BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4173

Length=849
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621612.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    287   6e-88   Nicotiana tomentosiformis
ref|XP_009621605.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    287   6e-88   Nicotiana tomentosiformis
ref|XP_009621600.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    287   8e-88   Nicotiana tomentosiformis
ref|XP_008353771.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    271   5e-86   
ref|XP_009783429.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    281   1e-85   Nicotiana sylvestris
ref|XP_009783430.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    281   1e-85   Nicotiana sylvestris
ref|XP_009783428.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    281   2e-85   Nicotiana sylvestris
ref|XP_004248184.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    281   2e-85   Solanum lycopersicum
ref|XP_004248185.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    281   2e-85   Solanum lycopersicum
emb|CDP15892.1|  unnamed protein product                                279   7e-85   Coffea canephora [robusta coffee]
ref|XP_002325591.1|  acyl-CoA oxidase family protein                    278   1e-84   
ref|XP_011002667.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    278   2e-84   Populus euphratica
ref|XP_006364108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    278   3e-84   Solanum tuberosum [potatoes]
ref|XP_006364109.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    278   3e-84   Solanum tuberosum [potatoes]
ref|XP_011037432.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    273   4e-84   Populus euphratica
emb|CBI21935.3|  unnamed protein product                                272   4e-83   Vitis vinifera
ref|XP_011013714.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    274   5e-83   Populus euphratica
ref|XP_012079023.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    274   9e-83   Jatropha curcas
ref|XP_011013710.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    273   2e-82   Populus euphratica
ref|XP_002525155.1|  acyl-CoA oxidase, putative                         270   6e-82   
gb|KJB50145.1|  hypothetical protein B456_008G155500                    268   6e-82   Gossypium raimondii
ref|XP_002278663.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    271   9e-82   Vitis vinifera
ref|XP_007213791.1|  hypothetical protein PRUPE_ppa002439m2g            267   9e-82   
ref|XP_006376402.1|  acyl-CoA oxidase family protein                    271   1e-81   
ref|NP_001280826.1|  acyl-coenzyme A oxidase 3, peroxisomal-like        270   2e-81   Malus domestica [apple tree]
ref|XP_010279215.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    270   4e-81   Nelumbo nucifera [Indian lotus]
gb|EYU29818.1|  hypothetical protein MIMGU_mgv1a002427mg                269   7e-81   Erythranthe guttata [common monkey flower]
ref|XP_009354288.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    268   9e-81   Pyrus x bretschneideri [bai li]
gb|KJB50144.1|  hypothetical protein B456_008G155500                    268   1e-80   Gossypium raimondii
ref|XP_008244854.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    266   4e-80   Prunus mume [ume]
ref|XP_006469060.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    266   5e-80   Citrus sinensis [apfelsine]
gb|AFQ93695.1|  acyl-CoA oxidase 3                                      266   7e-80   Prunus persica
ref|XP_006446734.1|  hypothetical protein CICLE_v10014502mg             265   2e-79   Citrus clementina [clementine]
gb|KJB31620.1|  hypothetical protein B456_005G198300                    263   9e-79   Gossypium raimondii
ref|XP_008358246.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    253   3e-78   
ref|XP_003607535.1|  Acyl-coenzyme A oxidase 3, peroxisomal             261   8e-78   Medicago truncatula
ref|XP_004303096.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    260   1e-77   Fragaria vesca subsp. vesca
ref|XP_011100229.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    259   4e-77   Sesamum indicum [beniseed]
gb|KHG13766.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    257   1e-76   Gossypium arboreum [tree cotton]
ref|XP_007043726.1|  Acyl-CoA oxidase 3 isoform 2                       257   1e-76   
ref|XP_010093490.1|  Acyl-coenzyme A oxidase 3                          257   2e-76   
ref|XP_007043725.1|  Acyl-CoA oxidase 3 isoform 1                       257   2e-76   
ref|XP_006592447.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    254   2e-76   
ref|XP_010689759.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    256   3e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689760.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    256   5e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN07770.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  254   8e-76   Glycine soja [wild soybean]
ref|XP_010689758.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    255   9e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF82159.1|AC068143_1  Contains similarity to an acyl-CoA oxid...    248   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539950.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    254   2e-75   Glycine max [soybeans]
ref|XP_004151905.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    254   2e-75   Cucumis sativus [cucumbers]
ref|XP_003527400.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    254   3e-75   Glycine max [soybeans]
ref|NP_187325.4|  putative acyl-coenzyme A oxidase                      238   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505527.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    250   9e-74   Cicer arietinum [garbanzo]
ref|XP_010035824.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    249   1e-73   Eucalyptus grandis [rose gum]
gb|KCW47289.1|  hypothetical protein EUGRSUZ_K01080                     249   1e-73   Eucalyptus grandis [rose gum]
ref|NP_172119.1|  acyl-coenzyme A oxidase 3                             248   7e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAF73843.1|AF207994_1  acyl-CoA oxidase ACX3                         248   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889597.1|  acyl-CoA oxidase ACX3                              247   8e-73   
gb|KJB12478.1|  hypothetical protein B456_002G020600                    248   8e-73   Gossypium raimondii
ref|XP_010916040.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    248   1e-72   Elaeis guineensis
ref|XP_006417937.1|  hypothetical protein EUTSA_v10006988mg             246   2e-72   Eutrema salsugineum [saltwater cress]
gb|EPS63701.1|  hypothetical protein M569_11080                         238   2e-72   Genlisea aurea
ref|XP_007132685.1|  hypothetical protein PHAVU_011G116000g             246   3e-72   Phaseolus vulgaris [French bean]
ref|XP_006306351.1|  hypothetical protein CARUB_v10012245mg             246   3e-72   Capsella rubella
ref|XP_010522108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    246   3e-72   Tarenaya hassleriana [spider flower]
gb|KHG26832.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    245   4e-72   Gossypium arboreum [tree cotton]
ref|XP_010457756.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    245   6e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009119069.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    244   1e-71   Brassica rapa
ref|XP_010485961.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    243   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010475360.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    243   2e-71   Camelina sativa [gold-of-pleasure]
emb|CDY10192.1|  BnaC05g04350D                                          243   3e-71   Brassica napus [oilseed rape]
ref|XP_008455941.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    243   4e-71   Cucumis melo [Oriental melon]
ref|XP_006417936.1|  hypothetical protein EUTSA_v10009440mg             242   4e-71   
gb|KFK42952.1|  hypothetical protein AALP_AA1G060500                    242   8e-71   Arabis alpina [alpine rockcress]
gb|EMS62188.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  233   1e-70   Triticum urartu
ref|XP_006852548.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    241   1e-70   Amborella trichopoda
ref|XP_008784451.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    241   2e-70   Phoenix dactylifera
gb|KHG11955.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    240   3e-70   Gossypium arboreum [tree cotton]
ref|XP_009405080.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    240   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB12486.1|  hypothetical protein B456_002G020700                    238   3e-69   Gossypium raimondii
ref|NP_172120.2|  putative acyl-CoA oxidase                             238   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388733.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    236   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002889598.1|  acyl-CoA oxidase 6                                 233   3e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_002456627.1|  hypothetical protein SORBIDRAFT_03g039670          232   4e-67   Sorghum bicolor [broomcorn]
gb|AGT17248.1|  acyl-coenzyme A oxidase                                 231   1e-66   Saccharum hybrid cultivar R570
ref|NP_001152024.1|  acyl-coenzyme A oxidase 2                          231   2e-66   Zea mays [maize]
tpg|DAA56859.1|  TPA: putative acyl-CoA oxidase family protein          231   2e-66   
ref|XP_009119067.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    229   5e-66   Brassica rapa
emb|CDY57822.1|  BnaA10g28090D                                          228   2e-65   Brassica napus [oilseed rape]
ref|XP_004965421.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    227   3e-65   Setaria italica
gb|EMT28672.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  223   2e-64   
emb|CDY10194.1|  BnaC05g04370D                                          224   3e-64   Brassica napus [oilseed rape]
ref|XP_003573815.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    222   2e-63   Brachypodium distachyon [annual false brome]
gb|EAZ36947.1|  hypothetical protein OsJ_21282                          220   1e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00875.1|  hypothetical protein OsI_22900                          220   1e-62   Oryza sativa Indica Group [Indian rice]
gb|ACN41105.1|  unknown                                                 220   1e-62   Picea sitchensis
ref|NP_001057591.1|  Os06g0354500                                       220   1e-62   
ref|XP_006656066.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    218   7e-62   
ref|XP_007043727.1|  Acyl-CoA oxidase 3 isoform 3                       194   3e-53   
ref|XP_010038681.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    180   8e-53   
ref|XP_002994091.1|  hypothetical protein SELMODRAFT_187751             169   3e-44   
emb|CBI36628.3|  unnamed protein product                                157   3e-44   Vitis vinifera
ref|XP_002985513.1|  hypothetical protein SELMODRAFT_122536             165   9e-43   
emb|CDY57819.1|  BnaA10g28070D                                          157   2e-42   Brassica napus [oilseed rape]
emb|CAN66151.1|  hypothetical protein VITISV_035129                     153   9e-41   Vitis vinifera
gb|AAG50996.1|AC036106_9  unknown protein; 4820-5433                    147   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001772379.1|  predicted protein                                  155   3e-39   
ref|XP_001759376.1|  predicted protein                                  141   2e-34   
ref|XP_011466939.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    137   3e-33   Fragaria vesca subsp. vesca
emb|CAN66343.1|  hypothetical protein VITISV_040587                     124   6e-32   Vitis vinifera
emb|CAN77404.1|  hypothetical protein VITISV_009474                     122   2e-31   Vitis vinifera
gb|AAF63829.1|  hypothetical protein                                    122   3e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21363.1|  unnamed protein product                                115   1e-28   Coffea canephora [robusta coffee]
emb|CBI39134.3|  unnamed protein product                                115   3e-28   Vitis vinifera
gb|AEW08613.1|  hypothetical protein CL814Contig1_06                  99.8    8e-23   Pinus radiata
emb|CBI31502.3|  unnamed protein product                              99.4    1e-22   Vitis vinifera
emb|CBI24556.3|  unnamed protein product                              99.4    1e-22   Vitis vinifera
ref|XP_005707013.1|  acyl-CoA oxidase isoform 1                       99.4    8e-20   Galdieria sulphuraria
ref|XP_005712269.1|  unnamed protein product                          93.2    1e-17   Chondrus crispus [carageen]
gb|AAB97825.1|  acyl-CoA oxidase                                      86.3    1e-15   Myxococcus xanthus DK 1622
ref|XP_005712968.1|  acyl-CoA oxidase                                 87.0    1e-15   Chondrus crispus [carageen]
gb|ABF87186.1|  putative acyl-CoA dehydrogenase                       85.9    3e-15   Myxococcus xanthus DK 1622
ref|WP_020478009.1|  acyl-CoA dehydrogenase                           85.5    4e-15   Myxococcus xanthus
ref|WP_015352554.1|  acyl-CoA dehydrogenase                           85.5    4e-15   Myxococcus stipitatus
ref|WP_013062161.1|  acyl-CoA oxidase                                 85.1    5e-15   Salinibacter ruber
ref|WP_011404446.1|  acyl-CoA oxidase                                 85.1    6e-15   Salinibacter ruber
ref|WP_020534466.1|  hypothetical protein                             84.7    6e-15   Lewinella cohaerens
ref|XP_004365565.1|  acyl-coenzyme A oxidase 3                        84.7    6e-15   Capsaspora owczarzaki ATCC 30864
ref|WP_043324301.1|  acyl-CoA oxidase                                 82.4    4e-14   
gb|AFE09438.1|  putative acyl-CoA dehydrogenase                       82.4    4e-14   Corallococcus coralloides DSM 2259
ref|WP_022834726.1|  acyl-CoA oxidase                                 82.4    4e-14   Salisaeta longa
ref|WP_043394213.1|  acyl-CoA oxidase                                 82.0    6e-14   Archangium violaceum
ref|WP_002637005.1|  acyl-CoA dehydrogenase                           81.6    7e-14   Myxococcus hansupus
ref|WP_044187894.1|  acyl-CoA oxidase                                 81.6    7e-14   Hyalangium minutum
ref|XP_005712270.1|  acyl-CoA oxidase                                 81.6    7e-14   Chondrus crispus [carageen]
ref|XP_003294150.1|  hypothetical protein DICPUDRAFT_58874            80.5    1e-13   Dictyostelium purpureum
ref|WP_002612916.1|  acyl-CoA dehydrogenase                           80.9    1e-13   Stigmatella aurantiaca
ref|WP_027064968.1|  acyl-CoA oxidase                                 80.1    2e-13   Maribacter sp. Hel_I_7
ref|WP_013937938.1|  acyl-CoA dehydrogenase                           79.7    3e-13   Myxococcus macrosporus
ref|WP_026707256.1|  acyl-CoA oxidase                                 78.6    7e-13   Flavobacterium frigidarium
gb|EKF56589.1|  acyl-CoA oxidase                                      78.6    8e-13   Galbibacter marinus
ref|WP_040459667.1|  acyl-CoA oxidase                                 78.2    8e-13   
ref|XP_005703885.1|  acyl-CoA oxidase                                 77.8    1e-12   Galdieria sulphuraria
ref|XP_004333085.1|  acylCoA oxidase                                  73.9    2e-12   Acanthamoeba castellanii str. Neff
gb|ERJ18395.1|  acyl-CoA oxidase protein                              77.4    2e-12   Salinisphaera shabanensis E1L3A
ref|XP_636605.1|  hypothetical protein DDB_G0288735                   76.6    3e-12   Dictyostelium discoideum AX4
