPEDKLSRV----KHCGGLVMVGDGINDDPALAAATVD  614

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            IVLA+ ASA A+ VAD+LLLQ  I GVPF +AKA QTTSLIKQ+VALAL SI +A L SV
Sbjct  615  IVLAKNASATAVQVADVLLLQHAIDGVPFVIAKAHQTTSLIKQSVALALLSIFLAGLPSV  674

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGS  507
            LG LPLWLTVLLHEGGTLLVC NS+RAL +P+ S
Sbjct  675  LGVLPLWLTVLLHEGGTLLVCANSVRALKNPSSS  708



>ref|WP_006341401.1| ATPase [Parachlamydia acanthamoebae]
 gb|EFB41409.1| hypothetical protein pah_c045o133 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB85553.1| putative cadmium/zinc-transporting ATPase HMA1,chloroplastic 
[Parachlamydia acanthamoebae UV-7]
 gb|KIA78719.1| putative cadmium/zinc-transporting ATPase HMA1 [Parachlamydia 
acanthamoebae]
Length=670

 Score =   127 bits (320),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ASA RVA  +GI E H  L PEDKL HV+ +++ K GL M+GDG+NDAPALA ATVG
Sbjct  522  DHQASAKRVADDLGISEYHADLTPEDKLRHVSQLAQSK-GLAMIGDGVNDAPALARATVG  580

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  S +AI  +DI+LLQDNI  + + + KA QT  +++QN+ LA  +I +ASL ++
Sbjct  581  ICMGKVGSTSAIDASDIVLLQDNIEQLNWLIGKAHQTQKIVRQNLTLAGLAIVLASLPAL  640

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            LGF+PLWL V+LHEGGT+LV LN +R + D
Sbjct  641  LGFIPLWLAVILHEGGTVLVGLNGLRLMRD  670



>ref|XP_008338386.1| PREDICTED: probable cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Malus domestica]
Length=765

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDK-GGLIMVGDGINDAPALAAATV  792
            DHE+SA RVA +VGI E +CSLKPEDKL HV  +SR+  GGLIMVG+GINDAPALAAATV
Sbjct  622  DHESSAWRVANSVGINEFYCSLKPEDKLSHVKDVSRETGGGLIMVGEGINDAPALAAATV  681

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQN  657
            GIVLA+RASA A AVAD+LLL+DNIS VPFC+AK+RQTTSL+  N
Sbjct  682  GIVLAQRASATATAVADVLLLRDNISAVPFCIAKSRQTTSLVLVN  726



>gb|KIC72628.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Neochlamydia sp. EPS4]
Length=665

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA R+AK +GI   + +LKPEDKL HV  ++ +K GL MVGDGINDAPALA ATVG
Sbjct  517  DHQYSAERIAKELGISSFYANLKPEDKLKHVAQLA-EKEGLAMVGDGINDAPALARATVG  575

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  +  A+  ADI+LLQDNI  + +   KA++T  ++KQN+ +A+++I +A++ S+
Sbjct  576  ICMGKVGTTTAVEAADIVLLQDNIERLDWLFLKAKRTQRVVKQNLFIAIAAIFIATIPSI  635

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
             GF+PLWL VL+HEGGT++V LN +R L  
Sbjct  636  AGFIPLWLAVLMHEGGTVIVGLNGLRLLKS  665



>ref|WP_042240439.1| ATPase [Neochlamydia sp. S13]
Length=662

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA R+AK +GI   + +LKPEDKL HV  ++ +K GL MVGDGINDAPALA ATVG
Sbjct  514  DHQYSAERIAKELGISSFYANLKPEDKLKHVAQLA-EKEGLAMVGDGINDAPALARATVG  572

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  +  A+  ADI+LLQDNI  + +   KA++T  ++KQN+ +A+++I +A++ S+
Sbjct  573  ICMGKVGTTTAVEAADIVLLQDNIERLDWLFLKAKRTQRVVKQNLFIAIAAIFIATIPSI  632

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
             GF+PLWL VL+HEGGT++V LN +R L  
Sbjct  633  AGFIPLWLAVLMHEGGTVIVGLNGLRLLKS  662



>ref|WP_039383686.1| ATPase [Neochlamydia sp. TUME1]
 gb|KIC76897.1| putative cadmium/zinc-transporting ATPase HMA1 [Neochlamydia 
sp. TUME1]
Length=662

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA R+AK +GI   + +LKPEDKL HV  ++ +K GL MVGDGINDAPALA ATVG
Sbjct  514  DHQYSAERIAKELGISSFYANLKPEDKLKHVAQLA-EKEGLAMVGDGINDAPALARATVG  572

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  +  A+  ADI+LLQDNI  + +   KA++T  ++KQN+ +A+++I +A++ S+
Sbjct  573  ICMGKVGTTTAVEAADIVLLQDNIERLDWLFLKAKRTQRVVKQNLFIAIAAIFIATIPSI  632

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
             GF+PLWL VL+HEGGT++V LN +R L  
Sbjct  633  AGFIPLWLAVLMHEGGTVIVGLNGLRLLKS  662



>ref|WP_044882722.1| ATPase [Neochlamydia sp. EPS4]
Length=662

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA R+AK +GI   + +LKPEDKL HV  ++ +K GL MVGDGINDAPALA ATVG
Sbjct  514  DHQYSAERIAKELGISSFYANLKPEDKLKHVAQLA-EKEGLAMVGDGINDAPALARATVG  572

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  +  A+  ADI+LLQDNI  + +   KA++T  ++KQN+ +A+++I +A++ S+
Sbjct  573  ICMGKVGTTTAVEAADIVLLQDNIERLDWLFLKAKRTQRVVKQNLFIAIAAIFIATIPSI  632

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
             GF+PLWL VL+HEGGT++V LN +R L  
Sbjct  633  AGFIPLWLAVLMHEGGTVIVGLNGLRLLKS  662



>gb|EMT13424.1| Putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Aegilops tauschii]
Length=695

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 91/102 (89%), Gaps = 1/102 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRD-KGGLIMVGDGINDAPALAAATV  792
            DHE+SA RVAKAV I+EVH SLKPEDKL  V ++SR+  GGLIMVGDGINDAPALAAATV
Sbjct  555  DHESSAQRVAKAVCIEEVHFSLKPEDKLNKVKAVSREGGGGLIMVGDGINDAPALAAATV  614

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLI  666
            GIVLA+RASA A+AVAD+LLLQDN+  VPFC+AKARQTTSL+
Sbjct  615  GIVLAQRASATAVAVADVLLLQDNLCVVPFCIAKARQTTSLV  656



>emb|CDZ80832.1| putative cadmium-transporting ATPase [Chlamydia sp. 'Rubis']
Length=661

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  +A + A ++GI      LKPEDKL HV+ +++ KG L M+GDGINDAPALA ATVG
Sbjct  513  DHAQNAEKTAHSIGISNFFAELKPEDKLLHVSQLAKTKG-LAMIGDGINDAPALARATVG  571

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  + AA+  ADI+LLQDN+  + +   K++ T +++KQN+ LA+ +I +A+L ++
Sbjct  572  ICMGKVGTTAAMDAADIILLQDNVELLSWLYRKSKNTQAVVKQNLTLAVGAILLAALPAL  631

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             GF+PLWL V+LHEGGT+LV LN++R L
Sbjct  632  AGFIPLWLAVILHEGGTVLVGLNALRLL  659



>ref|WP_041941913.1| ATPase [Waddlia chondrophila]
Length=655

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE SA RVA+ +GI +    L+PEDKL  V+ IS+ KG L MVGDGINDAPALA +TVG
Sbjct  507  DHENSARRVAEELGIDQWRAHLRPEDKLSAVSEISQSKG-LAMVGDGINDAPALARSTVG  565

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + +  + AA+  +DI+LL DNI  + +   KA++T +++KQN  LA  +I  ASL ++
Sbjct  566  VCMGQVGTTAAMDASDIVLLHDNIEMLSWLYGKAKKTQAIVKQNFLLATGAIIFASLPAL  625

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G +PLW+ V+LHEGGT+LV LN++R L 
Sbjct  626  FGIVPLWMAVILHEGGTILVGLNALRLLR  654



>gb|ADI38979.1| heavy metal translocating ATPase, P-type [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB92100.1| putative cadmium/zinc-transporting ATPase HMA1,chloroplastic 
[Waddlia chondrophila 2032/99]
Length=663

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE SA RVA+ +GI +    L+PEDKL  V+ IS+ KG L MVGDGINDAPALA +TVG
Sbjct  515  DHENSARRVAEELGIDQWRAHLRPEDKLSAVSEISQSKG-LAMVGDGINDAPALARSTVG  573

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + +  + AA+  +DI+LL DNI  + +   KA++T +++KQN  LA  +I  ASL ++
Sbjct  574  VCMGQVGTTAAMDASDIVLLHDNIEMLSWLYGKAKKTQAIVKQNFLLATGAIIFASLPAL  633

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G +PLW+ V+LHEGGT+LV LN++R L 
Sbjct  634  FGIVPLWMAVILHEGGTILVGLNALRLLR  662



>ref|WP_042103685.1| ATPase [Parachlamydiaceae bacterium HS-T3]
Length=668

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 105/146 (72%), Gaps = 1/146 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE SA ++A+  GI E +  LKPEDKL  ++ +S+++  L M+GDGINDAPALA ATVG
Sbjct  520  DHELSAKKIAQDTGITEYYSQLKPEDKLSIISDLSKNEN-LAMIGDGINDAPALARATVG  578

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  S AA+  AD++LL DNI  + + + KA+ T  ++KQN+  A  +I  AS+ ++
Sbjct  579  ISMGKVGSGAAMDAADVVLLHDNIEKLDWLMGKAKATQKIVKQNLIFATMAIFTASIPAL  638

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
            LGF+PLW+ VL+HEGGT+LV LN +R
Sbjct  639  LGFVPLWIAVLIHEGGTILVGLNGLR  664



>ref|WP_013942882.1| ATPase [Simkania negevensis]
 emb|CCB88415.1| putative cadmium/zinc-transporting ATPase HMA1,chloroplastic 
[Simkania negevensis Z]
Length=648

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ASA  VAK++GI+     L+PE KL  V+++S  K GL MVGDGINDAPALA ATVG
Sbjct  500  DHQASAAAVAKSLGIEVFLSDLRPEHKLEMVSNLSM-KHGLAMVGDGINDAPALARATVG  558

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I L E  SA AI  +DI+ LQD++  + +   KAR+T  ++++N+ LAL  I + +  ++
Sbjct  559  ISLGEIGSATAIDASDIVFLQDDLKLLSWLYTKARKTMRIVRENLTLALGVICLVTTPAL  618

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG++PLWL V+LHEGGT+LV LNS+R L 
Sbjct  619  LGWIPLWLAVILHEGGTVLVGLNSLRLLK  647



>ref|WP_020355591.1| MULTISPECIES: cadmium-translocating P-type ATPase [Chlamydia]
 gb|EPP36113.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 10_743_SC13]
 gb|EPP38522.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 10_881_SC42]
 gb|AHK63531.1| putative cadmium/zinc-transporting ATPase HMA1, chloroplastic 
[Chlamydia avium 10DC88]
Length=657

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   AK +GI EV   L P+DKLY +  ++  +  ++MVGDG+NDAPALA ATVG
Sbjct  510  DHHISAQNTAKLLGISEVFSDLSPDDKLYKIRELAEQRN-ILMVGDGVNDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL DNI+ +P+ + K++QT  ++ QN+ LAL  I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDNIASLPWIIRKSKQTRKIVTQNLGLALLIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>gb|AEB41191.1| cadmium-translocating P-type ATPase [Chlamydophila pecorum E58]
Length=628

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA  +AK VGI EV  +L PE KL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  481  DHKVSAENIAKIVGISEVFANLSPEAKLNKVRELAKRRH-ILMVGDGINDAPALAQATVG  539

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  AD++LL D+++ +P+ + KARQT  ++ QN++LAL+ I + S  + 
Sbjct  540  VAMGEAGSATAIEAADVVLLHDSLASLPWVLKKARQTKKIVSQNLSLALAIILLVSWPAS  599

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G +PLWL V+LHEG T++V +N++R L 
Sbjct  600  FGIIPLWLAVILHEGSTVIVGMNALRLLK  628



>ref|WP_021756909.1| cadmium-translocating P-type ATPase [Chlamydia pecorum]
 gb|AGW38326.1| cadmium-translocating P-type ATPase [Chlamydia pecorum PV3056/3]
Length=657

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA  +AK VGI EV  +L PE KL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHKVSAENIAKIVGISEVFANLSPEAKLNKVRELAKRRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  AD++LL D+++ +P+ + KARQT  ++ QN++LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADVVLLHDSLASLPWVLKKARQTKKIVSQNLSLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G +PLWL V+LHEG T++V +N++R L 
Sbjct  629  FGIIPLWLAVILHEGSTVIVGMNALRLLK  657



>ref|WP_021757537.1| cadmium-translocating P-type ATPase [Chlamydia pecorum]
 gb|AGW39251.1| cadmium-translocating P-type ATPase [Chlamydia pecorum W73]
 gb|AGW40176.1| cadmium-translocating P-type ATPase [Chlamydia pecorum P787]
 gb|ETF38547.1| cadmium-translocating P-type ATPase [Chlamydia pecorum VR629]
 gb|ETF39052.1| cadmium-translocating P-type ATPase [Chlamydia pecorum DBDeUG]
 gb|ETF39728.1| cadmium-translocating P-type ATPase [Chlamydia pecorum MC/MarsBar]
Length=657

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA  +AK VGI EV  +L PE KL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHKVSAENIAKIVGISEVFANLSPEAKLNKVRELAKRRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  AD++LL D+++ +P+ + KARQT  ++ QN++LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADVVLLHDSLASLPWVLKKARQTKKIVSQNLSLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G +PLWL V+LHEG T++V +N++R L 
Sbjct  629  FGIIPLWLAVILHEGSTVIVGMNALRLLK  657



>ref|WP_024010970.1| cadmium-translocating P-type ATPase [Chlamydia pecorum]
 gb|ETF40778.1| cadmium-translocating P-type ATPase [Chlamydia pecorum IPTaLE]
Length=657

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA  +AK VGI EV  +L PE KL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHKVSAENIAKIVGISEVFANLSPEAKLNKVRELAKRRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  AD++LL D+++ +P+ + KARQT  ++ QN++LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADVVLLHDSLASLPWVLKKARQTKKIVSQNLSLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G +PLWL V+LHEG T++V +N++R L 
Sbjct  629  FGIIPLWLAVILHEGSTVIVGMNALRLLK  657



>gb|EYE60727.1| cadmium-translocating P-type ATPase [Bacteroides fragilis str. 
S6L5]
Length=628

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   AK + I EV   L P DKL+ +  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  481  DHYVSAQNTAKLLEISEVFSDLSPADKLHKIQELAKQRQ-ILMVGDGINDAPALAQATVG  539

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL DNIS +P+ + KA+QT  ++ QN+ LAL  I   S  + 
Sbjct  540  VAMGEAGSATAIEAADIVLLHDNISSLPWIIRKAKQTRKIVTQNLGLALFIILCVSWPAS  599

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  600  LGIIPLWLAVILHEGSTIIVGLNALRLLK  628



>gb|EPJ33233.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 06-1683]
Length=388

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  241  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  299

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  300  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  359

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  360  LGIIPLWLAVILHEGSTIVVGLNALRLLK  388



>ref|WP_021828664.1| cadmium-translocating P-type ATPase [Chlamydia gallinacea]
 gb|ERL53642.1| cadmium-translocating P-type ATPase [Chlamydia gallinacea 08-1274/3]
Length=657

 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   AK + I EV   L P DKL+ +  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHYVSAQNTAKLLEISEVFSDLSPADKLHKIQELAKQRQ-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL DNIS +P+ + KA+QT  ++ QN+ LAL  I   S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDNISSLPWIIRKAKQTRKIVTQNLGLALFIILCVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIIVGLNALRLLK  657



>gb|EPP31529.1| cadmium-translocating P-type ATPase, partial [Chlamydia psittaci 
84-8471/1]
Length=395

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  248  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  306

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  307  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  366

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  367  LGIIPLWLAVILHEGSTIVVGLNALRLLK  395



>ref|WP_034734702.1| HAD family hydrolase [Bacteroides fragilis]
Length=657

 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   AK + I EV   L P DKL+ +  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHYVSAQNTAKLLEISEVFSDLSPADKLHKIQELAKQRQ-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL DNIS +P+ + KA+QT  ++ QN+ LAL  I   S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDNISSLPWIIRKAKQTRKIVTQNLGLALFIILCVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIIVGLNALRLLK  657



>ref|WP_014518218.1| HAD family hydrolase [Chlamydia pneumoniae]
 gb|ACZ32753.1| cadmium-translocating P-type ATPase [Chlamydophila pneumoniae 
LPCoLN]
Length=658

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   A+ +GI EV   L PEDKL  +  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHKVSAENTAEILGISEVFFDLTPEDKLAKIRELATQRQ-IMMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  ADI+LL D++S +P+ + KA+QT  ++ QN+ALAL+ I + S  + 
Sbjct  569  IAMGEAGSATAIEAADIVLLHDSLSSLPWIIQKAKQTKKVVSQNLALALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            LG +PLWL V+LHEG T++V LN++R L  
Sbjct  629  LGIIPLWLAVILHEGSTVIVGLNALRLLKS  658



>ref|WP_011097388.1| HAD family hydrolase [Chlamydophila abortus]
 emb|CAH64307.1| putative cation transport related membrane protein [Chlamydophila 
abortus S26/3]
 emb|CED80911.1| putative cation transport related membrane protein [Chlamydophila 
abortus]
Length=657

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV  +L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKLLGISEVFANLSPDDKLDKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + KA+QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKAKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>ref|WP_006344470.1| HAD family hydrolase [Chlamydophila abortus]
 gb|EGK69598.1| putative cation transport related membrane protein [Chlamydophila 
abortus LLG]
Length=657

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV  +L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKLLGISEVFANLSPDDKLDKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + KA+QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKAKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>gb|ETR79629.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
pneumoniae B21]
Length=654

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   A+ +GI EV   L PEDKL  +  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  506  DHKVSAENTAEILGISEVFFDLTPEDKLAKIRELATQRQ-IMMVGDGINDAPALAQATVG  564

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  ADI+LL D++S +P+ + KA+QT  ++ QN+ALAL+ I + S  + 
Sbjct  565  IAMGEAGSATAIEAADIVLLHDSLSSLPWIIQKAKQTKKVVSQNLALALAIILLVSWPAS  624

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            LG +PLWL V+LHEG T++V LN++R L  
Sbjct  625  LGIIPLWLAVILHEGSTVIVGLNALRLLKS  654



>ref|WP_020370598.1| MULTISPECIES: cadmium-translocating P-type ATPase [Chlamydia]
 gb|EPP34870.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 10_1398_11]
 gb|EQM62268.1| cadmium-translocating P-type ATPase [Chlamydia ibidis 10-1398/6]
Length=657

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   AK +GI EV   L P+DKL  V  +++++  ++MVGDGINDAPALA ATVG
Sbjct  510  DHRVSAENTAKVLGITEVFSDLSPDDKLDKVRELAKNRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA A+  AD++LL D +S +P+ + KA+ T  ++ QN+ALAL+ I + S  + 
Sbjct  569  IAMGEAGSATAVEAADVVLLNDALSSLPWLIQKAKSTQKIVSQNLALALAVIFLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGMIPLWLAVILHEGSTIVVGLNALRLLK  657



>ref|WP_010883503.1| HAD family hydrolase [Chlamydia pneumoniae]
 ref|NP_225063.1| metal transport P-type ATPase [Chlamydophila pneumoniae CWL029]
 gb|AAD19006.1| Metal Transport P-type ATPase [Chlamydophila pneumoniae CWL029]
 dbj|BAA99076.1| metal transport P-type ATPase [Chlamydophila pneumoniae J138]
 gb|AAP98826.1| copper-transporting ATPase [Chlamydophila pneumoniae TW-183]
Length=658

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   A+ +GI EV   L PEDKL  +  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHKVSAENTAEILGISEVFFDLTPEDKLAKIRELATQRQ-IMMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  ADI+LL D++S +P+ + KA+QT  ++ QN+ALAL+ I + S  + 
Sbjct  569  IAMGEAGSATAIEAADIVLLHDSLSSLPWIIQKAKQTKKVVSQNLALALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            LG +PLWL V+LHEG T++V LN++R L  
Sbjct  629  LGIIPLWLAVILHEGSTVIVGLNALRLLKS  658



>ref|WP_010892244.1| HAD family hydrolase [Chlamydia pneumoniae]
 ref|NP_445538.1| cation transporter E1-E2 family ATPase [Chlamydophila pneumoniae 
AR39]
 gb|AAF38779.1| cation-transporting ATPase, E1-E2 family [Chlamydophila pneumoniae 
AR39]
Length=683

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   A+ +GI EV   L PEDKL  +  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  535  DHKVSAENTAEILGISEVFFDLTPEDKLAKIRELATQRQ-IMMVGDGINDAPALAQATVG  593

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  ADI+LL D++S +P+ + KA+QT  ++ QN+ALAL+ I + S  + 
Sbjct  594  IAMGEAGSATAIEAADIVLLHDSLSSLPWIIQKAKQTKKVVSQNLALALAIILLVSWPAS  653

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            LG +PLWL V+LHEG T++V LN++R L  
Sbjct  654  LGIIPLWLAVILHEGSTVIVGLNALRLLKS  683



>ref|WP_014946276.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS27407.1| cadmium-translocating P-type ATPase [Chlamydia psittaci CP3]
Length=657

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIKKSKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>gb|EPJ19566.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC23]
Length=587

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  440  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  498

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  499  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  558

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  559  LGIIPLWLAVILHEGSTIVVGLNALRLLK  587



>ref|WP_014947277.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS21736.1| cadmium-translocating P-type ATPase [Chlamydia psittaci MN]
 emb|CCO02377.1| putative cation transport related membrane protein [Chlamydia 
psittaci 01DC12]
 gb|EPJ25522.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC77]
 gb|EPJ26719.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC80]
 gb|EPJ30633.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC78]
 gb|EPL02046.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 09DC79]
Length=657

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>ref|WP_014946930.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS28462.1| cadmium-translocating P-type ATPase [Chlamydia psittaci NJ1]
Length=657

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>gb|AEB55908.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 6BC]
Length=628

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  481  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  539

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  540  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  599

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  600  LGIIPLWLAVILHEGSTIVVGLNALRLLK  628



>ref|WP_006343557.1| HAD family hydrolase [Chlamydia psittaci]
 ref|YP_004064822.1| putative cation transport related membrane protein [Chlamydia 
psittaci RD1]
 emb|CBY17391.1| putative cation transport related membrane protein [Chlamydia 
psittaci RD1]
 gb|ADZ18138.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 6BC]
 gb|EGF84773.1| cadmium-translocating P-type ATPase [Chlamydia psittaci Cal10]
 gb|AEG85922.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C19/98]
 gb|AEG86897.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 01DC11]
 gb|AEG87875.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC15]
 gb|AEG88848.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 08DC60]
 gb|AFS19977.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 84/55]
 gb|AFS21029.1| cadmium-translocating P-type ATPase [Chlamydia psittaci GR9]
 gb|AFS23161.1| cadmium-translocating P-type ATPase [Chlamydia psittaci VS225]
 gb|AFS23914.1| cadmium-translocating P-type ATPase [Chlamydia psittaci WS/RT/E30]
 gb|AFS25936.1| cadmium-translocating P-type ATPase [Chlamydia psittaci WC]
 gb|AGE75475.1| putative cation transport related membrane protein [Chlamydia 
psittaci Mat116]
 gb|EPJ13310.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC15]
 gb|EPJ14406.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC16]
 gb|EPJ16134.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC18]
 gb|EPJ17305.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC22]
 gb|EPJ17983.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 01DC11]
 gb|EPJ19275.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 03DC29]
 gb|EPJ20669.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC21]
 gb|EPJ22555.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 04DC42]
 gb|EPJ23443.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 08DC60]
 gb|EPJ28342.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 99DC5]
 gb|EPJ28506.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C19/98]
 gb|EPJ31324.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 03DC35]
 gb|EPJ98255.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC24]
 gb|EPJ99999.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 02DC14]
 gb|EPP28743.1| cadmium-translocating P-type ATPase [Chlamydia psittaci 08-2626_L3]
 gb|EPP31092.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C1/97]
 gb|EPP34097.1| cadmium-translocating P-type ATPase [Chlamydia psittaci C6/98]
Length=657

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>ref|WP_011457672.1| HAD family hydrolase [Chlamydophila felis]
 dbj|BAE80887.1| cadmium/zinc cation transporting ATPase [Chlamydophila felis 
Fe/C-56]
Length=657

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV  +L P+DKL  V  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQVSAENTAKLLGISEVFSNLSPDDKLEKVRELANQRH-IVMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA A+  ADI+LL D IS +P+ + KA++T  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAVEAADIVLLHDAISLLPWIIKKAKKTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIIVGLNALRLLK  657



>ref|WP_014945350.1| HAD family hydrolase [Chlamydia psittaci]
 gb|AFS25111.1| cadmium-translocating P-type ATPase [Chlamydia psittaci M56]
Length=657

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHQISAENTAKILGISEVFADLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + K++QT  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKSKQTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIVVGLNALRLLK  657



>ref|WP_011006853.1| HAD family hydrolase [Chlamydophila caviae]
 gb|AAP05639.1| cadmium-translocating P-type ATPase [Chlamydophila caviae GPIC]
Length=657

 Score =   103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   AK +GI EV   L P+DKL  V  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHHISAENTAKLLGISEVFSDLSPDDKLEKVRELAKQRH-ILMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + + E  SA AI  ADI+LL D IS +P+ + KA++T  ++ QN+ LAL+ I + S  + 
Sbjct  569  VAMGEAGSATAIEAADIVLLHDAISLLPWIIRKAKKTRRIVTQNLGLALAIILLVSWPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG +PLWL V+LHEG T++V LN++R L 
Sbjct  629  LGIIPLWLAVILHEGSTIIVGLNALRLLK  657



>ref|WP_044640179.1| cadmium transporter [Thermoactinomycetaceae bacterium GD1]
Length=711

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 98/154 (64%), Gaps = 1/154 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E +A  +A  +GI+EVH  L PE KL  V   ++ +  + MVGDG+NDAPALAAATVG
Sbjct  559  DNEQTAKAIATELGIQEVHAELLPEQKL-EVIKDTQKEHSIAMVGDGVNDAPALAAATVG  617

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF +  +R+T ++IKQN+A AL    +A L  +
Sbjct  618  IAMGGAGTDTALETADLALMGDDLRKLPFAIGLSRKTMTIIKQNIAFALGIKLLALLLII  677

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGS  507
             GFL LWL V    GGTL+V LN++R L +   S
Sbjct  678  PGFLTLWLAVFADMGGTLIVTLNALRLLKNKENS  711



>ref|WP_015506573.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis]
 emb|CCP63663.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/1322/p2]
Length=659

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEGGT++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGGTVIVGLNALRLLKN  658



>ref|WP_012263550.1| HAD family hydrolase [Chlamydia trachomatis]
 emb|CAP06494.1| cation transporting ATPase [Chlamydia trachomatis L2b/UCH-1/proctitis]
 emb|CCP52026.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/8200/07]
 emb|CCP61879.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/795]
 emb|CCP62774.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/440/LN]
 emb|CCP64553.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/115]
 emb|CCP65442.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L1/224]
 emb|CCP67221.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L3/404/LN]
 emb|CCP68109.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/UCH-2]
 emb|CCP69000.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Canada2]
 emb|CCP69891.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/LST]
 emb|CCP70781.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams1]
 emb|CCP71671.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/CV204]
 emb|CCP90836.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams2]
 emb|CCP91726.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams3]
 emb|CCP92618.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Canada1]
 emb|CCP93511.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams4]
 emb|CCP94402.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2b/Ams5]
Length=659