ref|XP_005716306.1|  acyl-CoA oxidase                                 76.3    4e-12   Chondrus crispus [carageen]
ref|WP_017497064.1|  acyl-CoA oxidase                                 75.1    9e-12   Flavobacterium sp. WG21
ref|XP_003293845.1|  hypothetical protein DICPUDRAFT_158763           74.7    1e-11   Dictyostelium purpureum
ref|WP_025744009.1|  acyl-CoA oxidase                                 75.1    1e-11   Aquimarina pacifica
ref|WP_019598670.1|  hypothetical protein                             74.7    1e-11   Rhodonellum
ref|WP_013993723.1|  acyl-CoA oxidase                                 73.9    2e-11   Zobellia galactanivorans
ref|WP_036151893.1|  acyl-CoA oxidase                                 73.6    3e-11   Maribacter forsetii
ref|XP_005536533.1|  acyl-CoA oxidase ACX3                            73.6    3e-11   Cyanidioschyzon merolae strain 10D
ref|WP_040608171.1|  hypothetical protein                             73.2    3e-11   
ref|WP_016988806.1|  acyl-CoA oxidase                                 73.2    3e-11   Flavobacterium sp. ACAM 123
ref|WP_033431876.1|  acyl-CoA oxidase                                 73.2    3e-11   Saccharothrix syringae
ref|WP_026716117.1|  acyl-CoA oxidase                                 73.2    4e-11   Flavobacterium gelidilacus
ref|XP_642669.1|  acyl-CoA oxidase                                    72.8    5e-11   Dictyostelium discoideum AX4
ref|WP_014773637.1|  acyl-CoA oxidase                                 72.0    8e-11   Belliella baltica
ref|WP_039819999.1|  acyl-CoA oxidase                                 72.0    9e-11   Nocardiopsis halophila
ref|WP_033441505.1|  acyl-CoA oxidase                                 72.0    9e-11   
ref|WP_007810516.1|  acyl-CoA oxidase                                 71.6    1e-10   Flavobacterium sp. CF136
ref|WP_026978660.1|  acyl-CoA oxidase                                 71.6    1e-10   Flavobacterium tegetincola
ref|WP_035847687.1|  acyl-CoA oxidase                                 71.2    2e-10   Cryptosporangium arvum
ref|WP_035680554.1|  acyl-CoA oxidase                                 71.2    2e-10   Flavobacterium reichenbachii
ref|WP_026985441.1|  acyl-CoA oxidase                                 71.2    2e-10   Flavobacterium sp. URHB0058
ref|WP_009183890.1|  acyl-CoA oxidase                                 70.9    2e-10   Cecembia lonarensis
ref|WP_028709678.1|  acyl-CoA oxidase                                 70.5    3e-10   Propionicicella superfundia
ref|WP_042564417.1|  acyl-CoA oxidase                                 70.5    3e-10   Flavobacterium sp. MEB061
ref|WP_043716325.1|  acyl-CoA oxidase                                 70.1    3e-10   Kutzneria sp. 744
ref|WP_035644791.1|  acyl-CoA oxidase                                 70.1    4e-10   Flavobacterium sp. Fl
ref|WP_017557135.1|  hypothetical protein                             69.7    5e-10   Nocardiopsis baichengensis
ref|WP_018178700.1|  hypothetical protein                             69.7    5e-10   Gordonia kroppenstedtii
ref|WP_035690755.1|  acyl-CoA oxidase                                 69.7    6e-10   Flavobacterium sp. F52
gb|EJG02802.1|  acyl-CoA oxidase                                      69.7    6e-10   Flavobacterium sp. F52
ref|WP_036382477.1|  acyl-CoA oxidase                                 69.7    6e-10   Muricauda sp. MAR_2010_75
ref|WP_030096915.1|  acyl-CoA oxidase                                 69.3    6e-10   Mycobacteroides
ref|WP_026812503.1|  acyl-CoA oxidase                                 69.3    7e-10   Arenibacter certesii
ref|WP_012813658.1|  acyl-CoA oxidase                                 68.9    9e-10   Robiginitalea biformata
ref|WP_013453510.1|  acyl-CoA oxidase                                 68.9    9e-10   Marivirga tractuosa
ref|WP_008611975.1|  acyl-CoA oxidase                                 68.9    9e-10   Joostella marina
ref|WP_010853776.1|  Acyl-coenzyme A oxidase 1, peroxisomal           68.9    9e-10   Lunatimonas lonarensis
dbj|GAM28721.1|  hypothetical protein SAMD00019534_118970             68.9    9e-10   Acytostelium subglobosum LB1
ref|WP_012832911.1|  acyl-CoA oxidase                                 68.9    1e-09   Gordonia bronchialis
ref|WP_003924602.1|  acyl-CoA oxidase                                 68.6    1e-09   Mycolicibacterium thermoresistibile
ref|WP_009678111.1|  acyl-CoA oxidase                                 68.6    1e-09   Gordonia neofelifaecis
ref|WP_045823938.1|  acyl-CoA oxidase                                 68.6    1e-09   Williamsia herbipolensis
ref|WP_044506891.1|  acyl-CoA oxidase                                 68.2    2e-09   Mycobacterium simiae
ref|WP_039751994.1|  acyl-CoA oxidase                                 68.2    2e-09   
ref|WP_031456312.1|  acyl-CoA oxidase                                 68.2    2e-09   Flavobacterium chungangense
ref|WP_018156945.1|  hypothetical protein                             67.8    2e-09   Demetria terragena
ref|WP_014021931.1|  acyl-CoA oxidase                                 67.8    2e-09   Cyclobacterium marinum
ref|WP_006241046.1|  acyl-CoA oxidase                                 67.8    2e-09   Mycolicibacterium tusciae
ref|WP_025239597.1|  acyl-CoA oxidase                                 67.8    2e-09   Mycobacteroides abscessus
ref|WP_012025377.1|  acyl-CoA oxidase                                 67.8    3e-09   Flavobacterium johnsoniae
ref|WP_004019946.1|  acyl-CoA oxidase                                 67.8    3e-09   Gordonia terrae
gb|EMP11646.1|  acyl-CoA dehydrogenase, middle domain protein         67.4    3e-09   
ref|WP_005080876.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides abscessus
ref|WP_043077692.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides immunogenum
ref|WP_026729518.1|  acyl-CoA oxidase                                 67.4    3e-09   Flavobacterium denitrificans
ref|WP_016891967.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides abscessus
ref|WP_035751757.1|  acyl-CoA oxidase                                 67.4    3e-09   Gordonia alkanivorans
ref|WP_005056292.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides abscessus
ref|WP_005077362.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides abscessus
gb|AIC71572.1|  acyl-CoA oxidase                                      67.4    3e-09   Mycobacteroides abscessus subsp. massiliense str. GO 06
ref|WP_016888063.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides abscessus
ref|WP_017204937.1|  acyl-CoA oxidase                                 67.4    3e-09   Mycobacteroides abscessus
ref|WP_005088450.1|  MULTISPECIES: acyl-CoA oxidase                   67.4    3e-09   Mycobacteroides abscessus
ref|WP_020890884.1|  Acyl-coenzyme A oxidase 1, peroxisomal           67.4    3e-09   Cyclobacterium qasimii
ref|WP_016343166.1|  putative acyl-CoA oxidase                        67.0    3e-09   Mycobacteroides abscessus
ref|WP_015100482.1|  Acyl-CoA oxidase                                 67.0    3e-09   Saccharothrix espanaensis
ref|WP_029269714.1|  acyl-CoA oxidase                                 67.0    4e-09   Flavobacterium sp. KJJ
ref|WP_006122746.1|  MULTISPECIES: acyl-CoA oxidase                   67.0    4e-09   Streptomyces
ref|WP_032779937.1|  acyl-CoA oxidase                                 67.0    4e-09   Streptomyces albus
ref|WP_032769032.1|  acyl-CoA oxidase                                 67.0    4e-09   Streptomyces sp. CNS654
ref|WP_038237921.1|  acyl-CoA oxidase                                 67.0    4e-09   Zobellia uliginosa
ref|WP_008713698.1|  Acyl-CoA dehydrogenase domain protein            66.6    5e-09   Rhodococcus sp. AW25M09
ref|WP_013154234.1|  acyl-CoA oxidase                                 66.6    5e-09   Nocardiopsis dassonvillei
ref|WP_019609734.1|  acyl-CoA oxidase                                 66.6    5e-09   Nocardiopsis sp. CNS-639
ref|WP_030811972.1|  acyl-CoA oxidase                                 66.6    5e-09   Streptomyces mediolani
ref|WP_044376178.1|  acyl-CoA oxidase                                 66.6    5e-09   Streptomyces
ref|WP_029182498.1|  acyl-CoA oxidase                                 66.6    5e-09   Streptomyces
ref|WP_007619749.1|  putative acyl-CoA oxidase                        66.2    6e-09   Gordonia soli
ref|WP_014925550.1|  acyl-CoA oxidase                                 66.2    6e-09   Gordonia sp. KTR9
ref|WP_010842026.1|  Acyl-CoA dehydrogenase                           66.2    7e-09   Gordonia terrae
ref|WP_045539202.1|  acyl-CoA oxidase                                 66.2    7e-09   Gordonia sihwensis
ref|WP_019809905.1|  acyl-CoA oxidase                                 66.2    7e-09   Saccharomonospora halophila
dbj|GAM25056.1|  hypothetical protein SAMD00019534_082310             66.2    7e-09   Acytostelium subglobosum LB1
ref|WP_030580799.1|  acyl-CoA oxidase                                 66.2    8e-09   Streptomyces globisporus
ref|WP_037186992.1|  acyl-CoA oxidase                                 66.2    8e-09   Rhodococcus
ref|WP_006898335.1|  putative acyl-CoA oxidase                        65.9    9e-09   Gordonia
ref|WP_042377454.1|  acyl-CoA oxidase                                 65.9    1e-08   Gordonia alkanivorans
ref|WP_011856090.1|  acyl-CoA oxidase                                 65.9    1e-08   Mycobacteriaceae
ref|WP_011560818.1|  MULTISPECIES: acyl-CoA oxidase                   65.9    1e-08   Mycobacterium
ref|WP_027391884.1|  acyl-CoA oxidase                                 65.9    1e-08   Aquimarina latercula
ref|WP_036344488.1|  acyl-CoA oxidase                                 65.5    1e-08   Mycolicibacterium aromaticivorans
ref|WP_027504516.1|  acyl-CoA oxidase                                 65.5    1e-08   
ref|WP_022827387.1|  acyl-CoA oxidase                                 65.9    1e-08   Flavobacterium antarcticum
gb|KIQ18411.1|  acyl-CoA oxidase                                      65.5    1e-08   Rhodococcus sp. MEB064
ref|WP_006437568.1|  putative acyl-CoA oxidase                        65.5    1e-08   Gordonia amicalis
ref|WP_042574090.1|  acyl-CoA oxidase                                 65.5    1e-08   Rhodococcus
ref|WP_006358547.1|  acyl-CoA oxidase                                 65.5    1e-08   Gordonia alkanivorans
ref|WP_024445310.1|  acyl-CoA oxidase                                 65.5    1e-08   Mycolicibacterium iranicum
ref|WP_005194221.1|  acyl-CoA oxidase                                 65.5    1e-08   Gordonia rubripertincta
ref|WP_036470198.1|  acyl-CoA oxidase                                 65.5    1e-08   Mycobacterium triplex
ref|WP_032380392.1|  acyl-CoA oxidase                                 65.1    2e-08   Rhodococcus fascians
ref|WP_037171831.1|  acyl-CoA oxidase                                 65.1    2e-08   Rhodococcus fascians
ref|WP_032390396.1|  acyl-CoA oxidase                                 65.1    2e-08   Rhodococcus fascians
ref|WP_037114191.1|  acyl-CoA oxidase                                 65.1    2e-08   Rhodococcus
ref|WP_031937608.1|  acyl-CoA oxidase                                 65.1    2e-08   Rhodococcus defluvii
ref|WP_012787563.1|  acyl-CoA oxidase                                 65.1    2e-08   Catenulispora acidiphila
ref|WP_019666492.1|  MULTISPECIES: acyl-CoA oxidase                   65.1    2e-08   Rhodococcus
ref|WP_034664791.1|  acyl-CoA oxidase                                 65.1    2e-08   
ref|WP_020112517.1|  acyl-CoA oxidase                                 65.1    2e-08   Rhodococcus sp. 114MFTsu3.1
ref|WP_037185147.1|  acyl-CoA oxidase                                 65.1    2e-08   
ref|WP_032788418.1|  acyl-CoA oxidase                                 65.1    2e-08   Streptomyces sp. JS01
ref|WP_007023318.1|  acyl-CoA oxidase                                 64.7    2e-08   Saccharomonospora paurometabolica
ref|WP_032401875.1|  acyl-CoA oxidase                                 64.7    2e-08   Rhodococcus fascians
ref|WP_040270575.1|  acyl-CoA oxidase                                 64.7    2e-08   Streptomonospora alba
ref|WP_026453893.1|  acyl-CoA oxidase                                 64.7    2e-08   [Actinopolyspora] iraqiensis
ref|WP_018524646.1|  MULTISPECIES: acyl-CoA oxidase                   64.7    2e-08   Streptomyces sp. KhCrAH-43
ref|WP_003933305.1|  acyl-CoA oxidase                                 64.7    2e-08   Mycolicibacterium vaccae
ref|WP_045840649.1|  acyl-CoA oxidase                                 64.7    2e-08   Rhodococcus sp. PML026
ref|WP_037153748.1|  acyl-CoA oxidase                                 64.7    2e-08   Rhodococcus
ref|WP_026204649.1|  acyl-CoA oxidase                                 64.7    2e-08   
ref|WP_042180408.1|  acyl-CoA oxidase                                 64.7    2e-08   Kibdelosporangium sp. MJ126-NF4
ref|WP_036358810.1|  acyl-CoA oxidase                                 64.7    2e-08   Mycobacterium asiaticum
ref|WP_017565178.1|  acyl-CoA oxidase                                 64.7    2e-08   Nocardiopsis synnemataformans
ref|WP_014359023.1|  acyl-CoA oxidase                                 64.7    3e-08   Gordonia polyisoprenivorans
ref|WP_026468560.1|  acyl-CoA oxidase                                 64.7    3e-08   Amycolatopsis balhimycina
ref|WP_020172265.1|  acyl-CoA oxidase                                 64.7    3e-08   Gordonia polyisoprenivorans
ref|XP_004360487.1|  acyl-CoA oxidase                                 64.7    3e-08   Cavenderia fasciculata
ref|WP_036491874.1|  acyl-CoA oxidase                                 64.3    3e-08   
ref|WP_006372698.1|  acyl-CoA oxidase                                 64.3    3e-08   Gordonia polyisoprenivorans
ref|WP_036457059.1|  acyl-CoA oxidase                                 64.3    3e-08   Mycobacterium sp. UM_WGJ
ref|WP_036442896.1|  acyl-CoA oxidase                                 64.3    3e-08   Mycobacteriaceae
ref|WP_006865285.1|  acyl-CoA oxidase                                 64.3    3e-08   Gordonia namibiensis
ref|WP_006899076.1|  putative acyl-CoA oxidase                        64.3    3e-08   Gordonia paraffinivorans
gb|EOM77189.1|  acyl-CoA oxidase                                      64.3    3e-08   
ref|WP_013229814.1|  acyl-CoA oxidase                                 64.3    3e-08   
ref|WP_027498339.1|  MULTISPECIES: acyl-CoA oxidase                   64.3    3e-08   
gb|EON25586.1|  acyl-CoA oxidase domain-containing protein            64.3    3e-08   
ref|WP_040772532.1|  acyl-CoA oxidase                                 64.3    3e-08   
ref|WP_006338403.1|  putative acyl-CoA oxidase                        64.3    3e-08   
ref|WP_024481861.1|  acyl-CoA oxidase                                 64.3    4e-08   
ref|WP_005440921.1|  acyl-CoA oxidase                                 63.9    4e-08   
ref|WP_036565630.1|  acyl-CoA oxidase                                 63.9    4e-08   
ref|WP_043410495.1|  acyl-CoA oxidase                                 63.9    4e-08   
ref|WP_029447141.1|  acyl-CoA oxidase                                 63.9    4e-08   
ref|WP_025615938.1|  acyl-CoA oxidase                                 63.9    4e-08   
ref|XP_002677851.1|  acyl-coenzyme A oxidase                          63.9    5e-08   
ref|WP_041518765.1|  acyl-CoA oxidase                                 63.9    5e-08   
ref|WP_029450063.1|  acyl-CoA oxidase                                 63.9    5e-08   
ref|WP_037367820.1|  acyl-CoA oxidase                                 63.5    5e-08   
ref|WP_032365221.1|  acyl-CoA oxidase                                 63.5    5e-08   
ref|WP_027078216.1|  acyl-CoA oxidase                                 63.5    5e-08   
ref|WP_019969895.1|  acyl-CoA oxidase                                 63.5    5e-08   
ref|WP_032393893.1|  acyl-CoA oxidase                                 63.5    5e-08   
ref|WP_015356441.1|  acyl-CoA dehydrogenase                           63.5    5e-08   
ref|WP_020786817.1|  Acyl-coenzyme A oxidase 3, peroxisomal           63.5    6e-08   