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEGGT++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGGTVIVGLNALRLLKN  658



>ref|WP_009873330.1| HAD family hydrolase [Chlamydia trachomatis]
 ref|YP_001654187.1| cation transporting ATPase [Chlamydia trachomatis 434/Bu]
 emb|CAP03540.1| cation transporting ATPase [Chlamydia trachomatis 434/Bu]
 emb|CCP66333.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
L2/25667R]
 gb|AGJ65124.1| HAD family hydrolase [Chlamydia trachomatis L2/434/Bu(f)]
 gb|AGJ64184.1| HAD family hydrolase [Chlamydia trachomatis L2/434/Bu(i)]
 gb|AGR94172.1| cation transporting ATPase [Chlamydia trachomatis RC-F/69]
 gb|AGR95097.1| cation transporting ATPase [Chlamydia trachomatis RC-L2(s)/46]
 gb|AGR96022.1| cation transporting ATPase [Chlamydia trachomatis RC-F(s)/852]
 gb|AGR96976.1| cation transporting ATPase [Chlamydia trachomatis RC-J/943]
 gb|AGR97897.1| cation transporting ATPase [Chlamydia trachomatis RC-J/953]
 gb|AGR98817.1| cation transporting ATPase [Chlamydia trachomatis RC-L2(s)/3]
 gb|AGS01628.1| cation transporting ATPase [Chlamydia trachomatis RC-J/966]
 gb|AGS03509.1| cation transporting ATPase [Chlamydia trachomatis RC-J/971]
 gb|AGS04437.1| cation transporting ATPase [Chlamydia trachomatis RC-L2/55]
Length=659

 Score =   100 bits (250),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEGGT++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGGTVIVGLNALRLLKN  658



>ref|WP_020753778.1| Lead, cadmium, zinc and mercury transporting ATPase, partial 
[Geobacillus sp. WSUCF1]
 gb|EPR30113.1| Lead, cadmium, zinc and mercury transporting ATPase, partial 
[Geobacillus sp. WSUCF1]
Length=163

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  12   DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  71

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  72   VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  131

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  132  PGWLTLWLAIFADMGATLIVTLNSMRLLN  160



>ref|WP_041018267.1| ATPase [Criblamydia sequanensis]
 emb|CDR34723.1| Heavy metal translocating P-type ATPase [Criblamydia sequanensis 
CRIB-18]
Length=674

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH+ SA +VA AVGI  V   LKPEDKL  + S    +  + M+GDG+NDAPAL  A VG
Sbjct  526  DHKKSAEKVANAVGITHVFAGLKPEDKL-QLISEKNAEMKIAMIGDGVNDAPALTRANVG  584

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  S AAI  ADI+LL DN+  + +  AKA++T  ++ QN++LAL +I VASL ++
Sbjct  585  IGMGKVGSNAAIQAADIVLLHDNLDMLGWLFAKAKKTKKIVIQNLSLALLAIIVASLLAL  644

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
             G +PLWL V+ HEGGT+LV LN++R L D
Sbjct  645  GGIIPLWLAVVCHEGGTVLVGLNALRLLKD  674



>ref|WP_035345963.1| cadmium transporter [Bacillus hemicellulosilyticus]
 dbj|GAE31838.1| lead, cadmium, zinc and mercury transporting ATPase [Bacillus 
hemicellulosilyticus JCM 9152]
Length=704

 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH ++A  +AK +G  EV   L PEDKL+ + ++    G + MVGDGINDAPALA A VG
Sbjct  552  DHRSTASGIAKQLGGIEVKAELLPEDKLHVIRTLKESGGRIAMVGDGINDAPALATANVG  611

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+I  +PF +  +R+T ++IKQN+  +L    VA L  +
Sbjct  612  IAMGGAGTDTALETADIALMADDIEKIPFMIRLSRKTLAIIKQNIVFSLMIKLVAILLIM  671

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
            +G+LPLWL ++   G TLLV +N +R
Sbjct  672  IGWLPLWLAIVADVGATLLVTMNGLR  697



>ref|WP_045554656.1| cadmium transporter, partial [Listeria innocua]
 gb|KJR49827.1| cadmium transporter, partial [Listeria innocua]
Length=399

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  + + VG+ E+   L P+DKL ++  +  + G + MVGDGINDAPALAAATVG
Sbjct  248  DNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKVAMVGDGINDAPALAAATVG  307

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  308  IAMGGAGTDTAIETADVALMGDDLQKLPFTVKLSRKTLQIIKQNITFSLVIKLIALLLVI  367

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  368  PGWLTLWIAIMADMGATLLVTLNGLRLMK  396



>ref|WP_010232691.1| HAD family hydrolase [Chlamydia muridarum]
Length=659

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P+DKL  +  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHRISAENTARMLGIDEVFYDLTPDDKLAKIQELASTRQ-IMMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIKKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGSTVIVGLNALRLLRN  658



>ref|WP_033827061.1| cadmium transporter [Bacillus sp. KW-12]
Length=701

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  +   +G+ EV   L PEDKL ++  +  + G + MVGDG+NDAPALAAA +G
Sbjct  551  DNRATAKAIGSVIGVSEVKAELLPEDKLTYIRQLRNNHGHVAMVGDGVNDAPALAAANIG  610

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++S +P+ +  +R+T  +IKQN+  +L    VA L + 
Sbjct  611  IAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKTLKIIKQNITFSLVVKLVALLLAF  670

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R +N
Sbjct  671  PGWLTLWLAIFADMGATLIVTLNSLRLIN  699



>gb|KJR46509.1| Lead, cadmium, zinc and mercury transporting ATPase [Desulfosporosinus 
sp. I2]
Length=155

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 89/145 (61%), Gaps = 0/145 (0%)
 Frame = -2

Query  965  HEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVGi  786
             +A+A  +AK VGI+E    L P+DK+  V ++    G + MVGDGINDAPALA ATVGI
Sbjct  2    FDATAQAIAKEVGIEEFKAELLPQDKVSAVQNLLNKYGAVAMVGDGINDAPALATATVGI  61

Query  785  vlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsvL  606
             +    +  A+  ADI L+ D+++ +PF +A ++    +IKQN+  +L    VA +    
Sbjct  62   AMGGAGTDTALETADIALMADDLTKLPFTIALSQAALKIIKQNIGFSLFIKLVAIIAVFP  121

Query  605  GFLPLWLTVLLHEGGTLLVCLNSIR  531
            G+L LWL +L   G ++LV LN IR
Sbjct  122  GWLTLWLAILADMGASILVTLNGIR  146



>ref|WP_018924362.1| hypothetical protein [Salsuginibacillus kocurii]
Length=638

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 95/146 (65%), Gaps = 0/146 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K +GI EV   L P+DKL  +  +++++  + MVGDGINDAPALAA+TVG
Sbjct  484  DNTLTATAIGKQLGITEVKADLLPQDKLNVIKQLTKEEQKVAMVGDGINDAPALAASTVG  543

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D+IS +PF +  +R+  ++IKQN+A +L    +A    +
Sbjct  544  IAMGGAGTDTALETADVTLMADDISKLPFTIRLSRKALNVIKQNIAFSLGIKLIAIFFII  603

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
            LG+LPLWL +L   G TLLV LN +R
Sbjct  604  LGWLPLWLAILADVGATLLVTLNGMR  629



>ref|WP_027321941.1| cadmium transporter [Bacillus sp. URHB0009]
Length=666

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  + K VG+ +V   L P+DKL+ +  + RD G + MVGDG+NDAPALA A VG
Sbjct  515  DNHAAAEAIGKTVGMSDVKAELLPQDKLHFIKELQRDYGSVAMVGDGVNDAPALATAAVG  574

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    S  A+  ADI+L+ D++  +PF +  +R+T ++IKQN+  +L    +A L  +
Sbjct  575  IAMGGAGSDTALETADIVLMNDDLRKLPFTIKLSRKTLTIIKQNITFSLVIKVIALLLVI  634

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TLLV LN +R L 
Sbjct  635  PGWLTLWIAIFADMGTTLLVTLNGLRLLK  663



>ref|WP_010229366.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AAF38980.1| cation-transporting ATPase, E1-E2 family [Chlamydia muridarum 
str. Nigg]
 gb|AHH22499.1| HAD family hydrolase [Chlamydia muridarum str. Nigg3 CMUT3-5]
 gb|AHH23423.1| HAD family hydrolase [Chlamydia muridarum str. Nigg CM972]
 gb|KDU80374.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU81094.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU82161.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU83046.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|KDU84152.1| cadmium-translocating P-type ATPase [Chlamydia muridarum]
 gb|AID37650.1| HAD family hydrolase [Chlamydia muridarum str. Nigg 2 MCR]
 gb|AIT90337.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AIT91225.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AIW23099.1| HAD family hydrolase [Chlamydia muridarum]
 gb|AJR10203.1| HAD family hydrolase [Chlamydia muridarum]
Length=659

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHRISAENTAQLLGIDEVFYDLTPDNKLSKIQELAKTRQ-IMMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALALS I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIKKAKKTRRIVSQNLALALSIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGIIPLWLAVILHEGSTVIVGLNALRLLKN  658



>ref|WP_035407486.1| HAD family hydrolase [Chlamydia suis]
 gb|ESN89048.1| cadmium-translocating P-type ATPase [Chlamydia suis MD56]
Length=659

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 100/150 (67%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P DKL  +  ++  +  ++MVGDGINDAPALA ATVG
Sbjct  510  DHRISAENTARMLGIDEVFYDLTPADKLAKIQELASTRQ-IMMVGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIKKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGSTVVVGLNALRLLRN  658



>ref|WP_013119349.1| cadmium transporter [Thermincola potens]
 gb|ADG81326.1| heavy metal translocating P-type ATPase [Thermincola potens JR]
Length=689

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  +A+  GI E H  L P+DK+  V ++    G + MVGDGINDAPALAAATVG
Sbjct  535  DNKATAKAIAEKAGIDEFHAELLPQDKVAAVNNLVNKFGKVAMVGDGINDAPALAAATVG  594

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+++ +PF V  +R T S+IKQN+  A+    +A +   
Sbjct  595  IAMGGAGTDTALETADIALMADDLAKLPFLVRLSRATLSVIKQNIYFAVVIKLIAVVLIF  654

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +L   G  +LV LN+IR L 
Sbjct  655  PGWLMLWMAILADTGAAVLVTLNAIRLLR  683



>ref|WP_009872104.1| HAD family hydrolase [Chlamydia trachomatis]
 ref|NP_220246.1| metal transport ATPase [Chlamydia trachomatis D/UW-3/CX]
 gb|AAC68322.1| Metal Transport P-type ATPase [Chlamydia trachomatis D/UW-3/CX]
 gb|AAX51005.1| lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis A/HAR-13]
 emb|CAX10293.1| cation transporting ATPase [Chlamydia trachomatis B/TZ1A828/OT]
 gb|ADH19372.1| cation transporting ATPase [Chlamydia trachomatis G/11222]
 gb|ADI51404.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis D-EC]
 gb|ADI52416.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis D-LC]
 gb|AEJ77039.1| cadmium-translocating P-type ATPase [Chlamydia trachomatis L2c]
 gb|AEP35617.1| Lead, cadmium, zinc and mercury transporting ATPase [Chlamydia 
trachomatis A2497]
 emb|CAX09399.1| cation transporting ATPase [Chlamydia trachomatis A2497]
 emb|CCP49922.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
A/7249]
 emb|CCP49024.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
A/5291]
 emb|CCP48125.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
A/363]
 emb|CCP50906.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
K/SotonK1]
 emb|CCP53815.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
D/SotonD5]
 emb|CCP54706.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
D/SotonD6]
 emb|CCP58306.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
G/SotonG1]
 emb|CCP59200.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
Ia/SotonIa1]
 emb|CCP60094.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
Ia/SotonIa3]
 gb|AGS00685.1| cation transporting ATPase [Chlamydia trachomatis RC-J(s)/122]
 gb|AGS02556.1| cation transporting ATPase [Chlamydia trachomatis J/6276tet1]
 gb|AGT70257.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT71181.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT73023.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AHC17589.1| HAD family hydrolase [Chlamydia trachomatis C/TW-3]
Length=659

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGSTVIVGLNALRLLKN  658



>ref|WP_014541063.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|ADH18447.1| cation transporting ATPase [Chlamydia trachomatis G/9768]
 gb|ADH20294.1| cation transporting ATPase [Chlamydia trachomatis G/11074]
 gb|ADH97392.1| cation transporting ATPase [Chlamydia trachomatis G/9301]
Length=659

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGSTVIVGLNALRLLKN  658



>ref|WP_012727986.1| HAD family hydrolase [Chlamydia trachomatis]
 emb|CAX11186.1| cation transporting ATPase [Chlamydia trachomatis B/Jali20/OT]
Length=659

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGSTVIVGLNALRLLKN  658



>ref|WP_009872881.1| HAD family hydrolase [Chlamydia trachomatis]
 ref|YP_008635241.1| cation transporting ATPase [Chlamydia trachomatis E/C599]
 ref|YP_008655897.1| cation transporting ATPase [Chlamydia trachomatis F/SWFPminus]
 emb|CBJ15252.1| cation transporting ATPase [Chlamydia trachomatis Sweden2]
 gb|ADH17524.1| cation transporting ATPase [Chlamydia trachomatis E/150]
 gb|ADH21216.1| cation transporting ATPase [Chlamydia trachomatis E/11023]
 emb|CCE14790.1| cation transporting ATPase [Chlamydia trachomatis F/SW5]
 emb|CCE13901.1| cation transporting ATPase [Chlamydia trachomatis F/SW4]
 emb|CCE13012.1| cation transporting ATPase [Chlamydia trachomatis E/SW3]
 emb|CCP52923.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
D/SotonD1]
 emb|CCP55596.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
E/SotonE4]
 emb|CCP56496.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
E/SotonE8]
 emb|CCP57413.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
F/SotonF3]
 emb|CCP60989.1| zinc/cadmium/mercury/lead-transporting ATPase [Chlamydia trachomatis 
E/Bour]
 emb|CCP28526.1| cation transporting ATPase [Chlamydia trachomatis IU824]
 emb|CCP29427.1| cation transporting ATPase [Chlamydia trachomatis IU888]
 gb|AGR99739.1| cation transporting ATPase [Chlamydia trachomatis RC-F(s)/342]
 gb|AGT64698.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT65627.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT66553.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT67482.1| HAD family hydrolase [Chlamydia trachomatis F/11-96]
 gb|AGT68404.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT69335.1| HAD family hydrolase [Chlamydia trachomatis]
 gb|AGT72096.1| HAD family hydrolase [Chlamydia trachomatis]
 emb|CDG43629.1| cation transporting ATPase [Chlamydia trachomatis E/C599]
 emb|CDG42740.1| cation transporting ATPase [Chlamydia trachomatis F/SWFPminus]
Length=659

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  SA   A+ +GI EV   L P++KL  +  +++ +  ++M+GDGINDAPALA ATVG
Sbjct  510  DHRISAENTARLLGIDEVFYDLTPDNKLSKIQELAKSRQ-IMMIGDGINDAPALAQATVG  568

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + E  SA AI  AD++LL   +S +P+ + KA++T  ++ QN+ALAL+ I   S  + 
Sbjct  569  IAMGEAGSATAIEAADVVLLNQGLSSLPWLIDKAKKTRRIVSQNLALALAIILFISGPAS  628

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALND  519
            +G +PLWL V+LHEG T++V LN++R L +
Sbjct  629  MGVIPLWLAVILHEGSTVIVGLNALRLLKN  658



>ref|WP_034285888.1| cadmium transporter [Bacillus sp. 72]
Length=703

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   + K +G+ EV   L P+DKL  + S+    G + MVGDGINDAPALA+ATVG
Sbjct  551  DNQATGKAIGKQLGLSEVKADLMPQDKLEAIKSLREQHGKVAMVGDGINDAPALASATVG  610

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +A +R+T ++IKQNV  A     +A L  +
Sbjct  611  IAMGGAGTDTALETADIALMADDLEKLPYTIALSRKTLNVIKQNVTFAFGLKLLALLLII  670

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TL+V LNS+R L 
Sbjct  671  PGWLTLWMAIFADMGATLIVVLNSLRLLK  699



>ref|WP_018393724.1| cadmium transporter [Bacillus sp. 37MA]
Length=703

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   + K +G+ EV   L P+DKL  + S+    G + MVGDGINDAPALA+ATVG
Sbjct  551  DNQATGKAIGKQLGLSEVKADLMPQDKLEAIKSLREQHGKVAMVGDGINDAPALASATVG  610

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +A +R+T ++IKQNV  A     +A L  +
Sbjct  611  IAMGGAGTDTALETADIALMADDLEKLPYTIALSRKTLNVIKQNVTFAFGLKLLALLLII  670

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TL+V LNS+R L 
Sbjct  671  PGWLTLWMAIFADMGATLIVVLNSLRLLK  699



>gb|EGL48480.1| HAD ATPase, P-type, family IC domain protein [Streptococcus dysgalactiae 
subsp. equisimilis SK1249]
Length=202

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  51   DNQRTATAIGKQVGVSDIKADLLPEDKLNFIKELREKHQSVGMVGDGVNDAPALAASTVG  110

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L+   VA L  +
Sbjct  111  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLAIKLVALLLVM  170

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TLLV LNS+R L 
Sbjct  171  PGWLTLWIAIFADMGATLLVTLNSLRLLK  199



>ref|WP_020755401.1| Lead, cadmium, zinc and mercury transporting ATPase, partial 
[Geobacillus sp. WSUCF1]
 gb|EPR28095.1| Lead, cadmium, zinc and mercury transporting ATPase, partial 
[Geobacillus sp. WSUCF1]
Length=163

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  12   DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKHQSVAMVGDGVNDAPALAASTVG  71

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L   A+A L  V
Sbjct  72   VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKALALLLIV  131

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R L 
Sbjct  132  PGWLTLWLAIFADMGATLIVTLNSMRLLK  160



>ref|WP_007786745.1| cadmium transporter [Brevibacillus sp. CF112]
 gb|EJL39569.1| copper/silver/heavy metal-translocating P-type ATPase, Cd/Co/Hg/Pb/Zn-transporting 
[Brevibacillus sp. CF112]
Length=710

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  + + +G+ EV   L P+DKL ++  +  D G + MVGDG+NDAPALAA+TVG
Sbjct  555  DNRATAEAIGRQLGVAEVKAELLPQDKLAYIKQLRNDYGNVAMVGDGVNDAPALAASTVG  614

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +  +R+T ++IKQNV  +L    +A +  V
Sbjct  615  IAMGGAGTDTALETADIALMADDLGKLPYTMKLSRKTLAIIKQNVTFSLGIKLLALILIV  674

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R L 
Sbjct  675  PGWLTLWLAIFADMGATLIVTLNSLRLLK  703



>ref|WP_031644883.1| cadmium-transporting ATPase [Listeria monocytogenes]
 gb|KES26329.1| cadmium transporter [Listeria monocytogenes]
 gb|KES34305.1| cadmium transporter [Listeria monocytogenes]
 gb|KEX11332.1| cadmium transporter [Listeria monocytogenes]
 gb|KEX39670.1| cadmium transporter [Listeria monocytogenes]
 gb|KEX50072.1| cadmium transporter [Listeria monocytogenes]
Length=711

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  + + VG+ E+   L P+DKL ++  +  + G + MVGDGINDAPALAAATVG
Sbjct  560  DNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKVAMVGDGINDAPALAAATVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  620  IAMGGAGTDTAIETADVALMGDDLQKLPFTVKLSRKTLQIIKQNITFSLVIKLIALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  680  PGWLTLWIAIMADMGATLLVTLNGLRLMK  708



>ref|WP_003728466.1| MULTISPECIES: cadmium-transporting ATPase [Listeria]
 ref|YP_003728018.1| cadmium resistance protein B [Listeria monocytogenes]
 sp|Q60048.1|CADA_LISMN RecName: Full=Probable cadmium-transporting ATPase; AltName: 
Full=Cadmium efflux ATPase [Listeria monocytogenes]
 gb|AAA25275.1| ATPase [Listeria monocytogenes]
 gb|EEW20231.1| ATPase [Listeria monocytogenes FSL R2-503]
 gb|ADB69774.1| cadmium-transporting ATPase [Listeria monocytogenes 08-5578]
 gb|EFG03437.1| ATPase [Listeria monocytogenes FSL J1-194]
 gb|ADI61866.1| cadmium resistance protein B [Listeria monocytogenes]
 gb|EFK40156.1| ATPase [Listeria monocytogenes FSL N1-017]
 emb|CBV37084.1| cadmium transport ATPase [Listeria monocytogenes serotype 7 str. 
SLCC2482]
 emb|CBV37138.1| cadmium transport ATPase [Listeria monocytogenes SLCC2372]
 emb|CBV37201.1| cadmium transport ATPase [Listeria monocytogenes]
 gb|EFR98897.1| cadmium-translocating P-type ATPase [Listeria seeligeri FSL N1-067]
 gb|EFS03216.1| cadmium-translocating P-type ATPase [Listeria seeligeri FSL S4-171]
 gb|EHN62656.1| cadmium-exporting ATPase [Listeria innocua ATCC 33091]
 gb|AGR27763.1| cadmium transporter [Listeria monocytogenes]
 gb|AGT06861.1| cadmium transporter [Listeria monocytogenes]
 emb|CDM18240.1| cadmium-transporting ATPase Tn5422 [Listeria monocytogenes 6179]
 gb|EXL18939.1| cadmium transport ATPase [Listeria monocytogenes Lm_1823]
 gb|EXL21925.1| cadmium transport ATPase [Listeria monocytogenes Lm_1889]
 gb|EXL25268.1| cadmium transport ATPase [Listeria monocytogenes Lm_1880]
 gb|EXL27895.1| cadmium transport ATPase [Listeria monocytogenes Lm_1886]
 emb|CDM15195.1| cadmium-transporting ATPase Tn5422 [Listeria monocytogenes R479a]
 gb|EZH69221.1| cadmium transporter [Listeria monocytogenes N53-1]
 emb|CDN70871.1| putative cadmium-transporting ATPase [Listeria monocytogenes 
4423]
 gb|KES69559.1| cadmium transporter [Listeria monocytogenes]
 gb|KET14710.1| cadmium transporter [Listeria monocytogenes]
 gb|KET19775.1| cadmium transporter [Listeria monocytogenes]
 gb|KEU31882.1| cadmium transporter [Listeria monocytogenes]
 gb|KEU36494.1| cadmium transporter [Listeria monocytogenes]
 gb|KEU50361.1| cadmium transporter [Listeria monocytogenes]
 gb|KEV47502.1| cadmium transporter [Listeria monocytogenes]
 gb|KEW28041.1| cadmium transporter [Listeria monocytogenes]
 gb|KEX44095.1| cadmium transporter [Listeria monocytogenes]
 gb|AIS61015.1| cadmium transporter [Listeria ivanovii subsp. londoniensis]
 gb|AIS63823.1| cadmium transporter [Listeria ivanovii subsp. londoniensis]
 gb|KHK04895.1| cadmium transport ATPase [Listeria monocytogenes SHL004]
 gb|KHK04983.1| cadmium transport ATPase [Listeria monocytogenes SHL002]
 gb|KHK19156.1| cadmium transport ATPase [Listeria monocytogenes SHL008]
 gb|KID12733.1| cadmium transporter [Listeria monocytogenes]
 gb|KID18978.1| cadmium transporter [Listeria monocytogenes]
 gb|KID20268.1| cadmium transporter [Listeria monocytogenes]
 gb|KID22220.1| cadmium transporter [Listeria monocytogenes]
 gb|KID26756.1| cadmium transporter [Listeria monocytogenes]
 gb|KJR49718.1| cadmium transporter [Listeria innocua]
 gb|KKB89191.1| cadmium transporter [Listeria monocytogenes]
Length=711

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  + + VG+ E+   L P+DKL ++  +  + G + MVGDGINDAPALAAATVG
Sbjct  560  DNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKVAMVGDGINDAPALAAATVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  620  IAMGGAGTDTAIETADVALMGDDLQKLPFTVKLSRKTLQIIKQNITFSLVIKLIALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  680  PGWLTLWIAIMADMGATLLVTLNGLRLMK  708



>ref|WP_035066778.1| cadmium transporter [Carnobacterium maltaromaticum]
Length=711

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  + + VG+ E+   L P+DKL ++  +  + G + MVGDGINDAPALAAATVG
Sbjct  560  DNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKVAMVGDGINDAPALAAATVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  620  IAMGGAGTDTAIETADVALMGDDLQKLPFTVKLSRKTLQIIKQNITFSLVIKLIALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  680  PGWLTLWIAIMADMGATLLVTLNGLRLMK  708



>ref|WP_015076936.1| cadmium-translocating P-type ATPase [Carnobacterium maltaromaticum]
 emb|CCO11808.2| cadmium-translocating P-type ATPase [Carnobacterium maltaromaticum 
LMA28]
Length=711

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  + + VG+ E+   L P+DKL ++  +  + G + MVGDGINDAPALAAATVG
Sbjct  560  DNQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKVAMVGDGINDAPALAAATVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  620  IAMGGAGTDTAIETADVALMGDDLQKLPFTVKLSRKTLQIIKQNITFSLVIKLIALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  680  PGWLTLWIAIMADMGATLLVTLNGLRLMK  708



>ref|WP_044394570.1| cadmium transporter [Bacillus subterraneus]
 gb|KIY21436.1| cadmium transporter [Bacillus subterraneus]
Length=704

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E +A  + K VG+ E+   L PEDKL ++  +      + MVGDG+NDAPALA+ATVG
Sbjct  553  DNEGTAKAIGKEVGVMEIQAELLPEDKLVYIKQLRSKYDKVAMVGDGVNDAPALASATVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A +  V
Sbjct  613  IAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKLLALVLIV  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R L 
Sbjct  673  PGWLTLWLAIFADMGATLIVTLNSLRLLK  701



>ref|WP_016838775.1| hypothetical protein [Ureibacillus thermosphaericus]
Length=715

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+EA+A  +    GI EV   L PEDKL  V ++ +  G + MVGDG+NDAPALAAATVG
Sbjct  564  DNEATAKAIGSEAGILEVKADLMPEDKLEFVKTLRKQYGKVAMVGDGVNDAPALAAATVG  623

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+  + D+++ +PF +  +R+  ++IK N+A AL    +A L  V
Sbjct  624  IAMGGAGTDTALETADVAFMSDDLNKLPFTIKLSRKALAVIKTNIAFALGVKLLALLLVV  683

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R L
Sbjct  684  PGWLTLWIAIFSDMGATLLVTLNSMRLL  711



>ref|WP_033543579.1| cadmium transporter [Planococcus sp. CAU13]
Length=697

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH A+A  +AK +G+ +V   L PEDKL  +  + ++ G + MVGDGINDAPALAA+TVG
Sbjct  546  DHPATANAIAKEIGVTDVRAGLMPEDKLSAIRGLQQEYGRVAMVGDGINDAPALAASTVG  605

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +  +R+T  +IK+N+  AL    +A L  +
Sbjct  606  IAMGGAGTDTALETADIALMADDLEKLPYTIRLSRKTLRIIKENIMFALGLKVIALLLII  665

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
             G+L LW+ +    G TLLV LN++R
Sbjct  666  PGWLTLWIAIFADMGATLLVILNALR  691



>ref|WP_025038999.1| hypothetical protein, partial [Geobacillus sp. FW23]
Length=289