ref|WP_026242212.1|  acyl-CoA oxidase                                 63.5    6e-08   
ref|WP_040710503.1|  acyl-CoA oxidase                                 63.5    6e-08   
ref|WP_007171081.1|  acyl-CoA oxidase                                 63.5    6e-08   
ref|WP_045198929.1|  acyl-CoA oxidase                                 63.5    6e-08   
ref|WP_026810093.1|  acyl-CoA oxidase                                 63.5    6e-08   
ref|WP_041801916.1|  acyl-CoA oxidase                                 63.5    6e-08   
gb|AEM70899.1|  Acyl-CoA oxidase                                      63.5    6e-08   
ref|WP_018599328.1|  acyl-CoA oxidase                                 63.5    6e-08   
ref|WP_038580130.1|  acyl-CoA oxidase                                 63.2    7e-08   
gb|EPQ74968.1|  Acyl-coenzyme A oxidase 3, peroxisomal                63.2    7e-08   
ref|WP_036456278.1|  acyl-CoA oxidase                                 63.2    7e-08   
gb|EFA74856.1|  acyl-CoA oxidase                                      63.2    7e-08   
ref|WP_012395254.1|  acyl-CoA oxidase                                 63.2    7e-08   
ref|WP_041762943.1|  acyl-CoA oxidase                                 63.2    9e-08   
ref|WP_035622798.1|  acyl-CoA oxidase                                 63.2    9e-08   
ref|WP_016693747.1|  hypothetical protein                             62.4    9e-08   
ref|WP_023986016.1|  MULTISPECIES: acyl-CoA oxidase                   63.2    9e-08   
gb|AEA28278.1|  Acyl-CoA oxidase                                      62.8    9e-08   
ref|WP_037662951.1|  acyl-CoA oxidase                                 62.8    9e-08   
ref|WP_015780052.1|  acyl-CoA oxidase                                 62.8    9e-08   
ref|WP_036396123.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_036460965.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_017572294.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_015360696.1|  acyl-CoA oxidase domain-containing protein       62.8    1e-07   
emb|CDO05676.1|  acyl-CoA dehydrogenase domain-containing protein     62.8    1e-07   
ref|WP_019683694.1|  acyl-CoA oxidase                                 62.4    1e-07   
ref|WP_030133589.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_019734689.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_039115718.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_007924190.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_043786179.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_043644508.1|  hypothetical protein                             62.8    1e-07   
ref|WP_027862959.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_030629375.1|  acyl-CoA oxidase                                 62.8    1e-07   
ref|WP_030081577.1|  acyl-CoA oxidase                                 62.8    1e-07   
dbj|GAM25458.1|  hypothetical protein SAMD00019534_086330             62.4    1e-07   
ref|WP_033238735.1|  acyl-CoA oxidase                                 62.4    1e-07   
ref|WP_005169429.1|  putative acyl-CoA oxidase                        62.4    1e-07   
ref|WP_006239330.1|  acyl-CoA oxidase                                 62.4    1e-07   
ref|WP_003879598.1|  MULTISPECIES: acyl-CoA oxidase                   62.4    1e-07   
ref|WP_038676593.1|  acyl-CoA oxidase                                 62.4    1e-07   
ref|WP_041344327.1|  acyl-CoA oxidase                                 62.4    1e-07   
ref|WP_011893606.1|  acyl-CoA oxidase                                 62.4    2e-07   
ref|WP_035657136.1|  acyl-CoA oxidase                                 62.4    2e-07   
ref|WP_013828514.1|  acyl-CoA oxidase                                 62.4    2e-07   
ref|WP_042906846.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_019729355.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_033713247.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_015632626.1|  Acyl-coenzyme A dehydrogenaseoxidase             62.0    2e-07   
ref|WP_023881352.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_011724581.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_023898649.1|  MULTISPECIES: acyl-CoA oxidase                   62.0    2e-07   
ref|WP_010949479.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_003080258.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_023883147.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_023868784.1|  acyl-CoA oxidase                                 62.0    2e-07   
dbj|BAN30767.1|  acyl-CoA oxidase                                     62.0    2e-07   
gb|ELP46004.1|  hypothetical protein D522_13218                       62.0    2e-07   
gb|EGO40578.1|  acyl-CoA dehydrogenase                                62.0    2e-07   
gb|ETZ74934.1|  acyl-CoA dehydrogenase, C-terminal domain protein     62.0    2e-07   
ref|WP_026126958.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_029109612.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_033300853.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_024455592.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_037308120.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_006552333.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_015787457.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_030389344.1|  acyl-CoA oxidase                                 62.0    2e-07   
ref|WP_031121894.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_008354960.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_024101715.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_003895830.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_015607106.1|  Acyl-CoA oxidase domain-containing protein       61.6    2e-07   
ref|WP_032755520.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_019291205.1|  MULTISPECIES: acyl-CoA oxidase                   61.6    2e-07   
ref|WP_033948443.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_038508394.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_011729863.1|  acyl-CoA oxidase                                 61.6    2e-07   
ref|WP_009945757.1|  acyl-CoA oxidase                                 61.6    3e-07   
ref|WP_037340849.1|  acyl-CoA oxidase                                 61.6    3e-07   
ref|WP_007028884.1|  acyl-CoA oxidase domain-containing protein       61.6    3e-07   
emb|CKI16319.1|  acyl-CoA oxidase                                     61.6    3e-07   
ref|WP_039119472.1|  acyl-CoA oxidase                                 61.6    3e-07   
ref|WP_007317217.1|  acyl-CoA oxidase                                 61.6    3e-07   
ref|WP_023420722.1|  MULTISPECIES: Acyl-coenzyme A oxidase 1, per...  61.6    3e-07   
ref|WP_030714432.1|  acyl-CoA oxidase                                 61.6    3e-07   
ref|WP_037065914.1|  acyl-CoA oxidase                                 61.2    3e-07   
gb|AJK52456.1|  acyl-CoA oxidase                                      61.2    3e-07   
ref|WP_043828107.1|  acyl-CoA oxidase                                 61.2    3e-07   
emb|CCH75984.1|  conserved hypothetical protein                       61.2    3e-07   
ref|WP_005144785.1|  acyl-CoA oxidase                                 61.2    3e-07   
ref|WP_045549278.1|  acyl-CoA oxidase                                 61.2    4e-07   
gb|EUA26848.1|  acyl-CoA dehydrogenase, C-terminal domain protein     60.8    4e-07   
ref|WP_035694733.1|  acyl-CoA oxidase                                 61.2    4e-07   
ref|WP_040407217.1|  acyl-CoA oxidase                                 61.2    4e-07   
ref|XP_002672633.1|  peroxisomal acyl-CoA oxidase                     60.8    4e-07   
ref|WP_035305307.1|  acyl-CoA oxidase                                 60.8    4e-07   
ref|WP_017588837.1|  acyl-CoA oxidase                                 60.8    4e-07   
ref|WP_036194533.1|  acyl-CoA oxidase                                 60.8    4e-07   
ref|WP_039321983.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_039380663.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_029373113.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_028638761.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_011739426.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_030570486.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|XP_004363191.1|  putative acyl-CoA oxidase                        60.8    5e-07   
ref|WP_014212607.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_014816551.1|  acyl-CoA oxidase                                 60.8    5e-07   
ref|WP_014044514.1|  MULTISPECIES: acyl-CoA oxidase                   60.8    5e-07   
dbj|GAB09656.1|  putative acyl-CoA oxidase                            60.8    5e-07   
gb|EUA32514.1|  acyl-CoA oxidase family protein                       59.3    5e-07   
ref|WP_040522213.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_030226700.1|  acyl-CoA oxidase                                 60.5    6e-07   
gb|ABM14589.1|  acyl-CoA dehydrogenase domain protein                 60.5    6e-07   
ref|WP_022925252.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_033293761.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_026245499.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_036372117.1|  MULTISPECIES: acyl-CoA oxidase                   60.5    6e-07   
ref|WP_016337188.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_038570380.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_006946147.1|  acyl-CoA oxidase                                 60.5    6e-07   
ref|WP_034248225.1|  acyl-CoA oxidase                                 60.5    7e-07   
ref|WP_031088727.1|  acyl-CoA oxidase                                 60.5    7e-07   
ref|WP_017576371.1|  acyl-CoA oxidase                                 60.1    8e-07   
ref|WP_019200942.1|  acyl-CoA oxidase                                 60.1    8e-07   
ref|WP_042212501.1|  acyl-CoA oxidase                                 60.1    8e-07   
ref|WP_036449269.1|  acyl-CoA oxidase                                 60.1    9e-07   
ref|WP_033229275.1|  acyl-CoA oxidase                                 60.1    9e-07   
ref|WP_044524267.1|  acyl-CoA oxidase                                 60.1    9e-07   
ref|WP_028463272.1|  acyl-CoA oxidase                                 60.1    9e-07   
ref|WP_039797823.1|  acyl-CoA oxidase                                 58.2    9e-07   
ref|WP_017614281.1|  acyl-CoA oxidase                                 59.7    1e-06   
dbj|GAK93201.1|  acyl-coenzyme A oxidase 1                            58.9    1e-06   
ref|WP_007770344.1|  acyl-CoA oxidase                                 59.7    1e-06   
gb|ETD31096.1|  acyl-CoA oxidase                                      59.7    1e-06   
ref|WP_031333074.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|WP_044486229.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|WP_030165565.1|  MULTISPECIES: acyl-CoA oxidase                   59.7    1e-06   
gb|KGN32028.1|  acyl-CoA oxidase                                      59.7    1e-06   
ref|WP_035947609.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|WP_043221719.1|  acyl-CoA oxidase                                 59.7    1e-06   
gb|EUA33411.1|  acyl-CoA dehydrogenase, C-terminal domain protein     59.3    1e-06   
ref|WP_041297823.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|WP_008735487.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|XP_011402022.1|  Acyl-coenzyme A oxidase, peroxisomal             59.7    1e-06   
ref|WP_042295862.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|WP_018894104.1|  acyl-CoA oxidase                                 59.7    1e-06   
gb|ELR84632.1|  acyl-CoA oxidase                                      59.7    1e-06   
ref|WP_033226284.1|  acyl-CoA oxidase                                 59.7    1e-06   
gb|AFJ34889.1|  acyl-CoA oxidase                                      59.7    1e-06   
ref|WP_014384406.1|  acyl-CoA oxidase                                 59.7    1e-06   
ref|WP_044852233.1|  acyl-CoA oxidase                                 59.3    1e-06   
ref|WP_020664913.1|  acyl-CoA oxidase                                 59.3    1e-06   
ref|WP_037494263.1|  acyl-CoA oxidase                                 59.3    1e-06   
ref|WP_014379818.1|  MULTISPECIES: acyl-CoA oxidase                   59.3    1e-06   
gb|EFL10817.1|  acyl-CoA oxidase                                      59.3    1e-06   
ref|WP_026912172.1|  acyl-CoA oxidase                                 59.3    1e-06   
ref|WP_037715592.1|  acyl-CoA oxidase                                 59.3    1e-06   
ref|XP_004361564.1|  putative acyl-CoA oxidase                        59.3    1e-06   
ref|WP_030760334.1|  MULTISPECIES: acyl-CoA oxidase                   59.3    1e-06   
ref|WP_017605859.1|  acyl-CoA oxidase                                 59.3    1e-06   
ref|WP_016932641.1|  acyl-CoA oxidase                                 59.3    2e-06   
ref|WP_003946657.1|  MULTISPECIES: acyl-CoA oxidase                   59.3    2e-06   
ref|WP_041825462.1|  acyl-CoA oxidase                                 59.3    2e-06   
gb|ADW07059.1|  acyl-CoA dehydrogenase domain-containing protein      59.3    2e-06   
ref|WP_011292662.1|  acyl-CoA oxidase                                 59.3    2e-06   
dbj|GAB38637.1|  putative acyl-CoA oxidase                            59.3    2e-06   
ref|WP_039855121.1|  acyl-CoA oxidase                                 59.3    2e-06   
ref|WP_030768335.1|  acyl-CoA oxidase                                 59.3    2e-06   
ref|WP_037271082.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_030125188.1|  MULTISPECIES: acyl-CoA oxidase                   58.9    2e-06   
ref|WP_015576152.1|  acyl-coenzyme A oxidase 1                        58.9    2e-06   
ref|WP_005939341.1|  putative acyl-CoA oxidase                        58.9    2e-06   
ref|WP_020937550.1|  acyl-CoA dehydrogenase                           58.9    2e-06   
ref|WP_037831419.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_031177408.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_018471012.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_010639493.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_037306481.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_040883508.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_030317285.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_028649709.1|  acyl-CoA oxidase                                 58.9    2e-06   
gb|EAP98968.1|  hypothetical protein JNB_02330                        58.9    2e-06   
ref|WP_024795146.1|  acyl-CoA oxidase                                 58.9    2e-06   
gb|EFA75614.1|  putative acyl-CoA oxidase                             58.9    2e-06   
ref|WP_012924042.1|  acyl-CoA oxidase                                 58.9    2e-06   
ref|WP_045063823.1|  acyl-CoA oxidase                                 58.5    2e-06   
ref|WP_041815718.1|  acyl-CoA oxidase                                 58.5    2e-06   
ref|WP_033235472.1|  acyl-CoA oxidase                                 58.5    2e-06   
ref|WP_007237397.1|  acyl-CoA oxidase                                 58.5    2e-06   
ref|WP_003921933.1|  acyl-CoA oxidase                                 58.5    2e-06   
ref|WP_029254848.1|  acyl-CoA oxidase                                 58.5    2e-06   
ref|WP_024487810.1|  MULTISPECIES: acyl-CoA oxidase                   58.5    2e-06   
dbj|BAH32371.1|  putative acyl-CoA oxidase                            58.5    2e-06   
ref|WP_026917810.1|  acyl-CoA oxidase                                 58.5    3e-06   
ref|WP_036393685.1|  acyl-CoA oxidase                                 58.5    3e-06   
gb|AGT91460.1|  acyl-CoA oxidase                                      58.5    3e-06   
ref|XP_008021124.1|  hypothetical protein SETTUDRAFT_134436           58.5    3e-06   
gb|EME15692.1|  acyl-CoA oxidase                                      58.5    3e-06   