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  138  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  197

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  198  VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  257

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  258  PGWLTLWLAIFADMGATLIVTLNSMRLLN  286



>ref|WP_036184416.1| cadmium transporter [Lysinibacillus manganicus]
 gb|KGR79392.1| cadmium transporter [Lysinibacillus manganicus DSM 26584]
Length=717

 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 95/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E +A+ + + VG+ E+   L PEDKL+ +  +  + G + MVGDG+NDAPALAA+TVG
Sbjct  566  DNERAAMAIGRKVGVSEIQAELLPEDKLHTIKRLRSEYGKVAMVGDGVNDAPALAASTVG  625

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D+++ +PF +  +R+  ++IK N+A AL    +A L  V
Sbjct  626  IAMGGAGTDTALETADVTLMADDLTKLPFTIKLSRKALTIIKTNIAFALGIKLIALLLVV  685

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R +
Sbjct  686  PGWLTLWIAIFSDMGATLLVSLNSMRLM  713



>ref|WP_009225275.1| cadmium transporter [Paenibacillus sp. oral taxon 786]
 gb|EES72856.1| cadmium-exporting ATPase [Paenibacillus sp. oral taxon 786 str. 
D14]
Length=712

 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 95/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  + + + + +V   L P+DKL ++  + +D G + M+GDG+NDAPALAA+TVG
Sbjct  557  DNQATAEAIGRRLNVTDVKADLMPQDKLDYIKQLRKDYGNVAMIGDGVNDAPALAASTVG  616

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++S +P+ +  +R+T ++IKQN+  +L    +A    V
Sbjct  617  IAMGGAGTDTALETADIALMADDLSKLPYTIRLSRKTLAIIKQNITFSLGIKLLALALIV  676

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LWL +    G TL+V LNS+R L
Sbjct  677  PGWLTLWLAIFADMGATLIVTLNSLRLL  704



>dbj|GAJ60133.1| cadmium-transporting ATPase [Geobacillus thermoleovorans B23]
Length=284

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  133  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  192

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  193  VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  252

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  253  PGWLTLWLAIFADMGATLIVTLNSMRLLN  281



>ref|WP_033845577.1| cadmium transporter, partial [Geobacillus thermoleovorans]
Length=293

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  142  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  201

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  202  VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  261

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  262  PGWLTLWLAIFADMGATLIVTLNSMRLLN  290



>ref|WP_034626912.1| cadmium transporter [Bacillus okhensis]
 gb|KHF40916.1| cadmium transporter [Bacillus okhensis]
Length=708

 Score = 97.8 bits (242),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE SA R+A  VG+ +V  +L P +K+ +V SI +    + MVGDG+NDA ALA A VG
Sbjct  548  DHETSAHRIASQVGMTDVKANLLPNEKVSYVESIRKKGNHVAMVGDGVNDAAALATANVG  607

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    S  A+  ADI+ ++D++S +PF +  +R+  ++IKQN+ L+L    +A +  +
Sbjct  608  IAMGGAGSDVALETADIVFMKDDLSKLPFTIQLSRKARTIIKQNITLSLVLKLLALMLVI  667

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R LN
Sbjct  668  PGWLTLWIAIIADMGATLLVTLNGLRLLN  696



>ref|WP_021322493.1| hypothetical protein, partial [Geobacillus sp. A8]
 gb|EQB94637.1| hypothetical protein GA8_14955, partial [Geobacillus sp. A8]
Length=317

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  166  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  225

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  226  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  285

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  286  PGWLTLWLAIFADMGATLIVTLNSMRLLN  314



>ref|WP_015592581.1| cadmium transporter [Bacillus sp. 1NLA3E]
 gb|AGK52518.1| cadmium efflux P-type ATPase [Bacillus sp. 1NLA3E]
Length=612

 Score = 97.1 bits (240),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E +A  V   VG+ ++   L P+DKL  +  +  + G + MVGDGINDAPALAAA+VG
Sbjct  461  DNEGTAKAVGALVGVTDIQAELLPQDKLTMIKKLRAEYGNVAMVGDGINDAPALAAASVG  520

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +PF +  +R+   +IKQN+  +L+   +A L  V
Sbjct  521  VAMGGAGTDTALETADIALMGDDLSKLPFTIKLSRKALMIIKQNITFSLAVKILALLLVV  580

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TLLV LN +R LN
Sbjct  581  PGWLTLWIAIFADMGATLLVTLNGLRLLN  609



>emb|CKH65593.1| cadmium translocating P-type ATPase CadA%2C putative [Staphylococcus 
aureus]
Length=157

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  +   + M+GDG+NDAPALAA+TVG
Sbjct  5    DNQGTANAIGTHVGVSDIQSELMPQDKLDYIKKMQSEYDNVAMIGDGVNDAPALAASTVG  64

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  65   IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  124

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  125  PGWLTLWIAILSDMGATILVALNSLRLM  152



>ref|WP_011245132.1| cadmium transporter [Bacillus clausii]
 dbj|BAD62812.1| cadmium-transporting ATPase [Bacillus clausii KSM-K16]
Length=709

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + +AVG+ ++   L PEDKL  +     + G + MVGDG+NDAPALAAATVG
Sbjct  558  DNKQTAHAIGQAVGVADIQAELMPEDKLRFIKQWQENHGHVAMVGDGVNDAPALAAATVG  617

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +PF V  +R+T ++IK N+A A++    A L  V
Sbjct  618  IAMGGAGTDTALETADIALMGDDLKKLPFTVKLSRKTLNIIKANIAFAIAIKLAALLLVV  677

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
             G+L LW+ +L   G TLLV LNSIR
Sbjct  678  PGWLTLWIAILSDMGATLLVALNSIR  703



>ref|WP_010750087.1| heavy metal translocating P-type ATPase [Enterococcus villorum]
 gb|EOH94677.1| heavy metal translocating P-type ATPase [Enterococcus villorum 
ATCC 700913]
 gb|EOW77052.1| cadmium-translocating P-type ATPase [Enterococcus villorum ATCC 
700913]
Length=705

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K  G+ E+   L P+DKL ++ S+    G + MVGDGINDAPALAA+TVG
Sbjct  553  DNATTAQSIGKQTGVTEIKGDLMPQDKLDYIKSLKETYGKVAMVGDGINDAPALAASTVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF V  +RQT  +IKQN+  +L    +A L  V
Sbjct  613  IAMGGAGTDTALETADVALMGDDLQKLPFIVKLSRQTLRIIKQNITFSLGIKLLALLLVV  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LN +R +
Sbjct  673  PGWLTLWIAILADMGATILVTLNGLRLM  700



>ref|WP_002406005.1| cadmium transporter [Enterococcus faecalis]
 gb|EFQ14535.1| cadmium-exporting ATPase [Enterococcus faecalis EnGen0311]
 gb|EOI21070.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0251]
 gb|EOI88664.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0311]
 gb|EOL61550.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0247]
Length=705

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 90/148 (61%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K  G+ E+   L P+DKL ++ S+    G + MVGDGINDAPALAA+TVG
Sbjct  553  DNATTAQSIGKQTGVTEIKGDLMPQDKLDYIKSLKETYGKVAMVGDGINDAPALAASTVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF V  +RQT  +IKQN+  +L    +  L  V
Sbjct  613  IAMGGAGTDTALETADVALMGDDLQKLPFIVKLSRQTLRIIKQNITFSLGIKLLTLLLVV  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LN +R +
Sbjct  673  PGWLTLWIAILADMGATILVTLNGLRLM  700



>ref|WP_002372033.1| MULTISPECIES: cadmium transporter [Bacilli]
 gb|EFM66298.1| cadmium-exporting ATPase [Enterococcus faecalis TX0411]
 gb|EFM75814.1| cadmium-exporting ATPase [Enterococcus faecalis TX2134]
 gb|EJS79915.1| Cadmium-transporting ATPase [Enterococcus faecalis ATCC 29212]
 gb|EJY41456.1| cadmium-exporting ATPase [Enterococcus faecium 506]
 gb|EOK03428.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0367]
 gb|EOL25887.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0354]
 gb|EOL80770.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0295]
 gb|EOL83539.1| heavy metal translocating P-type ATPase [Enterococcus faecalis 
EnGen0283]
 gb|EOT39270.1| cadmium-translocating P-type ATPase [Enterococcus dispar ATCC 
51266]
 gb|EOW86315.1| cadmium-translocating P-type ATPase [Enterococcus dispar ATCC 
51266]
 gb|ETU39439.1| cadmium-translocating P-type ATPase [Enterococcus faecalis EnGen0417]
 gb|ETU52284.1| cadmium-translocating P-type ATPase [Enterococcus faecalis EnGen0422]
 gb|ETU60060.1| cadmium-translocating P-type ATPase [Enterococcus faecalis EnGen0425]
 gb|AIL05210.1| copper-translocating P-type ATPase [Enterococcus faecalis ATCC 
29212]
 gb|KHK11429.1| cadmium efflux ATPase CadA [Listeria monocytogenes SHL001]
Length=705

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K  G+ E+   L P+DKL ++ S+    G + MVGDGINDAPALAA+TVG
Sbjct  553  DNATTAQSIGKQTGVTEIKGDLMPQDKLDYIKSLKETYGKVAMVGDGINDAPALAASTVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF V  +RQT  +IKQN+  +L    +A L  V
Sbjct  613  IAMGGAGTDTALETADVALMGDDLQKLPFIVKLSRQTLRIIKQNITFSLGIKLLALLLVV  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LN +R +
Sbjct  673  PGWLTLWIAILADMGATILVTLNGLRLM  700



>ref|WP_016612417.1| cadmium-exporting ATPase [Enterococcus faecium]
 gb|EPH63782.1| cadmium-exporting ATPase [Enterococcus faecium 13.SD.W.09]
Length=707

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K VG+ ++   L PE+KL ++ S+ +  G + M+GDG+NDAPALAA+TVG
Sbjct  555  DNATTAQSIGKQVGVTDIKGDLMPEEKLDYIKSLKQTYGKVAMIGDGVNDAPALAASTVG  614

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF V  +RQT ++IKQN+  +L    +A L  +
Sbjct  615  IAMGGAGTDTALETADVALMGDDLQKLPFIVKLSRQTLTVIKQNITFSLVIKLIALLLVI  674

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV  N +R +
Sbjct  675  PGWLTLWIAILADMGATLLVTFNGLRLM  702



>ref|WP_034678530.1| cadmium transporter [Bacillus megaterium]
Length=706

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 91/149 (61%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   +A+ +GI E    L P+DKL  +  +    G + MVGDG+NDAPALAAA +G
Sbjct  556  DNQATGKAIAQQIGITETKAELMPQDKLVAIKQVREQYGSVAMVGDGVNDAPALAAANIG  615

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +A +++T  +IKQN+  A     VA L  +
Sbjct  616  IAMGGAGTDTALETADIALMSDDLDKLPYTMALSKKTLKIIKQNIIFAFVLKLVALLLVI  675

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TL+V LNS+R +N
Sbjct  676  PGWLTLWIAIFADMGATLIVVLNSLRLMN  704



>ref|WP_035202397.1| cadmium transporter [Bacillus clausii]
 gb|KFE63131.1| Cadmium-transporting ATPase [Bacillus clausii]
Length=709

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + +A+G+ ++   L PEDKL  +    +  G + MVGDG+NDAPALAAATVG
Sbjct  558  DNKRTAHAIGQAIGVADIQAELMPEDKLRFIKQWQKKHGNVAMVGDGVNDAPALAAATVG  617

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I + +  +  A+  ADI L+ D++  +PF V  +R+T ++IK N+A A+     A L  V
Sbjct  618  IAMGKAGTDTALETADIALMGDDLKKLPFTVKLSRKTLNIIKANIAFAIVIKLAALLLVV  677

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
             G+L LW+ +L   G TLLV LNS+R
Sbjct  678  PGWLTLWIAILSDMGATLLVALNSMR  703



>dbj|GAE26891.1| cadmium-transporting ATPase [Bacillus wakoensis JCM 9140]
Length=665

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E +A  + + VG+ +V   L PEDKL ++  +  + G + MVGDG+NDAPALAA+TVG
Sbjct  513  DNERTANAIGEHVGVTDVQAELMPEDKLEYIKRLRSEYGNVAMVGDGVNDAPALAASTVG  572

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D+++ +P+ V  +R+  ++IKQN+  +L    VA L  +
Sbjct  573  IAMGGAGTDTALETADVALMGDDLTKLPYTVKLSRKALNIIKQNITFSLGIKLVALLLVI  632

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV LN +R L
Sbjct  633  PGWLTLWIAILADMGATLLVTLNGLRLL  660



>gb|ETT40493.1| cadmium efflux P-type ATPase [Paenibacillus sp. FSL R5-808]
Length=715

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +A +VG+ +V   L P+DKL ++  +  + G + MVGDGINDAPALAA+TVG
Sbjct  564  DNKGTATAIAGSVGVSDVQAELLPQDKLDYIKQLRSEYGNVAMVGDGINDAPALAASTVG  623

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF +  +R   S+IKQN+  AL    +A L  +
Sbjct  624  IAMGGAGTDTALETADVALMGDDLRKLPFAIKLSRNALSIIKQNITFALVIKLIALLLVI  683

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV LN +R +
Sbjct  684  PGWLTLWIAILSDMGATLLVALNGLRLM  711



>ref|WP_004436784.1| cadmium transporter [Bacillus methanolicus]
 gb|EIJ78384.1| cadmium efflux P-type ATPase [Bacillus methanolicus PB1]
Length=674

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + + VG+ ++   L P+DKL  +  +  D G + MVGDG+NDAPALA+ATVG
Sbjct  522  DNKGTAKAIGEQVGVSDIQAELLPQDKLEFIKKLRNDYGKVAMVGDGVNDAPALASATVG  581

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + ++   +  A+  ADI L+ D++  +PF V  +R+T ++IKQN+  ++    +A L  +
Sbjct  582  VAMSGAGTDTALETADIALMGDDLRKLPFTVKLSRKTLAIIKQNIIFSIGVKLLALLLVI  641