>ref|XP_009621612.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana tomentosiformis]
Length=676

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S PV+PSQ +S A+R  +FQ DI CLRERDLL RFAAEVS+ QSQG+SKEYAF +
Sbjct  501  EHMNKSRPVVPSQFTSSAMRQAQFQNDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTL  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF+EAEASV S P+KN LGLVRSMYAL T+DED AFLRYGY
Sbjct  561  NYQLAEDLGRAFSDRAVLHTFLEAEASVTSAPLKNILGLVRSMYALVTVDEDVAFLRYGY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            L TDNAA +RKEVAKLCSELRPHAL+LV+SFGIPDAFL PIAFNW++AN WSS
Sbjct  621  LWTDNAAMVRKEVAKLCSELRPHALSLVSSFGIPDAFLGPIAFNWVEANVWSS  673



>ref|XP_009621605.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana tomentosiformis]
Length=686

 Score =   287 bits (735),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S PV+PSQ +S A+R  +FQ DI CLRERDLL RFAAEVS+ QSQG+SKEYAF +
Sbjct  511  EHMNKSRPVVPSQFTSSAMRQAQFQNDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTL  570

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF+EAEASV S P+KN LGLVRSMYAL T+DED AFLRYGY
Sbjct  571  NYQLAEDLGRAFSDRAVLHTFLEAEASVTSAPLKNILGLVRSMYALVTVDEDVAFLRYGY  630

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            L TDNAA +RKEVAKLCSELRPHAL+LV+SFGIPDAFL PIAFNW++AN WSS
Sbjct  631  LWTDNAAMVRKEVAKLCSELRPHALSLVSSFGIPDAFLGPIAFNWVEANVWSS  683



>ref|XP_009621600.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana tomentosiformis]
Length=691

 Score =   287 bits (735),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S PV+PSQ +S A+R  +FQ DI CLRERDLL RFAAEVS+ QSQG+SKEYAF +
Sbjct  516  EHMNKSRPVVPSQFTSSAMRQAQFQNDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTL  575

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF+EAEASV S P+KN LGLVRSMYAL T+DED AFLRYGY
Sbjct  576  NYQLAEDLGRAFSDRAVLHTFLEAEASVTSAPLKNILGLVRSMYALVTVDEDVAFLRYGY  635

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            L TDNAA +RKEVAKLCSELRPHAL+LV+SFGIPDAFL PIAFNW++AN WSS
Sbjct  636  LWTDNAAMVRKEVAKLCSELRPHALSLVSSFGIPDAFLGPIAFNWVEANVWSS  688



>ref|XP_008353771.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Malus 
domestica]
Length=284

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  L+  +FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  108  EHMNKPCPVIPSQLTSSTLQCSQFQMDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIIL  167

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA DLGRAFADR+I QTF++AEA++ +  +KN L L+RSMYAL  L+EDAAFLRYGY
Sbjct  168  SYQLAGDLGRAFADRSILQTFIDAEAALPAGSLKNVLALLRSMYALICLEEDAAFLRYGY  227

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+N A +RKEV++LC ELRPHALALV+SFGIPDAFLSPIAFNWID+N+WSS+
Sbjct  228  LSTNNVAAVRKEVSRLCGELRPHALALVSSFGIPDAFLSPIAFNWIDSNSWSSV  281



>ref|XP_009783429.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana sylvestris]
Length=686

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+PSQL S A+R  +FQ DI CLRERDLL RFAAEVS+ QSQG+SKEYAF +
Sbjct  511  EHMNNSRPVVPSQLKSSAMRQSQFQNDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTL  570

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF+EAEA+V S P+K+ LGLVRSMY L TL+ED AFLRYGY
Sbjct  571  NYQLAEDLGRAFSDRAVLHTFLEAEATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGY  630

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LSTDNAA +RKEVA LCSELRPHAL+LV+SFGIPDAFL PIAFNW++ N WSS
Sbjct  631  LSTDNAAVVRKEVANLCSELRPHALSLVSSFGIPDAFLGPIAFNWVEVNVWSS  683



>ref|XP_009783430.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana sylvestris]
Length=686

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+PSQL S A+R  +FQ DI CLRERDLL RFAAEVS+ QSQG+SKEYAF +
Sbjct  511  EHMNNSRPVVPSQLKSSAMRQSQFQNDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTL  570

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF+EAEA+V S P+K+ LGLVRSMY L TL+ED AFLRYGY
Sbjct  571  NYQLAEDLGRAFSDRAVLHTFLEAEATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGY  630

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LSTDNAA +RKEVA LCSELRPHAL+LV+SFGIPDAFL PIAFNW++ N WSS
Sbjct  631  LSTDNAAVVRKEVANLCSELRPHALSLVSSFGIPDAFLGPIAFNWVEVNVWSS  683



>ref|XP_009783428.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana sylvestris]
Length=691

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+PSQL S A+R  +FQ DI CLRERDLL RFAAEVS+ QSQG+SKEYAF +
Sbjct  516  EHMNNSRPVVPSQLKSSAMRQSQFQNDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTL  575

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF+EAEA+V S P+K+ LGLVRSMY L TL+ED AFLRYGY
Sbjct  576  NYQLAEDLGRAFSDRAVLHTFLEAEATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGY  635

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LSTDNAA +RKEVA LCSELRPHAL+LV+SFGIPDAFL PIAFNW++ N WSS
Sbjct  636  LSTDNAAVVRKEVANLCSELRPHALSLVSSFGIPDAFLGPIAFNWVEVNVWSS  688



>ref|XP_004248184.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum lycopersicum]
Length=686

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PVIPSQL+S  +R  +FQ DI CLRERDLL RFAAEVS  Q+QG+SKEYAF +
Sbjct  511  EHMNTSRPVIPSQLTSITMRQAQFQNDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTL  570

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF++AEASV S P+KN L LVRSMY L TL+EDAAFLRYGY
Sbjct  571  NYQLAEDLGRAFSDRAVLHTFLDAEASVTSGPLKNVLDLVRSMYVLITLEEDAAFLRYGY  630

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DNAA +RKEVAKLCSELRPHAL+LV+SFG+PDAFLSPIAFNW++ANAWSS
Sbjct  631  LSMDNAAIVRKEVAKLCSELRPHALSLVSSFGLPDAFLSPIAFNWVEANAWSS  683



>ref|XP_004248185.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum lycopersicum]
Length=683

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PVIPSQL+S  +R  +FQ DI CLRERDLL RFAAEVS  Q+QG+SKEYAF +
Sbjct  508  EHMNTSRPVIPSQLTSITMRQAQFQNDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTL  567

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF++AEASV S P+KN L LVRSMY L TL+EDAAFLRYGY
Sbjct  568  NYQLAEDLGRAFSDRAVLHTFLDAEASVTSGPLKNVLDLVRSMYVLITLEEDAAFLRYGY  627

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DNAA +RKEVAKLCSELRPHAL+LV+SFG+PDAFLSPIAFNW++ANAWSS
Sbjct  628  LSMDNAAIVRKEVAKLCSELRPHALSLVSSFGLPDAFLSPIAFNWVEANAWSS  680



>emb|CDP15892.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   279 bits (714),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+ SPVIPSQL+S  +RSI F+ D+LCLRERDLLNRFA+E+S RQ+QGESKE+AF M
Sbjct  500  EHMNKPSPVIPSQLTSTVMRSIDFEHDMLCLRERDLLNRFASEISQRQAQGESKEHAFVM  559

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAIFQTFV+AE +V    +K+ L L+RSMYAL TL+ED+AFLRYG+
Sbjct  560  SYQLAEDLGRAFSDRAIFQTFVDAETTVTDATLKSILCLLRSMYALVTLEEDSAFLRYGF  619

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNAA +RKEVAKLC ELRPHAL+LV+SFGIPDA LSPIAFNW++ N+WSS+
Sbjct  620  LSVDNAAAVRKEVAKLCGELRPHALSLVSSFGIPDALLSPIAFNWLETNSWSSV  673



>ref|XP_002325591.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|EEE99972.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=680

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVIPS L+S  LRS +FQ +  CLRERDLLNRFAAEVS+ QS+GESKE+AF +
Sbjct  505  EHMNGPVPVIPSNLTSSTLRSSQFQMNAFCLRERDLLNRFAAEVSLYQSKGESKEHAFIL  564

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V++  +KN LGL+RSMYAL  L+EDAAFLRYGY
Sbjct  565  SYQLAEDLGRAFSDRAILQTFIDAEANVSAGSLKNVLGLLRSMYALICLEEDAAFLRYGY  624

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDNAA +RKEV KLC ELRPHALALV+S GIPDAFL PIAFNWIDAN+WSS+
Sbjct  625  LSTDNAAAVRKEVTKLCGELRPHALALVSSLGIPDAFLGPIAFNWIDANSWSSV  678



>ref|XP_011002667.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=680

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVIPS L+S+ LRS +FQ +  CLRERDLLNRFAAEVS+ QS+GESKE+AF +
Sbjct  505  EHMNGPVPVIPSNLTSNNLRSSQFQMNAFCLRERDLLNRFAAEVSLYQSKGESKEHAFIL  564

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V++  +KN LGL+RSMYAL  L+EDAAFLRYGY
Sbjct  565  SYQLAEDLGRAFSDRAILQTFIDAEANVSAGSLKNVLGLLRSMYALICLEEDAAFLRYGY  624

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDNAA +RKEV KLC ELRPHALALV+S GIPDAFL PIAFNWIDAN+WSS+
Sbjct  625  LSTDNAAAVRKEVTKLCGELRPHALALVSSLGIPDAFLGPIAFNWIDANSWSSV  678



>ref|XP_006364108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PVIPSQL++  +R  +FQ DI CLRERDLL RFAAEVS  Q+QG+SKEYAF +
Sbjct  510  EHMNTSRPVIPSQLTNSTMRQAQFQNDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTL  569

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF++AEA V S P+KN L LVRSMY L TL+EDAAFLRYGY
Sbjct  570  NYQLAEDLGRAFSDRAVLHTFLDAEAFVTSGPLKNVLDLVRSMYVLVTLEEDAAFLRYGY  629

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DNAA +RKEVAKLCSELRPHAL+LV+SFG+PDAFLSPIAFNW++ANAWSS
Sbjct  630  LSMDNAAIVRKEVAKLCSELRPHALSLVSSFGLPDAFLSPIAFNWVEANAWSS  682



>ref|XP_006364109.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum tuberosum]
Length=683

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PVIPSQL++  +R  +FQ DI CLRERDLL RFAAEVS  Q+QG+SKEYAF +
Sbjct  508  EHMNTSRPVIPSQLTNSTMRQAQFQNDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTL  567

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAF+DRA+  TF++AEA V S P+KN L LVRSMY L TL+EDAAFLRYGY
Sbjct  568  NYQLAEDLGRAFSDRAVLHTFLDAEAFVTSGPLKNVLDLVRSMYVLVTLEEDAAFLRYGY  627

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DNAA +RKEVAKLCSELRPHAL+LV+SFG+PDAFLSPIAFNW++ANAWSS
Sbjct  628  LSMDNAAIVRKEVAKLCSELRPHALSLVSSFGLPDAFLSPIAFNWVEANAWSS  680



>ref|XP_011037432.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=514

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVI S L+S  LR+ +FQ +  CLRERDLLNRFAAEVS+ QS+GESKE AF +
Sbjct  339  EHMNGPVPVIQSNLTSTTLRNSQFQMNTHCLRERDLLNRFAAEVSLYQSKGESKERAFIL  398

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V++ P+KN LGL+RSMYAL  L+EDAAFLRYGY
Sbjct  399  SYQLAEDLGRAFSDRAILQTFIDAEANVSAGPLKNVLGLLRSMYALICLEEDAAFLRYGY  458