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TLLV LN +R L 
Sbjct  642  PGWLTLWIAIFADMGATLLVTLNGLRLLK  670



>ref|WP_036638569.1| cadmium transporter [Paenibacillus sp. FSL R5-808]
Length=718

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +A +VG+ +V   L P+DKL ++  +  + G + MVGDGINDAPALAA+TVG
Sbjct  567  DNKGTATAIAGSVGVSDVQAELLPQDKLDYIKQLRSEYGNVAMVGDGINDAPALAASTVG  626

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF +  +R   S+IKQN+  AL    +A L  +
Sbjct  627  IAMGGAGTDTALETADVALMGDDLRKLPFAIKLSRNALSIIKQNITFALVIKLIALLLVI  686

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV LN +R +
Sbjct  687  PGWLTLWIAILSDMGATLLVALNGLRLM  714



>ref|WP_034274569.1| cadmium transporter [Bacillus sp. J13]
Length=718

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +A +VG+ +V   L P+DKL ++  +  + G + MVGDGINDAPALAA+TVG
Sbjct  567  DNKGTATAIAGSVGVSDVQAELLPQDKLDYIKQLRSEYGNVAMVGDGINDAPALAASTVG  626

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF +  +R   S+IKQN+  AL+   +A L  +
Sbjct  627  IAMGGAGTDTALETADVALMGDDLRKLPFAIKLSRNALSIIKQNITFALAIKLIALLLVI  686

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV LN +R +
Sbjct  687  PGWLTLWIAILSDMGATLLVALNGLRLM  714



>ref|WP_008300244.1| putative cadmium-transporting ATPase [Bhargavaea cecembensis]
 gb|EMR05584.1| putative cadmium-transporting ATPase [Bhargavaea cecembensis 
DSE10]
Length=701

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+EA+   +   +G+ E    L PEDKL  + ++    G + MVGDG+NDAPALAAATVG
Sbjct  550  DNEATGQAIGHQLGLSETRAELLPEDKLAFIRTLRGQNGNVAMVGDGVNDAPALAAATVG  609

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    + AA+  AD+ L+ D++  +P+ +A +R+T ++IKQN++ A+     A L  V
Sbjct  610  IAMGGAGTDAALETADVALMADDLEKLPYTIALSRKTLAIIKQNISFAILVKIAALLLVV  669

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LWL +    G TL+V  NS+R L
Sbjct  670  PGWLTLWLAIFADMGATLIVVANSLRLL  697



>ref|WP_044337850.1| cadmium transporter [Bacillus aquimaris]
Length=703

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DHE +A+ + K VG+KE+   L P+ KL  V       G + MVGDGINDAPALAA+ VG
Sbjct  550  DHENTAMSIGKRVGVKEIKAGLLPQHKLDFVKQYMNTYGKVSMVGDGINDAPALAASNVG  609

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+++ +P+ +  +R+T ++IKQN++ A+    +A L  +
Sbjct  610  IAMGGAGTDTALETADIALMNDDLTKLPYIIRLSRKTLTIIKQNISFAIGIKLLALLLVI  669

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LN +R L
Sbjct  670  PGWLTLWIAIFADMGATLLVTLNGLRLL  697



>ref|WP_033567369.1| cadmium transporter, partial [Staphylococcus aureus]
Length=304

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  152  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  211

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  212  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  271

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  272  PGWLTLWIAILSDMGATILVALNSLRLM  299



>gb|KIY23838.1| cadmium transporter [Bacillus subterraneus]
Length=674

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  +    G+ ++   L PE+KL  + S+ +D G + MVGDGINDAPALAAATVG
Sbjct  522  DNRGTAQAIGSLAGVSDIQSDLLPEEKLAFIKSLQKDHGKVAMVGDGINDAPALAAATVG  581

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +PF +  +R+T ++IKQN+A ++    +A L  +
Sbjct  582  IAMGGAGTDTALETADIALMADDLKKLPFTIKLSRKTLAIIKQNIAFSIGVKLLALLLVI  641

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TL+V LN +R L
Sbjct  642  PGWLTLWIAIFADMGATLIVTLNGLRLL  669



>ref|WP_044124828.1| cadmium transporter, partial [Staphylococcus aureus]
Length=320

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  168  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  227

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  228  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  287

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  288  PGWLTLWIAILSDMGATILVALNSLRLM  315



>ref|WP_044118888.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EVJ75391.1| hypothetical protein U061_02845, partial [Staphylococcus aureus 
KINW6048]
Length=328

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  176  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  235

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  236  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  295

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  296  PGWLTLWIAILSDMGATILVALNSLRLM  323



>ref|WP_036807509.1| cadmium transporter [Planomicrobium glaciei]
 gb|ETP68465.1| cadmium transporter [Planomicrobium glaciei CHR43]
Length=689

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 93/146 (64%), Gaps = 0/146 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  +A  +A  +G+K+V   L PEDKL  +  + ++ G + MVGDG+NDAPALAA+T+G
Sbjct  538  DHPVTARAIASQIGVKDVRAGLMPEDKLSAIKDLQKEYGRVAMVGDGVNDAPALAASTIG  597

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    + AA+  ADI L+ D++  +P+ +  +R+T  +IK+N+  AL    +A L  +
Sbjct  598  IAMGGAGTDAALETADIALMADDLEKLPYTIRLSRKTLRIIKENIVFALGLKIIALLLII  657

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
             G+L LW+ +    G TLLV +N++R
Sbjct  658  PGWLTLWIAIFADMGATLLVIMNALR  683



>ref|WP_027410416.1| cadmium transporter [Anoxybacillus tepidamans]
Length=701

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  +  A+G+ EV   L PEDKL  +  I  + G + MVGDG+NDAPALAAA+VG
Sbjct  552  DNRATATSIGGALGVNEVKAELLPEDKLRIIKEIRDEHGRIAMVGDGVNDAPALAAASVG  611

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++  +P+ +  +R+T  +IKQN+  AL    +A +  V
Sbjct  612  VAMGAAGTDVALETADIVLMSDDLQQLPYVIRLSRKTLRIIKQNIMFALLLKLLALILIV  671

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ V    G TL+V  NS+R + 
Sbjct  672  PGWLTLWMAVFADMGATLIVLFNSLRLMR  700



>ref|WP_036174038.1| cadmium transporter [Lysinibacillus massiliensis]
 gb|KGR91265.1| cadmium transporter [Lysinibacillus massiliensis 4400831 = CIP 
108448 = CCUG 49529]
Length=712

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E++A      +G+ +V   L PEDKL ++  +  + G + MVGDG+NDAPALAAATVG
Sbjct  561  DNESTAKAKGHEIGVSDVQAELMPEDKLNYIKQLRSEYGKVAMVGDGVNDAPALAAATVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  AD++L+ D+++ +PF +  +R+   +IK N+  AL    +A L  V
Sbjct  621  VAMGGAGTDTALETADVVLMADDLTKLPFTIKLSRKALGIIKSNIIFALGIKVLALLLVV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV LNS+R L
Sbjct  681  PGWLTLWIAILADMGATLLVSLNSMRLL  708



>ref|WP_021290516.1| MULTISPECIES: hypothetical protein [Virgibacillus]
 gb|EQB37188.1| hypothetical protein M948_09915 [Virgibacillus sp. CM-4]
 emb|CDQ41216.1| putative cadmium-transporting ATPase [Virgibacillus sp. Vm-5]
Length=702

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   + K +GI E    L PE+KL  +  +S+  G + MVGDGINDAPALAAA +G
Sbjct  549  DNQATGQAIGKQIGISETRAELMPEEKLNAIKQLSKQHGSVAMVGDGINDAPALAAADIG  608

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +PF +  +R+T  +IKQN+  AL    +A L  +
Sbjct  609  IAMGGAGTDTAMETADIALMADDLGKLPFTMDLSRKTLQVIKQNIIFALGLKVIALLLVI  668

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TL+V LNS+R + 
Sbjct  669  PGWLTLWIAIFADMGATLIVVLNSLRLMK  697



>ref|WP_040285593.1| cadmium transporter [Sporosarcina koreensis]
Length=702

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D   +A  +AK +G+ +V   L PEDKL  + S+SR K  + MVGDG+NDAPALAAA+VG
Sbjct  551  DDPNTAASIAKELGMDDVRAGLMPEDKLTAIRSLSRGKQRVAMVGDGVNDAPALAAASVG  610

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    + AA+  ADI L+ D++  +P+ V  +R+T   IK+N+  A+     A L  +
Sbjct  611  IAMGGAGTDAALETADIALMADDLEQLPYTVQLSRKTLRTIKENIMFAVGLKIAALLLVI  670

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R +
Sbjct  671  PGWLTLWIAIFADMGATLLVVLNSLRLM  698



>ref|WP_035301102.1| cadmium transporter, partial [Brevibacillus thermoruber]
Length=514

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  +   +G+ EV   L P+DKL  +  + ++ G + M+GDG+NDAPALAA+TVG
Sbjct  363  DNRATAEAIGSQLGVAEVKAELLPQDKLEFIKQLRKEYGNVAMIGDGVNDAPALAASTVG  422

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +  +R+T ++IKQN+  +L   A+A L  V
Sbjct  423  IAMGGAGTDTALETADIALMADDLGKLPYTMKLSRKTLTIIKQNITFSLGIKALALLLIV  482

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TL+V LNS+R L
Sbjct  483  PGWLTLWMAIFADMGATLIVTLNSLRLL  510



>emb|CCO07049.1| putative cadmium-transporting ATPase [Desulfotomaculum hydrothermale 
Lam5 = DSM 18033]
Length=728

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH A+A  VA+ +GI +   +L P+DK+  V ++    G + MVGDGINDAPALAAA +G
Sbjct  556  DHMATAGSVARQIGIPDYQANLLPQDKVLAVQTLRERYGSIGMVGDGINDAPALAAANIG  615

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD++L+ D++S +PF V   R+   +IKQN+  A+S   +A L   
Sbjct  616  IAMGGAGNDTALETADVVLMTDDLSKLPFAVRLGREARRVIKQNIFFAISIKTLAVLLVF  675

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LWL +L   G  LLV LNS+R L
Sbjct  676  PGWLTLWLAILADMGAGLLVTLNSMRLL  703



>ref|WP_019380955.1| cadmium transporter [Bacillus oceanisediminis]
Length=708

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   +  +VG+ EV   L P+DKL  + S+    G + MVGDGINDAPALA++TVG
Sbjct  557  DNKATGQAIGNSVGLTEVKAELMPQDKLSTINSLREQHGKVAMVGDGINDAPALASSTVG  616

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+++ +P+ +  +R+T  +IKQN+  AL    +A +  V
Sbjct  617  IAMGGAGTDTALETADIALMADDLNKLPYTIELSRRTLGIIKQNITFALGLKLLALVLIV  676

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TL+V LNS+R L 
Sbjct  677  PGWLTLWMAIFADMGATLIVVLNSMRLLK  705



>ref|WP_007502121.1| ATPase [Caldalkalibacillus thermarum]
 gb|EGL84263.1| heavy metal translocating P-type ATPase [Caldalkalibacillus thermarum 
TA2.A1]
Length=671

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 90/149 (60%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  +AK VG+ E +  L P+DKL  +  +    G + M+GDG+NDAPALA+ATVG
Sbjct  520  DNNQTAAAIAKLVGVDEYYGELLPQDKLAKIKELREKYGKVAMIGDGVNDAPALASATVG  579

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++S +PF +   R    +IKQN++ AL +  +A L   
Sbjct  580  IAMGGAGTDTALETADIALMADDLSKLPFMIRLGRNAVRVIKQNISFALITKLIAVLLVF  639

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +L   G T+LV LN IR L 
Sbjct  640  PGWLTLWLAILADMGATILVTLNGIRLLK  668



>ref|WP_035040546.1| metal ABC transporter ATPase, partial [Aquabacterium sp. NJ1]
Length=775

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+E  A  VA +VGI +V   L PEDKL  +  + RD   + MVGDG+NDAPA+A AT+G
Sbjct  624  DNEPVAKAVAASVGITDVRAGLLPEDKLKVIDELMRDHQQVAMVGDGVNDAPAMARATIG  683

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++S +PF +A +R + S+I+QN+  A   +A+    ++
Sbjct  684  IAMGGAGTDVALETADVALMGDDLSRLPFAIALSRASRSIIQQNLWAAFGVVALLIPATL  743

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG   + + VL+HEG T+LV LN++R L 
Sbjct  744  LGLASMGVAVLIHEGATVLVVLNALRLLR  772



>ref|WP_014097067.1| cadmium transporter [Bacillus coagulans]
 gb|AEP00982.1| cadmium-translocating P-type ATPase [Bacillus coagulans 36D1]
 gb|KGT38128.1| cadmium transporter [Bacillus coagulans P38]
 gb|AJH78051.1| copper-translocating P-type ATPase [Bacillus coagulans DSM 1 
= ATCC 7050]
Length=711

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  V K VG+ ++   L PEDKL  +  +     G+ MVGDG+NDAPALAA+TVG
Sbjct  560  DNKRTAEVVGKEVGVSDIKADLLPEDKLNFIKELRGKNQGVAMVGDGVNDAPALAASTVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  S+IKQN+  +L+   VA L  +
Sbjct  620  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALSIIKQNITFSLAIKLVALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R L
Sbjct  680  PGWLTLWIAIFSDMGATLLVTLNSLRLL  707



>ref|WP_017473047.1| hypothetical protein [Amphibacillus jilinensis]
Length=718

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + + VG+  V   L PEDKL  + ++S   G + MVGDG+NDAPALAAATVG
Sbjct  567  DNQITAHAIGEQVGVTRVQAELMPEDKLNAIRALSDQFGKVAMVGDGVNDAPALAAATVG  626

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D+++ +PF V  +R+T  +IK N+  ++    VA L  V
Sbjct  627  IAMGSVGTDTALETADVALMGDDLTKLPFVVKLSRKTLRVIKSNITFSILIKLVALLLVV  686