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+NAA +R EV KLC ELRPHALALV+S GIPDAFLSPIAFNWIDAN+WSS+
Sbjct  459  LSTENAAAVRNEVTKLCGELRPHALALVSSLGIPDAFLSPIAFNWIDANSWSSV  512



>emb|CBI21935.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S PV+PSQL+S  LRS +FQTDI CLRERDLL RFAAE+S  Q+QG S+EYA   
Sbjct  373  EHMNKSCPVVPSQLTSSTLRSSQFQTDIFCLRERDLLIRFAAEMSQLQAQGLSREYALLQ  432

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V+S P+K+ L L+RSM+ L  L+EDA+FLRYGY
Sbjct  433  SYQLAEDLGRAFSDRAILQTFLDAEAAVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGY  492

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNAA IRKEV  LCSELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  493  LSPDNAAGIRKEVTILCSELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  546



>ref|XP_011013714.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=643

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVI S L+S  LR+ +FQ ++ CLRERDLLNRFAAE S+ QS+GESKE AF +
Sbjct  468  EHMNGPVPVIQSNLTSTTLRNSQFQMNVHCLRERDLLNRFAAEASLYQSKGESKERAFIL  527

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V++ P+KN LGL+RSMYAL  L+EDAAFLRYGY
Sbjct  528  SYQLAEDLGRAFSDRAILQTFIDAEANVSASPLKNVLGLLRSMYALICLEEDAAFLRYGY  587

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDNAA +R EV KLC ELRPHALALV+S GIPDAFLSPIAFNWIDAN+WSS+
Sbjct  588  LSTDNAAAVRNEVTKLCGELRPHALALVSSLGIPDAFLSPIAFNWIDANSWSSV  641



>ref|XP_012079023.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Jatropha 
curcas]
 gb|KDP31760.1| hypothetical protein JCGZ_12221 [Jatropha curcas]
Length=680

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVIPSQL+S  LRS +FQ +  CLRERDLL+RFAAEVS  Q+ GESKE AF M
Sbjct  505  EHMNGPCPVIPSQLTSAILRSSQFQINAFCLRERDLLSRFAAEVSQHQANGESKERAFIM  564

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DR I QTF+EAE +V++  +KN LGL+RSMYAL  L+ED+AFLRYGY
Sbjct  565  SYQLAEDLGRAFSDRLILQTFIEAETTVSAGSLKNVLGLLRSMYALICLEEDSAFLRYGY  624

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST++AA +RKEVAKLCSELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  625  LSTESAAAVRKEVAKLCSELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  678



>ref|XP_011013710.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A oxidase 3, peroxisomal-like 
[Populus euphratica]
Length=680

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVI S L+S  LR+ +FQ +  CLRERDLLNRFAAEVS+ QS+GESKE AF +
Sbjct  505  EHMNGPVPVIQSNLTSTTLRNSQFQMNTHCLRERDLLNRFAAEVSLYQSKGESKERAFIL  564

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V++ P+KN LGL+RSMYAL  L+EDAAFLRYGY
Sbjct  565  SYQLAEDLGRAFSDRAILQTFIDAEANVSAGPLKNVLGLLRSMYALICLEEDAAFLRYGY  624

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+NAA +R EV KLC ELRPHALALV+S GIPDAFLSPIAFNWIDAN+WSS+
Sbjct  625  LSTENAAAVRNEVTKLCGELRPHALALVSSLGIPDAFLSPIAFNWIDANSWSSV  678



>ref|XP_002525155.1| acyl-CoA oxidase, putative [Ricinus communis]
 gb|EEF37282.1| acyl-CoA oxidase, putative [Ricinus communis]
Length=625

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN    +IPSQL+S  LRS +FQ    CLRERDLLNRFA EVS  Q++GESKE AF +
Sbjct  450  EHMNGPCLIIPSQLTSTILRSSQFQIGAFCLRERDLLNRFATEVSQHQAKGESKENAFML  509

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             YQLAEDLGRAF+DRAI QTF+EAE SV+   +KN LGL+RSMYA+  L+EDAAFLRYGY
Sbjct  510  GYQLAEDLGRAFSDRAILQTFIEAETSVSDGALKNVLGLLRSMYAMICLEEDAAFLRYGY  569

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+NAA +RKEV KLC+ELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  570  LSTENAAAVRKEVMKLCNELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  623



>gb|KJB50145.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=543

 Score =   268 bits (685),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL++  LR  +FQ D+LCLRERDLLNRF AEVS  Q++GESKE+AF M
Sbjct  369  EHMNKPCPVIPSQLTTTTLRCSQFQMDVLCLRERDLLNRFVAEVSQCQAKGESKEHAFIM  428

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLG+AF+DRAI QTFVEAEA++ +  +K+ LG++RS+YAL  L ED A+LRYGY
Sbjct  429  SYQLAEDLGKAFSDRAILQTFVEAEATLAACSLKDVLGMLRSLYALNCL-EDGAYLRYGY  487

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS +NAAT+R+E+ K+CSELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS
Sbjct  488  LSVENAATVRREITKICSELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSS  540



>ref|XP_002278663.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Vitis vinifera]
Length=691

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S PV+PSQL+S  LRS +FQTDI CLRERDLL RFAAE+S  Q+QG S+EYA   
Sbjct  506  EHMNKSCPVVPSQLTSSTLRSSQFQTDIFCLRERDLLIRFAAEMSQLQAQGLSREYALLQ  565

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V+S P+K+ L L+RSM+ L  L+EDA+FLRYGY
Sbjct  566  SYQLAEDLGRAFSDRAILQTFLDAEAAVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGY  625

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNAA IRKEV  LCSELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  626  LSPDNAAGIRKEVTILCSELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  679



>ref|XP_007213791.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
 gb|EMJ14990.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
Length=520

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  L+S +FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  345  EHMNKPCPVIPSQLTSSTLQSSQFQMDAFCLRERDLLNRFAMEVSERQKQGESKEYSVIL  404

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA+DLGRAF+DR I Q  ++AEA V S  +KN L ++RSMYAL  L+ED AFLR+GY
Sbjct  405  SYQLAQDLGRAFSDRTILQALLDAEAGVPSGSLKNVLAMLRSMYALICLEEDPAFLRFGY  464

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDN A +RKEV++LC ELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  465  LSTDNVAAVRKEVSRLCGELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  518



>ref|XP_006376402.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|ERP54199.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=673

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PVI S L+S  LR+ +FQ +  CLRERDLLNRFAAEVS+ QS+GESKE AF +
Sbjct  498  EHMNGPVPVIQSNLTSTTLRNSQFQMNAHCLRERDLLNRFAAEVSLYQSKGESKERAFIL  557

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+V++  +KN LGL+RSMYAL  L+EDAAFLRYGY
Sbjct  558  SYQLAEDLGRAFSDRAILQTFIDAEANVSAGSLKNVLGLLRSMYALICLEEDAAFLRYGY  617

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDNAA +R EV KLC ELRPHALALV+S GIPDAFLSPIAFNWIDAN+WSS+
Sbjct  618  LSTDNAAAVRNEVTKLCGELRPHALALVSSLGIPDAFLSPIAFNWIDANSWSSV  671



>ref|NP_001280826.1| acyl-coenzyme A oxidase 3, peroxisomal-like [Malus domestica]
 gb|ABB83366.1| putative medium chain acyl-CoA oxidase [Malus domestica]
Length=674

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  L+  +FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  498  EHMNKPCPVIPSQLTSSTLQCSQFQMDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIIL  557

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA DLGRAFADR+I QTF++AEA++ +  +KN L L+RSMYAL  L+EDAAFLRYGY
Sbjct  558  SYQLAGDLGRAFADRSILQTFIDAEAALPAGSLKNVLALLRSMYALICLEEDAAFLRYGY  617

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDN A +RKEV++LC ELRPHALALV+SFGIPDAFLSPIAFNWID+N+WSS+
Sbjct  618  LSTDNVAAVRKEVSRLCGELRPHALALVSSFGIPDAFLSPIAFNWIDSNSWSSV  671



>ref|XP_010279215.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Nelumbo 
nucifera]
Length=684

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S PVIP+QLSS  LRS +FQ DI CLRERDLLNR A++V+ RQ+QGES+EYAF M
Sbjct  509  EHMNDSCPVIPAQLSSSVLRSSKFQVDIFCLRERDLLNRLASQVAERQAQGESREYAFLM  568

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF++RAI Q F+E+EAS++   +KN LGL+RSMYA+ +L+EDA+FLRYGY
Sbjct  569  SYQLAEDLARAFSERAILQNFLESEASLSVGSLKNVLGLLRSMYAMVSLEEDASFLRYGY  628

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            +ST+N A +RKEV KLCSELR HAL+LV+SFGIPDAFLSPIAFNWI++N+WSS+
Sbjct  629  MSTENDAAVRKEVMKLCSELRSHALSLVSSFGIPDAFLSPIAFNWIESNSWSSV  682



>gb|EYU29818.1| hypothetical protein MIMGU_mgv1a002427mg [Erythranthe guttata]
Length=676

 Score =   269 bits (687),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            +HMN+S P IP QL++  +RS++FQ DILCLRERDLLN FAA+VS  Q+QGESKE A   
Sbjct  501  DHMNKSCPTIPLQLTASTVRSVQFQNDILCLRERDLLNHFAAQVSKYQAQGESKESAVIA  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SY+LAEDLGRAF+DRAIFQTFVEAE +V  +P+KN L ++RSMY L TLDEDAAFLRYGY
Sbjct  561  SYRLAEDLGRAFSDRAIFQTFVEAENNVTDVPLKNILSVLRSMYVLVTLDEDAAFLRYGY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            L+ +NA T+RKEVA LCSE+RPHALALV SFGIPDAFLSPIAF+WI AN+WS
Sbjct  621  LTVENAETVRKEVANLCSEMRPHALALVTSFGIPDAFLSPIAFDWIAANSWS  672



>ref|XP_009354288.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Pyrus 
x bretschneideri]
Length=674

 Score =   268 bits (686),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  L+  +FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  498  EHMNKPCPVIPSQLTSSTLQCRQFQMDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIIL  557

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA DLGRAFADRAI QTF++AEA++ +  +KN L L+RSMYAL  L+EDAAFLRYGY
Sbjct  558  SYQLAGDLGRAFADRAILQTFIDAEAALPAGSLKNVLALLRSMYALICLEEDAAFLRYGY  617

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDN A +RKEV++LC ELRPHALALV+SFGIPDA LSPIAFNWID+N+WSS+
Sbjct  618  LSTDNVAAVRKEVSRLCGELRPHALALVSSFGIPDACLSPIAFNWIDSNSWSSV  671



>gb|KJB50144.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=676

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL++  LR  +FQ D+LCLRERDLLNRF AEVS  Q++GESKE+AF M
Sbjct  502  EHMNKPCPVIPSQLTTTTLRCSQFQMDVLCLRERDLLNRFVAEVSQCQAKGESKEHAFIM  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLG+AF+DRAI QTFVEAEA++ +  +K+ LG++RS+YAL  L ED A+LRYGY
Sbjct  562  SYQLAEDLGKAFSDRAILQTFVEAEATLAACSLKDVLGMLRSLYALNCL-EDGAYLRYGY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS +NAAT+R+E+ K+CSELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS
Sbjct  621  LSVENAATVRREITKICSELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSS  673



>ref|XP_008244854.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Prunus 
mume]
Length=662

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPS+L+S  L+S +FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  487  EHMNKPCPVIPSRLTSSTLQSSQFQMDAFCLRERDLLNRFAMEVSERQKQGESKEYSVIL  546

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA+DLGRAF+DR I QT ++AEA V S  +KN L ++RSMYAL  L+ED AFLR+GY
Sbjct  547  SYQLAQDLGRAFSDRTILQTLLDAEAGVPSGSLKNVLAMLRSMYALICLEEDLAFLRFGY  606

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDN A +RKEV++LC ELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  607  LSTDNVAAVRKEVSRLCGELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  660



>ref|XP_006469060.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Citrus 
sinensis]
Length=671

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  LR+ +FQ D  CLRERDLL+RF  +VS  Q++G+SK+YA  +
Sbjct  497  EHMNKPCPVIPSQLTSSILRTTQFQMDAFCLRERDLLSRFVMKVSQHQAEGQSKDYALML  556

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRA+ QTF++ EA+++S  +KN LGL+RS+YAL  L+EDAAFLRYGY
Sbjct  557  SYQLAEDLGRAFSDRAMLQTFIDTEATISSGSLKNVLGLLRSLYALTCLEEDAAFLRYGY  616

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDNA+ +R EV KLCSE+RPHALALV+SFGIPDAFL PIAF+WIDANAWSS+
Sbjct  617  LSTDNASAVRNEVQKLCSEIRPHALALVSSFGIPDAFLGPIAFDWIDANAWSSV  670



>gb|AFQ93695.1| acyl-CoA oxidase 3 [Prunus persica]
Length=672

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  L+S +FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  497  EHMNKPCPVIPSQLTSSTLQSSQFQMDAFCLRERDLLNRFAMEVSERQKQGESKEYSVIL  556

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA+DLGRAF+DR I Q  ++AEA V S  +KN L ++RSMYAL  L+ED AFLR+GY
Sbjct  557  SYQLAQDLGRAFSDRTILQALLDAEAGVPSGSLKNVLAMLRSMYALICLEEDPAFLRFGY  616

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDN A +RKEV++LC ELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSS+
Sbjct  617  LSTDNVAAVRKEVSRLCGELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSV  670



>ref|XP_006446734.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
 gb|ESR59974.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
Length=671

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  LR+ +FQ D  CLRERDLL+RF  +VS  Q++G+SK+YA  +
Sbjct  497  EHMNKPCPVIPSQLTSSILRTTQFQMDAFCLRERDLLSRFVMKVSQHQAEGQSKDYALML  556

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRA+ QTF++ EA+++S  +KN LGL+RS+YAL  L+EDAAFLRYGY
Sbjct  557  SYQLAEDLGRAFSDRAMLQTFIDTEATISSGSLKNVLGLLRSLYALTCLEEDAAFLRYGY  616

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDNA+ +R EV KLCSE+RPHALALV+SFGIPDAFL PIAF+WIDAN WSS+
Sbjct  617  LSTDNASAVRNEVQKLCSEIRPHALALVSSFGIPDAFLGPIAFDWIDANTWSSV  670



>gb|KJB31620.1| hypothetical protein B456_005G198300 [Gossypium raimondii]
Length=674

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S ALRS +FQ D LCLRERDLLNRFAAE+S  Q++G SKE+AF M
Sbjct  500  EHMNKPCPVIPSQLTSTALRSSQFQMDALCLRERDLLNRFAAEISHYQAKGPSKEHAFNM  559

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDLGRAF DR+IFQ F EAEA++ +  +K+ LG+VRS+Y L  + EDA+FLRYGY
Sbjct  560  SYQIAEDLGRAFTDRSIFQAFAEAEATLAASSLKDVLGMVRSLYGLICV-EDASFLRYGY  618

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +NAA +R E+ K+C ELRPHALALV+SFGIPDAFLSPIAFNWIDAN+WSSI
Sbjct  619  LSVENAAAVRSEITKVCGELRPHALALVSSFGIPDAFLSPIAFNWIDANSWSSI  672



>ref|XP_008358246.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A oxidase 3, peroxisomal-like 
[Malus domestica]
Length=356

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  L+   FQ D  CLRERDLLNRFA EVS  Q QGESKEY+   
Sbjct  167  EHMNKPRPVIPSQLTSSTLQCSXFQMDAFCLRERDLLNRFAMEVSQHQKQGESKEYSVIR  226

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRA+ QTF++AEA++ +  +KN L L+RSM A   L+EDAAFLRYGY
Sbjct  227  SYQLAEDLGRAFSDRAMLQTFIDAEAALPAXSLKNVLALLRSMXAWICLEEDAAFLRYGY  286

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+  A +R EV++LC ELRPHALALV+SFGIPDAFLSPIAF WI +N+WSS+
Sbjct  287  LSTNKVAAVRNEVSRLCGELRPHALALVSSFGIPDAFLSPIAFXWIHSNSWSSV  340



>ref|XP_003607535.1| Acyl-coenzyme A oxidase 3, peroxisomal [Medicago truncatula]
 gb|AES89732.1| peroxisomal acyl-CoA oxidase [Medicago truncatula]
Length=678

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PVIPSQL+S  ++S  FQ D+  LRERDLL RFAAEVS  QSQG SKE AF +
Sbjct  503  EHMNGSCPVIPSQLTSSTIKSSEFQIDLFHLRERDLLKRFAAEVSEHQSQGNSKESAFIL  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF++RAI +TF+EAE+++ +  +K+ LGL+RS+YAL ++DEDAAFLRYGY
Sbjct  563  SYQLAEDLGRAFSERAILKTFMEAESALPAGSLKDVLGLLRSLYALISVDEDAAFLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST+NA+ +RKEV KLC+ELRPHALALVNSFGIPDAFLSPIA+NW+++N+WS+
Sbjct  623  LSTENASAVRKEVPKLCAELRPHALALVNSFGIPDAFLSPIAYNWVESNSWST  675



>ref|XP_004303096.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=674

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIP  L+S  L+SI FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  498  EHMNKPCPVIPPHLTSSTLQSIEFQMDAFCLRERDLLNRFALEVSQRQKQGESKEYSVLL  557

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DR I QTF++ EA+V +  +KN L ++R+MYAL  L+ED  FLRYGY
Sbjct  558  SYQLAEDLGRAFSDRTILQTFIDVEATVPAGSLKNVLAMLRTMYALICLEEDVTFLRYGY  617

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LSTDN   ++KEV+ LC ELRPHAL LV+SFGIPDAFLSPIAFNWI++N+WSS+
Sbjct  618  LSTDNVTAVQKEVSSLCRELRPHALTLVSSFGIPDAFLSPIAFNWIESNSWSSV  671



>ref|XP_011100229.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Sesamum 
indicum]
Length=678

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 144/174 (83%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S P+IPSQL+    RS +FQ DI CLRERDL+      VS  Q+QGESKE AF +
Sbjct  504  EHMNKSCPIIPSQLTVSTARSAQFQNDIFCLRERDLI-YXXXXVSRYQAQGESKESAFIV  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAFADRAI QTF+EAE +V   P+KN L L+RSMY L TLDEDAAFLRYGY
Sbjct  563  SYQLAEDLGRAFADRAILQTFIEAENNVTDAPLKNMLSLLRSMYVLVTLDEDAAFLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            L+T+NAAT+RKEVAKLCSE+RPHALALV+S GIPDAFLSPIAF+W+ AN+WS +
Sbjct  623  LTTENAATVRKEVAKLCSEIRPHALALVSSLGIPDAFLSPIAFDWVAANSWSPV  676



>gb|KHG13766.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=675

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S ALRS +FQ   LCLRERDLLNRFAAE+S  Q++G SKE+AF M
Sbjct  501  EHMNKPCPVIPSQLTSTALRSSQFQMKALCLRERDLLNRFAAEISHYQAKGLSKEHAFNM  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDLGRAF DR+IFQ F EAEA++ +  +K+ LG+VRS+Y L  + EDA+FLRYGY
Sbjct  561  SYQIAEDLGRAFTDRSIFQAFAEAEATLAASSLKDVLGMVRSLYGLICV-EDASFLRYGY  619

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +NAA +R E+ K+C ELRPHALALV+SFGIP AFLSPIAFNWIDAN+WSSI
Sbjct  620  LSVENAAAVRSEITKVCGELRPHALALVSSFGIPHAFLSPIAFNWIDANSWSSI  673



>ref|XP_007043726.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
 gb|EOX99557.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
Length=676

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  LR  +FQ D LCLRERDLL  F  +VS  Q++GESKE+AF M
Sbjct  502  EHMNKPCPVIPSQLTSATLRCSQFQMDALCLRERDLLKCFVLDVSQHQAKGESKEHAFIM  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF+DRAIFQ FVEAEA++ +  +K+ LG++RS+YAL  + ED AFLRYGY
Sbjct  562  SYQLAEDLSRAFSDRAIFQKFVEAEATLAAGSLKDVLGMLRSLYALICI-EDVAFLRYGY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNAA +R+E+ K+CSELRPHALALV+SFGIPDAFLSP+AFNWIDAN+WSS+
Sbjct  621  LSVDNAAAVRREITKVCSELRPHALALVSSFGIPDAFLSPVAFNWIDANSWSSV  674



>ref|XP_010093490.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
 gb|EXB54129.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
Length=667

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN + PVIPSQL+S  L S +FQ D  CLRERDLLNRF+ EVS  Q  G+SKE+AF +
Sbjct  497  EHMNGAHPVIPSQLTSSTLGSSQFQMDAFCLRERDLLNRFSMEVSQHQKHGQSKEHAFIL  556

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AEA+     I +  G +RSMYAL  L+E+AAFLRYGY
Sbjct  557  SYQLAEDLGRAFSDRAILQTFLDAEAT-----IPDVFGKLRSMYALICLEEEAAFLRYGY  611

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS +NAA IRKEV KLCSELRPHALALV+SFGIPDAFLSPIAFNWID+N+WSS
Sbjct  612  LSMENAAAIRKEVTKLCSELRPHALALVSSFGIPDAFLSPIAFNWIDSNSWSS  664



>ref|XP_007043725.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOX99556.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
Length=690

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  LR  +FQ D LCLRERDLL  F  +VS  Q++GESKE+AF M
Sbjct  516  EHMNKPCPVIPSQLTSATLRCSQFQMDALCLRERDLLKCFVLDVSQHQAKGESKEHAFIM  575

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF+DRAIFQ FVEAEA++ +  +K+ LG++RS+YAL  + ED AFLRYGY
Sbjct  576  SYQLAEDLSRAFSDRAIFQKFVEAEATLAAGSLKDVLGMLRSLYALICI-EDVAFLRYGY  634

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNAA +R+E+ K+CSELRPHALALV+SFGIPDAFLSP+AFNWIDAN+WSS+
Sbjct  635  LSVDNAAAVRREITKVCSELRPHALALVSSFGIPDAFLSPVAFNWIDANSWSSV  688



>ref|XP_006592447.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Glycine max]
Length=584

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  +R+  FQ D+  LRERDLL RFA EVS  QS+GESKE AF +
Sbjct  410  EHMNKPLPVIPSQLTSSYIRNSEFQIDLFHLRERDLLRRFAEEVSEYQSRGESKESAFIL  469

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAE+LGRAF++RAI +TF+EAE++V +  +KN LGL+RS+YA+  +DED+AFLRYGY
Sbjct  470  SYQLAEELGRAFSERAILKTFMEAESTVPAGSLKNVLGLLRSLYAVICVDEDSAFLRYGY  529

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST+NA+ +RKEV KLC+ELRPHALALV+SFGIPDAFLSPIA+NW+D+N+WSS
Sbjct  530  LSTENASAVRKEVPKLCAELRPHALALVSSFGIPDAFLSPIAYNWVDSNSWSS  582



>ref|XP_010689759.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN SSP+IP QL+   LRS + QTDI  LRERDLL+RF AEVS  Q QG ++E+AF +
Sbjct  489  EHMNSSSPIIPDQLTGSILRSSQIQTDIFYLRERDLLHRFVAEVSAYQKQGRNREHAFVL  548

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAFAD+A+  TF+EAEA V   P+K+ L L+R++YAL  L+ED +FLRYGY
Sbjct  549  AYQLAEDLGRAFADKAVLLTFIEAEAKVPVGPLKDVLALLRTLYALIVLEEDVSFLRYGY  608

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            L+ +NAA +R+EV +LCSELRPHALALV+SFGIPDAFLSPIAF+WIDAN+WSS+
Sbjct  609  LTVENAAVVRQEVIRLCSELRPHALALVSSFGIPDAFLSPIAFDWIDANSWSSV  662



>ref|XP_010689760.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=688

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN SSP+IP QL+   LRS + QTDI  LRERDLL+RF AEVS  Q QG ++E+AF +
Sbjct  513  EHMNSSSPIIPDQLTGSILRSSQIQTDIFYLRERDLLHRFVAEVSAYQKQGRNREHAFVL  572

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAFAD+A+  TF+EAEA V   P+K+ L L+R++YAL  L+ED +FLRYGY
Sbjct  573  AYQLAEDLGRAFADKAVLLTFIEAEAKVPVGPLKDVLALLRTLYALIVLEEDVSFLRYGY  632

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            L+ +NAA +R+EV +LCSELRPHALALV+SFGIPDAFLSPIAF+WIDAN+WSS+
Sbjct  633  LTVENAAVVRQEVIRLCSELRPHALALVSSFGIPDAFLSPIAFDWIDANSWSSV  686



>gb|KHN07770.1| Acyl-coenzyme A oxidase 3, peroxisomal [Glycine soja]
Length=624

 Score =   254 bits (649),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  +RS  FQ D+  LRERDLL RFA EVS  QS+GESKE AF +
Sbjct  450  EHMNKPLPVIPSQLTSSTVRSSEFQIDLFHLRERDLLRRFAEEVSEYQSRGESKESAFIL  509

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA DLGRAF++RAI +TF+EAE+++ +  +KN LGL+RS+YA+  +DEDAAFLRYGY
Sbjct  510  SYQLAGDLGRAFSERAILKTFMEAESTLPAGTLKNVLGLLRSLYAVICVDEDAAFLRYGY  569

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST+NA+ +RKEV KLC+E+RPHALALV+SFGIPDAFLSPIA+NW+D+N+WSS
Sbjct  570  LSTENASAVRKEVPKLCAEIRPHALALVSSFGIPDAFLSPIAYNWVDSNSWSS  622



>ref|XP_010689758.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=686

 Score =   255 bits (652),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN SSP+IP QL+   LRS + QTDI  LRERDLL+RF AEVS  Q QG ++E+AF +
Sbjct  511  EHMNSSSPIIPDQLTGSILRSSQIQTDIFYLRERDLLHRFVAEVSAYQKQGRNREHAFVL  570

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDLGRAFAD+A+  TF+EAEA V   P+K+ L L+R++YAL  L+ED +FLRYGY
Sbjct  571  AYQLAEDLGRAFADKAVLLTFIEAEAKVPVGPLKDVLALLRTLYALIVLEEDVSFLRYGY  630

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            L+ +NAA +R+EV +LCSELRPHALALV+SFGIPDAFLSPIAF+WIDAN+WSS+
Sbjct  631  LTVENAAVVRQEVIRLCSELRPHALALVSSFGIPDAFLSPIAFDWIDANSWSSV  684



>gb|AAF82159.1|AC068143_1 Contains similarity to an acyl-CoA oxidase from Myxococcus xanthus 
gb|AF013216 and contains an acyl-CoA oxidase PF|01756 
domain. EST gb|AI997124 comes from this gene, partial [Arabidopsis 
thaliana]
Length=419

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S  LR  +FQT++ CLRERDLL +F +EV+  Q +GES+E++F +
Sbjct  246  EHMNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQFTSEVAQLQGRGESREFSFLL  305

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  306  SHQLAEDLGKAFTEKAILQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGY  365

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  366  LSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  419



>ref|XP_003539950.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Glycine max]
Length=675

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  +R+  FQ D+  LRERDLL RFA EVS  QS+GESKE AF +
Sbjct  501  EHMNKPLPVIPSQLTSSYIRNSEFQIDLFHLRERDLLRRFAEEVSEYQSRGESKESAFIL  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAE+LGRAF++RAI +TF+EAE++V +  +KN LGL+RS+YA+  +DED+AFLRYGY
Sbjct  561  SYQLAEELGRAFSERAILKTFMEAESTVPAGSLKNVLGLLRSLYAVICVDEDSAFLRYGY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST+NA+ +RKEV KLC+ELRPHALALV+SFGIPDAFLSPIA+NW+D+N+WSS
Sbjct  621  LSTENASAVRKEVPKLCAELRPHALALVSSFGIPDAFLSPIAYNWVDSNSWSS  673



>ref|XP_004151905.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
sativus]
 gb|KGN63212.1| hypothetical protein Csa_2G415540 [Cucumis sativus]
Length=681