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G TLLV LNS+R +
Sbjct  687  PGWLTLWIAILSDMGATLLVSLNSMRLM  714



>ref|WP_023508362.1| cadmium transporter [Sporolactobacillus laevolacticus]
 gb|EST13264.1| cadmium transporter [Sporolactobacillus laevolacticus DSM 442]
Length=704

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 96/146 (66%), Gaps = 1/146 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++++A  + K VG+ E+   L PE+KL ++ S SR K  + MVGDG+NDAPALA ATVG
Sbjct  554  DNKSTAEAIGKEVGVSEIKAELLPEEKLTYIKSYSR-KQKVAMVGDGVNDAPALAEATVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+++ +P+ +  +R+  ++IKQNV  +L+  A++ L   
Sbjct  613  IAMGGAGTDTALETADIALMSDDLTKLPYTIKLSRKALAIIKQNVTFSLAIKAISILLIF  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIR  531
             G+L LW+ +L   G TL+V LNS+R
Sbjct  673  PGWLTLWIAILADVGATLIVTLNSLR  698



>ref|WP_017552366.1| cadmium transporter [Bacillus coagulans]
Length=711

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  V K VG+ ++   L PEDKL  +  +     G+ MVGDG+NDAPALAA+TVG
Sbjct  560  DNKRTAEVVGKEVGVSDIKADLLPEDKLNFIKELRGKNQGVAMVGDGVNDAPALAASTVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  S+IKQN+  +L+   VA L  +
Sbjct  620  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALSIIKQNITFSLAIKLVALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R L
Sbjct  680  PGWLTLWIAIFSDMGATLLVTLNSLRLL  707



>ref|WP_013860498.1| cadmium transporter [Bacillus coagulans]
 gb|AEH54614.1| heavy metal translocating P-type ATPase [Bacillus coagulans 2-6]
Length=711

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  V K VG+ ++   L PEDKL  +  +     G+ MVGDG+NDAPALAA+TVG
Sbjct  560  DNKRTAEVVGKEVGVSDIKADLLPEDKLNFIKELRGKNQGVAMVGDGVNDAPALAASTVG  619

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  S+IKQN+  +L+   VA L  +
Sbjct  620  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALSIIKQNITFSLAIKLVALLLVI  679

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R L
Sbjct  680  PGWLTLWIAIFSDMGATLLVTLNSLRLL  707



>ref|WP_018131873.1| ATPase [Effusibacillus pohliae]
Length=701

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 90/149 (60%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  +AK VG+ E H  L P++KL  +  +    G + MVGDGINDAPALA+ATVG
Sbjct  551  DNNKTAAAIAKQVGVDEFHGELLPDNKLEKMKQLREQYGKVAMVGDGINDAPALASATVG  610

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++S +P+ V   R    +IKQN+A AL +  +A L   
Sbjct  611  IAMGGAGTDTALETADIALMADDLSKLPYTVRLGRNAIRVIKQNIAFALVTKLLAVLLVF  670

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +L   G T+LV LN IR L 
Sbjct  671  PGWLTLWLAILADMGATILVTLNGIRLLK  699



>ref|WP_026700046.1| cadmium transporter [Bacillus aidingensis]
Length=674

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            DH  +A  + K VGI+ V   L PE+KL ++  ++++     MVGDG+NDAPALA A VG
Sbjct  522  DHRRTAEAIGKEVGIRNVQAELLPEEKLSYIQKLTKNNKKAAMVGDGVNDAPALANAAVG  581

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ V  +R+T ++IKQN+  AL   A A L  +
Sbjct  582  IAMGGAGTDTALETADITLMADDLEKLPYTVNLSRKTLNIIKQNIVFALGVKAAALLLVI  641

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALNDPT  513
             G+L LW+ +    G TLLV LN++R L   T
Sbjct  642  PGWLTLWIAIFADMGATLLVTLNALRLLKTKT  673



>ref|WP_009374038.1| MULTISPECIES: Cadmium-transporting ATPase CadA [Lysinibacillus]
 gb|EKU41016.1| Cadmium-transporting ATPase CadA [Lysinibacillus fusiformis ZB2]
 gb|KER43059.1| cadmium transporter [Lysinibacillus fusiformis]
 gb|KGR82533.1| cadmium transporter [Lysinibacillus boronitolerans JCM 21713 
= 10a = NBRC 103108]
 gb|KHK52014.1| cadmium transporter [Lysinibacillus sp. A1]
 gb|AJK85965.1| cadmium transporter [Lysinibacillus fusiformis]
Length=792

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ E+   L PEDKL ++  + +D G + MVGDG+NDAPALAA+TVG
Sbjct  641  DNKGTANAIGHHVGVSEIQAELMPEDKLSYIKQLRKDYGNVAMVGDGVNDAPALAASTVG  700

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF +  +R+  ++IK N+A A+     A L  +
Sbjct  701  IAMGGAGTDTALETADVALMADDLRKLPFTIKLSRKALNIIKANIAFAILIKLAALLLVI  760

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ ++   G TLLV LNS+R +
Sbjct  761  PGWLTLWIAIVSDMGATLLVALNSLRLM  788



>ref|WP_044116546.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EVE65137.1| hypothetical protein T780_02861, partial [Staphylococcus aureus 
LAMC0011]
Length=355

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  203  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  262

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  263  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  322

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  323  PGWLTLWIAILSDMGATILVALNSLRLM  350



>ref|WP_044116778.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EVF45613.1| hypothetical protein T831_02786, partial [Staphylococcus aureus 
UCIM6042]
Length=377

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  225  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  284

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  285  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  344

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  345  PGWLTLWIAILSDMGATILVALNSLRLM  372



>ref|WP_040037563.1| MULTISPECIES: cadmium transporter [unclassified Bacillaceae]
 gb|KKB34714.1| Lead, cadmium, zinc and mercury transporting ATPase [Bacillaceae 
bacterium MTCC 8252]
 gb|KKB38771.1| Lead, cadmium, zinc and mercury transporting ATPase [Bacillaceae 
bacterium MTCC 10057]
Length=703

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   +   +G+ +V   L P+DKL  V S+    G + M+GDGINDAPALA ATVG
Sbjct  551  DNQATGKAIGTQLGLSDVKADLMPQDKLEAVKSLREQHGKIAMIGDGINDAPALATATVG  610

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    + AA+  ADI L+ D++  +P+ +A +R+T ++IKQNV+ AL    +A L  V
Sbjct  611  IAMGGAGTDAALETADIALMADDLEKLPYTIALSRKTLNIIKQNVSFALGLKLLALLLIV  670

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R + 
Sbjct  671  PGWLTLWLAIFADMGATLIVVLNSLRLMK  699



>ref|WP_044120432.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EUR00211.1| hypothetical protein T707_02851, partial [Staphylococcus aureus 
UCIM6015]
Length=369

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  217  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  276

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  277  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  336

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  337  PGWLTLWIAILSDMGATILVALNSLRLM  364



>ref|WP_044120700.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EVI50636.1| hypothetical protein T983_02846, partial [Staphylococcus aureus 
WAMC6102]
Length=355

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  203  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  262

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  263  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  322

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  323  PGWLTLWIAILSDMGATILVALNSLRLM  350



>ref|WP_020279842.1| cadmium-transporting ATPase [Geobacillus kaustophilus]
 dbj|GAD15337.1| cadmium-transporting ATPase [Geobacillus kaustophilus GBlys]
Length=485

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  334  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  393

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  394  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  453

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  454  PGWLTLWLAIFADMGATLIVTLNSMRLLN  482



>ref|WP_041305724.1| cadmium transporter [Kyrpidia tusciae]
Length=708

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 91/149 (61%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  + + VG+ EV   L PEDK+  V+ + +  G + MVGDG+NDAPALAAAT G
Sbjct  555  DNPATARAIGRTVGVDEVRAGLLPEDKVRAVSELRQRYGRVGMVGDGVNDAPALAAATTG  614

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++S VPF V   R T  +I+QN+ +AL     A L + 
Sbjct  615  IAMGTSGTDLALEAADVALMNDDLSKVPFAVRLGRATLRIIQQNIFIALFMKTAALLLAF  674

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL ++   G TLLV  N++R L 
Sbjct  675  PGWLTLWLAIVGDMGATLLVTANALRLLR  703



>ref|WP_044118635.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EVC22522.1| hypothetical protein T665_02796, partial [Staphylococcus aureus 
SJOS6053]
Length=369

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  217  DNQGTAEAIGAHVGVSDIQSELLPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  276

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  277  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  336

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  337  PGWLTLWIAILSDMGATILVALNSLRLM  364



>ref|WP_026575931.1| cadmium transporter [Bacillus sp. UNC438CL73TsuS30]
Length=579

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ ASA  + +  GIK++   L PEDKL  + S+    G + MVGDG+NDAPALA+AT+G
Sbjct  428  DNHASAEAIGQYTGIKKMEAELLPEDKLNLIKSLKHQFGRVAMVGDGVNDAPALASATIG  487

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+++ +PF +  +R+T  +IKQN+ +++    VA L  V
Sbjct  488  IAMGGAGTDTALETADIALMNDDLTKLPFTIHLSRKTLKIIKQNITISIVIKLVALLLVV  547

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G T+LV LN +R L
Sbjct  548  PGWLTLWIAIFADMGTTILVTLNGLRLL  575



>dbj|GAE92807.1| lead, cadmium, zinc and mercury transporting ATPase [Gracilibacillus 
boraciitolerans JCM 21714]
Length=524

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 91/148 (61%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   +   +G+ E    L PEDKL  +  +    G + MVGDG+NDAPALAA+TVG
Sbjct  371  DNKATGEAIGNQLGLTETKAELLPEDKLNEIKDLRNQYGKIAMVGDGVNDAPALAASTVG  430

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +A +R+T ++IKQN+  AL    +A L  +
Sbjct  431  IAMGGAGTDTALETADIALMADDLEKLPYTIALSRKTMTIIKQNIFFALGLKLLALLLII  490

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LWL +    G TL+V LNS+R +
Sbjct  491  PGWLTLWLAIFADMGATLIVVLNSLRLM  518



>gb|EAO63130.1| cation-transporting ATPase, E1-E2 family [Streptococcus agalactiae 
18RS21]
Length=355

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  204  DNQRTATAIGKQVGVSDIKADLLPEDKLNFIKELREKHQSVGMVGDGVNDAPALAASTVG  263

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L+   VA L  +
Sbjct  264  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLAIKLVALLLVM  323

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TLLV LNS+R L
Sbjct  324  PGWLTLWIAIFADMGATLLVTLNSLRLL  351



>ref|WP_021322558.1| hypothetical protein, partial [Geobacillus sp. A8]
 gb|EQB94633.1| hypothetical protein GA8_15850, partial [Geobacillus sp. A8]
Length=317

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  166  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKHQSVAMVGDGVNDAPALAASTVG  225

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L   A+A L  V
Sbjct  226  VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKALALLLIV  285

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LWL +    G TL+V LNS+R L
Sbjct  286  PGWLTLWLAIFADMGATLIVTLNSMRLL  313



>ref|WP_034781872.1| cadmium transporter, partial [Exiguobacterium mexicanum]
Length=373

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 96/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +   + + VG+ E+   L PEDKL  +  +  +   + MVGDG+NDAPALAA+TVG
Sbjct  222  DNKGTGKAIGQQVGVNEIQAELMPEDKLNIIKRLRAEYDNVAMVGDGVNDAPALAASTVG  281

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++S +PF +  +R++ ++IK N+A A+S  A+A L  +
Sbjct  282  IAMGGAGTDTALETADVALMGDDLSKLPFTIKLSRKSLNIIKVNIAFAISIKAIALLLVI  341

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LNS+R +N
Sbjct  342  PGWLTLWIAIMSDMGATLLVALNSLRLMN  370



>dbj|GAE27699.1| lead, cadmium, zinc and mercury transporting ATPase [Bacillus 
wakoensis JCM 9140]
Length=673

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLI-MVGDGINDAPALAAATV  792
            DHEASA  +AK VG+  V  +L P++K+ +V SI R+KG  + M+GDG+NDA ALA A V
Sbjct  521  DHEASANVIAKQVGMTNVKANLLPDEKVSYVQSI-REKGSHVAMIGDGVNDAAALATANV  579

Query  791  GivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavaslts  612
            G+ +    S  A+  ADI+ ++D+++ +PF +  +R+  S+IKQN+ L+L    VA L  
Sbjct  580  GVAMGGAGSDVALETADIVFMKDDLAKLPFTIQLSRKARSIIKQNITLSLVLKLVALLLV  639

Query  611  vLGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            + G+L LW+ ++   G TLLV LN +R L 
Sbjct  640  IPGWLTLWIAIIADMGATLLVTLNGLRLLK  669



>ref|WP_034799686.1| cadmium transporter, partial [Exiguobacterium aurantiacum]
Length=373

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 96/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +   + + VG+ E+   L PEDKL  +  +  +   + MVGDG+NDAPALAA+TVG
Sbjct  222  DNKGTGKAIGQQVGVNEIQAELMPEDKLNVIKRLRAEYDNVAMVGDGVNDAPALAASTVG  281

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++S +PF +  +R++ ++IK N+A A+S  A+A L  +
Sbjct  282  IAMGGAGTDTALETADVALMGDDLSKLPFTIKLSRKSLNIIKVNIAFAISIKAIALLLVI  341

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LNS+R +N
Sbjct  342  PGWLTLWIAIMSDMGATLLVALNSLRLMN  370



>ref|WP_039069840.1| cadmium transporter [Brevibacillus borstelensis]
Length=704

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  +   +G+ EV   L P+DKL ++  + ++   + MVGDG+NDAPALAA+TVG
Sbjct  553  DNQATAEAIGSQLGVAEVKAELLPQDKLEYIKKLRKEYENVAMVGDGVNDAPALAASTVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ ++ +R+T ++IKQN++ +L    +A +  +
Sbjct  613  IAMGGAGTDTALETADIALMADDLDKLPYTMSLSRKTLNIIKQNISFSLGIKLLALILII  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TL+V LNS+R L
Sbjct  673  PGWLTLWMAIFADMGATLVVTLNSLRLL  700