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN++ PVIPS+L+S  LRS +FQTD  CLRERDLLNR AAEVS   ++G SKEYAF  
Sbjct  497  EHMNKACPVIPSKLTSSILRSCQFQTDAFCLRERDLLNRLAAEVSQDVARGNSKEYAFIQ  556

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+  AEDLGRAF+++AI   F+E E SV S  IKN LGL+RSMYAL  L+EDA+FLRYGY
Sbjct  557  SFLFAEDLGRAFSEKAILHCFIEVENSVPSGSIKNVLGLLRSMYALICLEEDASFLRYGY  616

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +N A +R+EV KLCSE+RPHALALVNSFGIPDAFL+PIA+NW+++N+WSS+
Sbjct  617  LSPENVAAVRQEVKKLCSEIRPHALALVNSFGIPDAFLAPIAYNWVESNSWSSV  670



>ref|XP_003527400.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Glycine 
max]
Length=675

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  +RS  FQ D+  LRERDLL RFA EVS  QS+GESKE AF +
Sbjct  501  EHMNKPLPVIPSQLTSSTVRSSEFQIDLFHLRERDLLRRFAEEVSEYQSRGESKESAFIL  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA DLGRAF++RAI +TF+EAE+++ +  +KN LGL+RS+YA+  +DEDAAFLRYGY
Sbjct  561  SYQLAGDLGRAFSERAILKTFMEAESTLPAGTLKNVLGLLRSLYAVICVDEDAAFLRYGY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST+NA+ +RKEV KLC+E+RPHALALV+SFGIPDAFLSPIA+NW+D+N+WSS
Sbjct  621  LSTENASAVRKEVPKLCAEIRPHALALVSSFGIPDAFLSPIAYNWVDSNSWSS  673



>ref|NP_187325.4| putative acyl-coenzyme A oxidase [Arabidopsis thaliana]
 sp|P0CZ24.1|Y3669_ARATH RecName: Full=Putative acyl-coenzyme A oxidase At3g06690; Short=Acyl-CoA 
oxidase [Arabidopsis thaliana]
 gb|AEE74442.1| putative acyl-coenzyme A oxidase [Arabidopsis thaliana]
Length=187

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  827  PVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED  648
            PV+P+QL+S  LR  +FQT++ CLRERDLL RF +EV+  Q +GES+E++F +S+QLAED
Sbjct  21   PVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREFSFLLSHQLAED  80

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAA  468
            LG+AF ++A+ QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGYLS DN  
Sbjct  81   LGKAFTEKAMLQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVG  140

Query  467  TIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
             +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++AN WSS+
Sbjct  141  DVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANTWSSV  187



>ref|XP_004505527.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cicer 
arietinum]
Length=678

 Score =   250 bits (638),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+S P++PSQL+S  + S  FQ D+  LRERDLL RFAAEVS  QS G SKE +F +
Sbjct  503  EHMNKSCPIVPSQLTSSIINSSEFQIDLFHLRERDLLMRFAAEVSEHQSHGNSKESSFIL  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+ RAI +TF+EAE+++ +   KN LGL+RS+YAL  +DEDAAFLRYGY
Sbjct  563  SYQLAEDLGRAFSKRAILKTFMEAESNLPAGSSKNVLGLLRSLYALICVDEDAAFLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST  A+ +RKEV KLC+ELRPHALALVNSFGIPDAFLSPIA+NW+++N+WS+
Sbjct  623  LSTRKASAVRKEVPKLCAELRPHALALVNSFGIPDAFLSPIAYNWVESNSWSA  675



>ref|XP_010035824.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Eucalyptus 
grandis]
 gb|KCW47288.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=675

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P QL S  LRS +FQ D   +RERDLLNRFA E+  RQ+QGE KE+A   
Sbjct  500  EHMNGPCPVLPQQLPSTVLRSDQFQVDAFHVRERDLLNRFAEEILQRQAQGERKEHALLS  559

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF++R + Q FVE E +  +  +K+ L L+RSMYAL  ++EDA+FLRYGY
Sbjct  560  SYQLAEDLGRAFSERCVLQNFVEVEENSPAGSLKDMLALLRSMYALTCMEEDASFLRYGY  619

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+NAA +RKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNW++AN+WSS+
Sbjct  620  LSTENAAAVRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWVEANSWSSV  673



>gb|KCW47289.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=678

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P QL S  LRS +FQ D   +RERDLLNRFA E+  RQ+QGE KE+A   
Sbjct  503  EHMNGPCPVLPQQLPSTVLRSDQFQVDAFHVRERDLLNRFAEEILQRQAQGERKEHALLS  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF++R + Q FVE E +  +  +K+ L L+RSMYAL  ++EDA+FLRYGY
Sbjct  563  SYQLAEDLGRAFSERCVLQNFVEVEENSPAGSLKDMLALLRSMYALTCMEEDASFLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LST+NAA +RKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNW++AN+WSS+
Sbjct  623  LSTENAAAVRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWVEANSWSSV  676



>ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
 sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 
3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA 
oxidase; Short=AtCX3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana]
 gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
 gb|AAP37772.1| At1g06290 [Arabidopsis thaliana]
 dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
Length=675

 Score =   248 bits (632),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S  LR  +FQT++ CLRERDLL +F +EV+  Q +GES+E++F +
Sbjct  502  EHMNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQFTSEVAQLQGRGESREFSFLL  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  562  SHQLAEDLGKAFTEKAILQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  622  LSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
Length=675

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S  LR  +FQT++ CLRERDLL +F +EV+  Q +GES+E++F +
Sbjct  502  EHMNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQFTSEVAQLQGRGESREFSFLL  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  562  SHQLAEDLGKAFTEKAILQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  622  LSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65856.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   247 bits (631),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PV+P+QL+S  LR  +FQT++ CLRERDLL RF +EV+  Q +GES+E++F +
Sbjct  502  EHLNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREFSFLL  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  562  SHQLAEDLGKAFTEKAILQTILDAEAKLPAGSVKDVLGLVRSMYALISLEEDPSLLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  622  LSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>gb|KJB12478.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
 gb|KJB12479.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=694

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIP QL+S  LR  +FQ D LCLRERDLLNRF A+VS  +++GES E AF M
Sbjct  522  EHMNKPCPVIPLQLTSTTLRCSQFQMDALCLRERDLLNRFVADVSKCKAKGESNEQAFMM  581

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             Y+LA+DLG+AF+DRAIFQTFV+AE ++ +  +K+ LG +RS+YAL  + ED +FL+YGY
Sbjct  582  CYELAQDLGKAFSDRAIFQTFVDAETTLPAGSLKDVLGTLRSLYALICI-EDVSFLQYGY  640

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN A +R+E+ KLC+ELRPHALALV+SFGIPDAFL PIAFNWI+ANAWSS+
Sbjct  641  LSVDNGANVRREITKLCTELRPHALALVSSFGIPDAFLGPIAFNWIEANAWSSV  694



>ref|XP_010916040.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Elaeis 
guineensis]
Length=747

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIP+ L+S  LRSI FQTD+ CLRERDLLNRFA+EVS  Q+ GESKE A  +
Sbjct  571  EHMNDPCPVIPTNLTSCTLRSITFQTDLFCLRERDLLNRFASEVSQYQNHGESKENAVNL  630

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAE+L RAF +R I QTF++ E ++ + P+K+ LGL+RSMYAL  ++EDA+F+RYGY
Sbjct  631  SYQLAEELARAFTERKILQTFMDTEMTLPAGPLKDVLGLLRSMYALICVEEDASFIRYGY  690

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            LS  NAA +RKEV +LC+++RPHALA+VNSFGIPDAFLSP+AF+WI+AN+WS
Sbjct  691  LSLSNAAAVRKEVMRLCTDVRPHALAVVNSFGIPDAFLSPLAFDWIEANSWS  742



>ref|XP_006417937.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
 gb|ESQ36290.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
Length=675

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S  LR  +FQT++ CLRERDLL RF +EV+  Q +GES+E +F +
Sbjct  502  EHMNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESRELSFLV  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            ++Q+AEDLG+AF ++AI QT ++ EA +++ P+K+ LGLVRSMYAL  L+ED + LRYGY
Sbjct  562  NHQIAEDLGKAFTEKAILQTILDTEAKLSAGPVKDVLGLVRSMYALICLEEDPSLLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPDAFL+PIAFNW++ANAWSS+
Sbjct  622  LSRDNVGDVRREVSKLCGELRPHALALVTSFGIPDAFLAPIAFNWVEANAWSSV  675



>gb|EPS63701.1| hypothetical protein M569_11080, partial [Genlisea aurea]
Length=352

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            +HMNE  PVIPSQL+S  +RS RFQ DILCLRERDLL+RFAAEV   Q+QGESKE A   
Sbjct  183  DHMNEPRPVIPSQLTSSTIRSSRFQKDILCLRERDLLDRFAAEVWRYQAQGESKESASMA  242

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DR+IF+ F EAE +++   +K  + +VR++Y   TLDEDAAFLRYGY
Sbjct  243  SYQLAEDLGRAFSDRSIFRCFTEAENNLSDPSLKRMVSVVRTLYVAATLDEDAAFLRYGY  302

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANA  339
            L+T++AA +R+E+ KLC E+RPHAL LV +FGIPDAFLSPIAF+W+ AN+
Sbjct  303  LNTESAAAVREEMPKLCGEVRPHALPLVTAFGIPDAFLSPIAFDWVAANS  352



>ref|XP_007132685.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
 gb|ESW04679.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
Length=674

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  P+IPS ++S  +RS  FQ D+  LRERDLL RFA EVS  QS+GESKE AF +
Sbjct  500  EHMNKPLPIIPSHVTSPIIRSSEFQIDLFHLRERDLLRRFAEEVSEYQSRGESKESAFIL  559

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF++RAI +TF++A +++ +  +KN LGL+RS+YA+ ++DEDA FLRYGY
Sbjct  560  SYQLAEDLGRAFSERAILKTFMDAVSTLPAGSLKNVLGLLRSLYAVISVDEDATFLRYGY  619

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LST++A+ +RKEV KLC+ELRPHALALV+SFGIPDAFLSPIA+NW+D+N+WSS
Sbjct  620  LSTEDASAVRKEVPKLCAELRPHALALVSSFGIPDAFLSPIAYNWVDSNSWSS  672



>ref|XP_006306351.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
 gb|EOA39249.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
Length=675

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S P +P+QL+S  LR  +FQT++ CLRERDLL RF +EV+  Q +GES+E +F +
Sbjct  502  EHMNSSRPELPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREISFLL  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  562  SHQLAEDLGKAFTEKAILQTILDAEAKLPAGSVKDVLGLVRSMYALISLEEDPSMLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  622  LSRDNVGDVRREVSKLCKELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>ref|XP_010522108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Tarenaya hassleriana]
Length=680

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+PSQL+S  LR  +FQT++ CLRERDLL RF+AEVS  Q +GES+EY+F  
Sbjct  503  EHMNSPRPVLPSQLTSSTLRCSQFQTNVFCLRERDLLERFSAEVSQHQGKGESREYSFMQ  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            ++QLAEDLGRAFA++AI QT +EAEA + +  +K+ LG+VR+MY L  ++EDA+FLRY Y
Sbjct  563  NHQLAEDLGRAFAEKAILQTILEAEAKLPAGSVKDVLGMVRAMYGLICIEEDASFLRYEY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LSTD    +R+EV+KLC E+RPHAL+LV SFG PD+FLSPIAFNW++ANAW S
Sbjct  623  LSTDGIGAVRREVSKLCGEMRPHALSLVTSFGFPDSFLSPIAFNWVEANAWPS  675



>gb|KHG26832.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=670

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIP QL+S  LR  +FQ D LCLRERDLLNRF A+VS  +++GES E AF +
Sbjct  498  EHMNKPCPVIPLQLTSTTLRCSQFQMDALCLRERDLLNRFVADVSKCKAKGESSEQAFMI  557

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             Y+LA+DLG+AF+DRAIFQTFV+AE ++ +  +K+ LG +RS+YAL  + ED +FL+YGY
Sbjct  558  CYELAQDLGKAFSDRAIFQTFVDAETTLPAGSLKDVLGTLRSLYALICI-EDVSFLQYGY  616

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN A +R+E+ KLC+ELRPHALALV+SFGIPDAFL PIAFNWI+ANAWSS+
Sbjct  617  LSVDNGANVRREITKLCTELRPHALALVSSFGIPDAFLGPIAFNWIEANAWSSV  670



>ref|XP_010457756.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=675

 Score =   245 bits (625),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QL+S  LR  +FQT++ CLRERDLL RF +EV+  Q +GES+E +F  
Sbjct  502  EHMNTSRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREISFLQ  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++A+ QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  562  SHQLAEDLGKAFTEKALLQTILDAEAKLPAGSVKDVLGLVRSMYALISLEEDPSLLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +N   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  622  LSRENVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>ref|XP_009119069.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Brassica rapa]
 emb|CDY57818.1| BnaA10g28060D [Brassica napus]
Length=675

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QLSS  LR  +FQ ++ CLRERDLL RF +EV+  Q +GES+E +F +
Sbjct  502  EHMNSSRPVLPTQLSSSTLRCSQFQKNVFCLRERDLLERFTSEVAQLQGRGESRESSFLV  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +++LAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +++ED +FLRYGY
Sbjct  562  NHELAEDLGKAFTEKAILQTILDAEAKLPAGSMKDVLGLVRSMYALISIEEDPSFLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV+SFGIPDAFL PIAFNW++ANAWSS+
Sbjct  622  LSRDNVGDVRREVSKLCGELRPHALALVSSFGIPDAFLGPIAFNWVEANAWSSV  675



>ref|XP_010485961.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Camelina sativa]
Length=623

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QL+S  LR  +FQT++ CLRERDLL +F +EV+  Q +GES+E +F  
Sbjct  450  EHMNSSRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQFTSEVAQLQGRGESREISFLQ  509

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMY L +L+ED + LRYGY
Sbjct  510  SHQLAEDLGKAFTEKAILQTILDAEAKLPAGSVKDVLGLVRSMYTLISLEEDPSLLRYGY  569

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +N   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  570  LSRENVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  623