>gb|ADG06775.1| heavy metal translocating P-type ATPase [Kyrpidia tusciae DSM 
2912]
Length=742

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 91/149 (61%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+ A+A  + + VG+ EV   L PEDK+  V+ + +  G + MVGDG+NDAPALAAAT G
Sbjct  589  DNPATARAIGRTVGVDEVRAGLLPEDKVRAVSELRQRYGRVGMVGDGVNDAPALAAATTG  648

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++S VPF V   R T  +I+QN+ +AL     A L + 
Sbjct  649  IAMGTSGTDLALEAADVALMNDDLSKVPFAVRLGRATLRIIQQNIFIALFMKTAALLLAF  708

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL ++   G TLLV  N++R L 
Sbjct  709  PGWLTLWLAIVGDMGATLLVTANALRLLR  737



>ref|WP_035385747.1| cadmium transporter, partial [Exiguobacterium sp. GIC31]
Length=373

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 96/149 (64%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +   + + VG+ E+   L PEDKL  +  +  +   + MVGDG+NDAPALAA+TVG
Sbjct  222  DNKGTGKAIGQQVGVNEIQAELMPEDKLNVIKRLRAEYDNVAMVGDGVNDAPALAASTVG  281

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++S +PF +  +R++ ++IK N+A A+S  A+A L  +
Sbjct  282  IAMGGAGTDTALETADVALMGDDLSKLPFTIKLSRKSLNIIKVNIAFAISIKAIALLLVI  341

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LNS+R +N
Sbjct  342  PGWLTLWIAIMSDMGATLLVALNSLRLMN  370



>ref|WP_033013733.1| cadmium transporter [Geobacillus stearothermophilus]
Length=712

 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  561  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKHQSVAMVGDGVNDAPALAASTVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L   A+A L  V
Sbjct  621  VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKALALLLIV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  681  PGWLTLWLAIFADMGATLIVTLNSMRLLN  709



>emb|CDN41322.1| Probable cadmium-transporting ATPase [Paenibacillus sp. P22]
Length=705

 Score = 94.7 bits (234),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  +   + + +V   L P+DKL ++  + +D G + M+GDG+NDAPALAA+TVG
Sbjct  553  DNQATAEAIGSRLNVTDVKADLMPQDKLDYIKQLRKDYGNVAMIGDGVNDAPALAASTVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +  +R+T ++IKQN+  +L    VA    V
Sbjct  613  IAMGGAGTDTALETADIALMADDLGKLPYTIRLSRKTLAIIKQNITFSLGIKLVALALIV  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +    G TL+V LNS+R L 
Sbjct  673  PGWLTLWMAIFADMGATLIVTLNSLRLLK  701



>ref|WP_042411719.1| cadmium transporter [Geobacillus caldoxylosilyticus]
 dbj|GAJ41458.1| cadmium-transporting ATPase [Geobacillus caldoxylosilyticus NBRC 
107762]
Length=712

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  561  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  621  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  681  PGWLTLWLAIFADMGATLIVTLNSMRLLN  709



>ref|WP_035666842.1| cadmium transporter [Bacillus akibai]
Length=708

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + + VG+ +V   L PEDKL ++  +  + G + MVGDG+NDAPALAA+TVG
Sbjct  556  DNKRTAKAIGEHVGVTDVQAELMPEDKLEYIKRLRSEYGNVAMVGDGVNDAPALAASTVG  615

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D+++ +P+ V  +R+  ++IKQN+  +L    VA L  +
Sbjct  616  IAMGGAGTDTALETADVALMGDDLTKLPYTVKLSRKALNIIKQNITFSLGIKLVALLLVI  675

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +L   G TLLV LN +R L 
Sbjct  676  PGWLTLWIAILADMGATLLVTLNGLRLLR  704



>ref|WP_031879516.1| cadmium transporter, partial [Staphylococcus aureus]
 gb|EYQ73119.1| hypothetical protein W276_02917, partial [Staphylococcus aureus 
DAR3144]
Length=264

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  +   + M+GDG+NDAPALAA+TVG
Sbjct  112  DNQGTANAIGTHVGVSDIQSELMPQDKLDYIKKMQSEYDNVAMIGDGVNDAPALAASTVG  171

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  172  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  231

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  232  PGWLTLWIAILSDMGATILVALNSLRLM  259



>ref|WP_012749257.1| cadmium transporter [Geobacillus sp. WCH70]
 gb|ACS23452.1| heavy metal translocating P-type ATPase [Geobacillus sp. WCH70]
Length=712

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  561  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  621  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  681  PGWLTLWLAIFADMGATLIVTLNSMRLLN  709



>ref|WP_016621962.1| cadmium-exporting ATPase [Enterococcus faecalis]
 gb|EPH87121.1| cadmium-exporting ATPase [Enterococcus faecalis 06-MB-DW-09]
Length=706

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K  GI E+   L P+DKL ++ ++ +  G + M+GDG+NDAPALAA+TVG
Sbjct  554  DNATTAQSIGKQTGITEIKGDLMPQDKLDYIKALKQTYGKVAMIGDGMNDAPALAASTVG  613

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    + AA+  AD+ L+ D++  +PF +  +R+T  +IKQN+  +L    +A L  V
Sbjct  614  IAMGSIGTDAALETADVALMGDDLQKLPFIIKLSRETLKIIKQNITFSLGIKLLALLLVV  673

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +L   G TLLV LN +R + 
Sbjct  674  PGWLTLWIAILADMGATLLVTLNGLRLMK  702



>ref|WP_035067453.1| cadmium transporter [Anoxybacillus gonensis]
 gb|KGP59690.1| cadmium transporter [Anoxybacillus gonensis]
Length=712

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  561  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI+L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  621  VAMGGAGTDTALETADIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  681  PGWLTLWLAIFADMGATLIVTLNSMRLLN  709



>dbj|GAE36673.1| cadmium-transporting ATPase [Bacillus akibai JCM 9157]
Length=715

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + + VG+ +V   L PEDKL ++  +  + G + MVGDG+NDAPALAA+TVG
Sbjct  563  DNKRTAKAIGEHVGVTDVQAELMPEDKLEYIKRLRSEYGNVAMVGDGVNDAPALAASTVG  622

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D+++ +P+ V  +R+  ++IKQN+  +L    VA L  +
Sbjct  623  IAMGGAGTDTALETADVALMGDDLTKLPYTVKLSRKALNIIKQNITFSLGIKLVALLLVI  682

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ +L   G TLLV LN +R L 
Sbjct  683  PGWLTLWIAILADMGATLLVTLNGLRLLR  711



>ref|WP_035333303.1| cadmium transporter [Bacillus firmus]
 gb|EWG08553.1| ATPase P [Bacillus firmus DS1]
Length=708

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+   +  +V + EV   L P+DKL  + S+    G + MVGDGINDAPALA++TVG
Sbjct  557  DNKATGEAIGNSVSLSEVKAELMPQDKLNTINSLREQYGKVAMVGDGINDAPALASSTVG  616

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D+++ +P+ +  +R+T  +IKQN+  AL    +A +  V
Sbjct  617  IAMGGAGTDTALETADIALMADDLNKLPYTIELSRRTLGIIKQNITFALGLKLLALVLIV  676

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
            LG+L LW+ +    G TLLV LNS+R L 
Sbjct  677  LGWLTLWMAIFADMGATLLVVLNSMRLLK  705



>ref|WP_004577738.1| MULTISPECIES: cadmium-transporting ATPase [Bacillaceae]
 gb|EMT44794.1| cadmium-transporting ATPase [Anoxybacillus flavithermus AK1]
 gb|KDE50159.1| cadmium transporter [Geobacillus sp. CAMR5420]
Length=712

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  561  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  621  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  681  PGWLTLWLAIFADMGATLIVTLNSMRLLN  709



>ref|WP_011230089.1| MULTISPECIES: cadmium transporter [Geobacillus]
 dbj|BAD74870.1| cadmium-transporting ATPase [Geobacillus kaustophilus HTA426]
 gb|AEV17966.1| cadmium-transporting ATPase [Geobacillus thermoleovorans CCB_US3_UF5]
Length=712

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  + K VG+ ++   L PEDKL  +  +      + MVGDG+NDAPALAA+TVG
Sbjct  561  DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVG  620

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            + +    +  A+  ADI L+ D++S +P+ +  +R+  ++IKQN+  +L    +A L  V
Sbjct  621  VAMGGAGTDTALETADIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIV  680

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LWL +    G TL+V LNS+R LN
Sbjct  681  PGWLTLWLAIFADMGATLIVTLNSMRLLN  709



>ref|XP_005645930.1| heavy metal translocatin [Coccomyxa subellipsoidea C-169]
 gb|EIE21386.1| heavy metal translocatin [Coccomyxa subellipsoidea C-169]
Length=812

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 7/162 (4%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKG------GLIMVGDGINDAPAL  807
            D+E SA R+A  +GI +V   L+P +K   + +  R+        G+IMVGDG+ND PAL
Sbjct  609  DNEVSAARIAARLGIADVSAGLRPGEKQAAIEAAQREAAASPRGSGVIMVGDGMNDLPAL  668

Query  806  AAATVGivlaerasaaaiavadillLQDN-ISGVPFCVAKARQTTSLIKQNvalalssia  630
            AAATVG+ +A     A     D++LL +N    VP  +  A +T S+I+QN+ LA  SIA
Sbjct  669  AAATVGVGVAGSRPGAVANWVDVILLHNNGAEAVPLLLDTAHRTRSIIRQNLVLAFGSIA  728

Query  629  vasltsvLGFLPLWLTVLLHEGGTLLVCLNSIRALNDPTGSW  504
              +L ++LG++PLW  V LHEG T+LV LN  R L+ P  SW
Sbjct  729  ALALPALLGWVPLWAAVALHEGSTVLVALNCTRLLSLPRRSW  770



>ref|WP_029194015.1| cadmium transporter [Paenibacillus alginolyticus]
Length=705

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 93/148 (63%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++A+A  +   + + +V   L P+DKL ++  + +D G + M+GDG+NDAPALAA+TVG
Sbjct  553  DNQATAEAIGSRLNVTDVKADLMPQDKLDYIKQLRKDYGNVAMIGDGVNDAPALAASTVG  612

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  ADI L+ D++  +P+ +  +R+T ++IKQN+  +L    VA    V
Sbjct  613  IAMGGAGTDTALETADIALMADDLGKLPYTIRLSRKTLAIIKQNITFSLGIKLVALALIV  672

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +    G TL+V LNS+R L
Sbjct  673  PGWLTLWMAIFADMGATLIVTLNSLRLL  700



>gb|EFB58003.1| cadmium-translocating P-type ATPase [Staphylococcus aureus subsp. 
aureus WW2703/97]
Length=507

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D++ +A  +   VG+ ++   L P+DKL ++  +  + G + M+GDG+NDAPALAA+TVG
Sbjct  355  DNQGTAEAIGAHVGVSDIQSELMPQDKLDYIKKMKAEHGNVAMIGDGVNDAPALAASTVG  414

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  AI  ADI L+ D++S +PF V  +R+T ++IK N+  A+    +A L  +
Sbjct  415  IAMGGAGTDTAIETADIALMGDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVI  474

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRAL  525
             G+L LW+ +L   G T+LV LNS+R +
Sbjct  475  PGWLTLWIAILSDMGATILVALNSLRLM  502



>ref|WP_010989665.1| cadmium-transporting ATPase [Listeria monocytogenes]
 ref|NP_464625.1| cadmium resistance protein [Listeria monocytogenes EGD-e]
 sp|P58414.1|CADA_LISMO RecName: Full=Probable cadmium-transporting ATPase; AltName: 
Full=Cadmium efflux ATPase [Listeria monocytogenes EGD-e]
 emb|CAC99178.1| cadmium resistance protein [Listeria monocytogenes EGD-e]
Length=707

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K +G+ ++   L PEDKL ++  + +  G + M+GDG+NDAPALAA+TVG
Sbjct  556  DNNDTAQFIGKEIGVSDIKAELMPEDKLTYIKELKQTYGKVAMIGDGVNDAPALAASTVG  615

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  616  IAMGGAGTDTALETADVALMGDDLKKLPFIVNLSRKTLKIIKQNITFSLGIKLLALLLVL  675

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  676  PGWLTLWIAIVADMGATLLVTLNGLRLMK  704



>ref|WP_039670424.1| cadmium transporter [Streptococcus macedonicus]
 emb|CAE52410.1| cadmium efflux ATPase [Streptococcus thermophilus]
 gb|KEH51979.1| cadmium transporter [Streptococcus macedonicus]
 gb|KEH52994.1| cadmium transporter [Streptococcus macedonicus]
Length=707

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -2

Query  968  DHEASALRVAKAVGIKEVHCSLKPEDKLYHVTSISRDKGGLIMVGDGINDAPALAAATVG  789
            D+  +A  + K +G+ ++   L PEDKL ++  + +  G + M+GDG+NDAPALAA+TVG
Sbjct  556  DNNDTAQFIGKEIGVSDIKAELMPEDKLTYIKELKQTYGKVAMIGDGVNDAPALAASTVG  615

Query  788  ivlaerasaaaiavadillLQDNISGVPFCVAKARQTTSLIKQNvalalssiavasltsv  609
            I +    +  A+  AD+ L+ D++  +PF V  +R+T  +IKQN+  +L    +A L  +
Sbjct  616  IAMGGAGTDTALETADVALMGDDLKKLPFIVNLSRKTLKIIKQNITFSLGIKLLALLLVL  675

Query  608  LGFLPLWLTVLLHEGGTLLVCLNSIRALN  522
             G+L LW+ ++   G TLLV LN +R + 
Sbjct  676  PGWLTLWIAIVADMGATLLVTLNGLRLMK  704



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2377925492388