>ref|XP_010475360.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=676

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QL+S  LR  +FQT++ CLRERDLL +F +E++  Q +GES+E +F  
Sbjct  503  EHMNGSRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQFTSEIAQLQGRGESREISFLQ  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGY
Sbjct  563  SHQLAEDLGKAFTEKAILQTILDAEAKLPAGSVKDVLGLVRSMYALISLEEDPSLLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +N   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIAFNW++ANAWSS+
Sbjct  623  LSRENVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANAWSSV  676



>emb|CDY10192.1| BnaC05g04350D [Brassica napus]
Length=677

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QLSS  LR  +FQ ++ CLRERDLL RF +EV+  Q +GES+E +F +
Sbjct  504  EHMNSSRPVLPTQLSSSTLRCSQFQKNVFCLRERDLLERFTSEVAQLQGRGESRESSFLV  563

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +++LAEDLG+AF ++AI QT ++AEA + +  +K+ LGLVRSMYAL +++ED +FLRYGY
Sbjct  564  NHELAEDLGKAFTEKAILQTILDAEAKLPAGSLKDVLGLVRSMYALISIEEDPSFLRYGY  623

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC E+RPHALALV SFGIPDAFL PIAFNW++ANAWSS+
Sbjct  624  LSRDNVGDVRREVSKLCGEVRPHALALVTSFGIPDAFLGPIAFNWVEANAWSSV  677



>ref|XP_008455941.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
melo]
Length=677

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMNE+ PVIPS+L+S  LRS +FQTD  CLRERDLLN  AAEVS   S G SKEYA   
Sbjct  497  EHMNEACPVIPSKLTSSILRSCQFQTDAFCLRERDLLNLLAAEVSRYVSLGNSKEYAIIQ  556

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+ +AEDLGRAF+++AI   F++ E SV S  IKN LGL+RSMYAL  L+EDA+FLRYGY
Sbjct  557  SFLVAEDLGRAFSEKAILLYFIKVENSVPSGSIKNVLGLLRSMYALICLEEDASFLRYGY  616

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS +N A +R+EV KLC E+RPHALALV+SFGIPDAFL+PIA+NW+++N+WSS+
Sbjct  617  LSPENIAAVRQEVKKLCGEIRPHALALVSSFGIPDAFLAPIAYNWVESNSWSSV  670



>ref|XP_006417936.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
 gb|ESQ36289.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
Length=648

 Score =   242 bits (618),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QL+S  LR  +FQ ++  LRERDLL R+ +EV+  Q +GES+E++F +
Sbjct  475  EHMNSSRPVLPTQLTSSTLRCSQFQKNVFSLRERDLLERYTSEVAQLQGRGESREFSFLL  534

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            ++QL+EDL RAF ++AI QTF++AEA + +  IK+ LGLVRSMYAL  L+ED + LRYGY
Sbjct  535  NHQLSEDLSRAFTEKAILQTFLDAEAKIRAGSIKDVLGLVRSMYALICLEEDPSLLRYGY  594

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPDAFL PIAFNW+D NAWSS+
Sbjct  595  LSRDNVGDVRREVSKLCGELRPHALALVTSFGIPDAFLGPIAFNWVDVNAWSSV  648



>gb|KFK42952.1| hypothetical protein AALP_AA1G060500 [Arabis alpina]
Length=675

 Score =   242 bits (618),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN S PV+P+QL+S  LR  +FQ+++ CLRERDLL RF +EV+  Q +GES+E +F +
Sbjct  502  EHMNSSRPVLPTQLTSSTLRCSQFQSNVFCLRERDLLERFTSEVAQLQGRGESRESSFLV  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            ++QLAEDLG+AF ++AI +T ++AE  + +  +K+ LGLVRSMYAL  L+ED + LRYGY
Sbjct  562  THQLAEDLGKAFTEKAILKTILDAEVKLPAGSVKDVLGLVRSMYALICLEEDPSLLRYGY  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC EL+PHALALV+SFGIPDAFLSPIAFNW++ANAWSS+
Sbjct  622  LSRDNVGDVRREVSKLCGELKPHALALVDSFGIPDAFLSPIAFNWVEANAWSSV  675



>gb|EMS62188.1| Acyl-coenzyme A oxidase 3, peroxisomal [Triticum urartu]
Length=349

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PVIP  L+SD LRS +FQ D+ CLRERDLL +FA EV+   +QGES+E A  +
Sbjct  174  EHLNGPCPVIPHSLTSDILRSSKFQMDLFCLRERDLLKQFAEEVARYLAQGESRERALML  233

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDL RAF +R I Q F+E E +  +  +K+ LGL+RSMY +  +DE A+FLRYGY
Sbjct  234  SYQIAEDLARAFTERTILQIFLEDEMNAPAGSLKDVLGLLRSMYVMVCIDESASFLRYGY  293

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN AT+RKEV  LCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA SS
Sbjct  294  LSRDNVATVRKEVMILCSELRPHALAIVDSFGIPDAFLSPLAFDWIEANALSS  346



>ref|XP_006852548.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Amborella 
trichopoda]
 gb|ERN14015.1| hypothetical protein AMTR_s00021p00193270 [Amborella trichopoda]
Length=678

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+NE SPVIPS L+S  LRS +F+  + CLRERDLL RFAAEVS   SQG  KE AF +
Sbjct  503  EHLNEPSPVIPSVLTSSVLRSSQFEVGLFCLRERDLLGRFAAEVSQYMSQGYHKENAFML  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQLAEDL RAF +R I Q  ++ E S+   P+KN LGL+R+MYA+ T++EDA+FL+YGY
Sbjct  563  TYQLAEDLARAFTERTILQYILDVETSMPGGPLKNVLGLLRTMYAVVTIEEDASFLQYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS+ N+ TIRKE+ KLCSELRPH+LALV+SFGIPDA+LSPIAF+WI AN+W+S+
Sbjct  623  LSSANSITIRKELMKLCSELRPHSLALVSSFGIPDAYLSPIAFDWIVANSWASV  676



>ref|XP_008784451.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Phoenix 
dactylifera]
Length=689

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+ SPV+P+ L+S  LRSI FQTD+ CLRERDLLNRFA+EVS  Q+ GESK  A  +
Sbjct  513  EHMNDPSPVVPANLTSCTLRSIMFQTDLFCLRERDLLNRFASEVSQYQNHGESKVNAVNL  572

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAE+L RAF +R I QTF++ E ++ +  +K+  GL+RSMYAL  ++EDA+FLRYGY
Sbjct  573  SYQLAEELARAFTERRILQTFMDTEMTLPAGALKDVFGLLRSMYALICVEEDASFLRYGY  632

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            LS  NAA +RKEV KLC++LRPH LA+V+SFGIPDAFLSPIAF+WI+AN+WS
Sbjct  633  LSLGNAAAVRKEVMKLCTDLRPHVLAVVSSFGIPDAFLSPIAFDWIEANSWS  684



>gb|KHG11955.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=671

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  LR  +FQ D LCLRERDLLNRF A+V   +++GE+ E AF  
Sbjct  499  EHMNKPCPVIPSQLTSTTLRCSQFQMDALCLRERDLLNRFVADVLKCKAKGENTEQAFNT  558

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             Y+LA+DLGRAF++RAIFQ FVEAE+++ +  +KN LG +RS+YA   + ED +FLRYGY
Sbjct  559  CYELAKDLGRAFSERAIFQKFVEAESTLPAGSLKNVLGTLRSLYASICI-EDVSFLRYGY  617

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN A +R+E+ KLC+ELRPHALAL++SFGIPDAFLSPIAFNWID N+WS +
Sbjct  618  LSVDNGANVRREITKLCNELRPHALALISSFGIPDAFLSPIAFNWIDTNSWSLV  671



>ref|XP_009405080.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=683

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  P+IPS L+S  LRS +FQ D+ CLRERDL  R+A EVS  Q+QGE+KE A  +
Sbjct  507  EHMNDPCPIIPSNLNSCTLRSSKFQLDLFCLRERDLFGRYANEVSQYQAQGETKEKAVLL  566

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLA DL RAFA+R+I Q F++ E +  + P+K+ LGL+RSMYAL   +EDA+FLRYGY
Sbjct  567  SYQLAGDLARAFAERSILQIFIDDEMAQPAGPLKDILGLLRSMYALICTEEDASFLRYGY  626

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI*E  321
            LS DNAA  RKEV KLC ELRPHAL++V+SFGIPDAFLSPIAF+WI AN+WSS+ E
Sbjct  627  LSLDNAAVARKEVMKLCYELRPHALSVVSSFGIPDAFLSPIAFDWIQANSWSSLNE  682



>gb|KJB12486.1| hypothetical protein B456_002G020700 [Gossypium raimondii]
Length=672

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  +R  +FQ D LCLRERDLLNRF A V   +++GE+ E AF  
Sbjct  500  EHMNKPCPVIPSQLTSTTVRCSQFQMDALCLRERDLLNRFVANVLKCKAKGENTEQAFNS  559

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             Y+LA+DLGRAF++RAIFQTFVEAE+++ +  +K+ LG +RS+YA   + ED +FLRYGY
Sbjct  560  CYELAKDLGRAFSERAIFQTFVEAESTLPAGSLKDVLGTLRSLYASICI-EDVSFLRYGY  618

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN A +R+E+ KLC+ELRPHALAL++SFGIPDAFLSPIAFNWID N+WS +
Sbjct  619  LSVDNGANVRREITKLCNELRPHALALISSFGIPDAFLSPIAFNWIDTNSWSLV  672



>ref|NP_172120.2| putative acyl-CoA oxidase [Arabidopsis thaliana]
 sp|Q9LMI7.1|ACO32_ARATH RecName: Full=Putative acyl-coenzyme A oxidase 3.2, peroxisomal; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82160.1|AC068143_2 Contains similarity to an acyl-CoA oxidase (ASX2) mRNA from Arabidopsis 
thaliana gb|AF057043 and contains an acyl-CoA oxidase 
PF|01756 domain [Arabidopsis thaliana]
 gb|AEE27973.1| acyl-CoA oxidase [Arabidopsis thaliana]
Length=675

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S  LR  +FQ  + CLRERDLL RF +EV+  Q +GES+E+ F +
Sbjct  502  EHMNSPRPVLPTQLTSSTLRCSQFQKSVFCLRERDLLERFTSEVAELQGRGESREFLFLL  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            ++QL+EDL +AF ++AI QT ++AEA +    +K+ LGLVRSMYAL +L+ED + LRYG+
Sbjct  562  NHQLSEDLSKAFTEKAILQTVLDAEAKLPPGSVKDVLGLVRSMYALISLEEDPSLLRYGH  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +RKEV+KLC ELRPHALALV SFGIPDAFLSPIAFNW++ANAWSS+
Sbjct  622  LSRDNVGDVRKEVSKLCGELRPHALALVASFGIPDAFLSPIAFNWVEANAWSSL  675



>ref|XP_009388733.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=679

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  P+IP+ L+S  LRSI+FQ D+LCLRERDLL R+A+EVS  Q+QGESK+ A  +
Sbjct  503  EHMNDPCPIIPANLTSCTLRSIKFQLDLLCLRERDLLGRYASEVSQYQAQGESKQKAMLL  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLA++L RAF +R I Q F + E + ++ P+K  LGL+RSMYAL  ++EDA+FLRYGY
Sbjct  563  SHQLADELARAFTERTILQIFADDEMTQSAGPLKELLGLLRSMYALICVEEDASFLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS ++AA  RKEV KLC +LRPHAL++V+SFGIPDAFLSPIAF+WI AN+W+S+
Sbjct  623  LSLESAAAARKEVMKLCGDLRPHALSVVSSFGIPDAFLSPIAFDWIQANSWASL  676



>ref|XP_002889598.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65857.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S  LR  +FQ ++ CLRERDLL RF  E++  Q +GES+E++  +
Sbjct  502  EHMNSPRPVLPTQLTSSTLRCSQFQKNVFCLRERDLLERFTCEIAELQGRGESREFSILL  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            ++QL+EDL +AF ++AI QT ++AEA +    +K  LGLVRSMYAL +L+ED + LRYG+
Sbjct  562  NHQLSEDLSKAFTEKAILQTVLDAEAKLPPGSVKEVLGLVRSMYALISLEEDPSLLRYGH  621

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV KLC ELRPHALALV SFGIPDAFLSPIAFNW+ ANAWSS+
Sbjct  622  LSRDNVGDVRREVCKLCGELRPHALALVASFGIPDAFLSPIAFNWVKANAWSSL  675



>ref|XP_002456627.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
 gb|EES01747.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
Length=684

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N S+PVIP +L+S+ LRS +FQ D+ CLRERDLL +FA EVS+  +QGES+E A  +
Sbjct  509  EHLNGSTPVIPDKLTSNILRSSKFQMDLFCLRERDLLKQFAEEVSLHLAQGESREKALML  568

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF +R I Q F+E E +V S  +K  LGL+RS+Y +  +DE  +FLRYGY
Sbjct  569  SYQLAEDLARAFTERTILQIFLEDERNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGY  628

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN A +RKEV K+CSELRPHALA+V+SFGIPDAFLSP+AF+WI+AN  S+
Sbjct  629  LSRDNVALVRKEVLKMCSELRPHALAVVSSFGIPDAFLSPLAFDWIEANTLST  681



>gb|AGT17248.1| acyl-coenzyme A oxidase [Saccharum hybrid cultivar R570]
Length=682

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N SSPV+P +L+S  LRS +FQ D+ CLRERDLL +FA EVS++ +QGES+E A  +
Sbjct  507  EHLNGSSPVMPDKLTSSILRSSKFQMDLFCLRERDLLKQFAEEVSLQLAQGESREKALML  566

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF +R I Q F+E E +V S  +K  LGL+RS+Y +  +DE  +FLRYG+
Sbjct  567  SYQLAEDLARAFTERTILQIFLEDEMNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGH  626

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN A +RKEV K+CSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA S+
Sbjct  627  LSRDNVALVRKEVLKVCSELRPHALAVVSSFGIPDAFLSPLAFDWIEANALST  679



>ref|NP_001152024.1| acyl-coenzyme A oxidase 2 [Zea mays]
 gb|ACG45431.1| acyl-coenzyme A oxidase 2 [Zea mays]
Length=684

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N SSPVIP +L+S  LRS +FQ D+ CLRERDLL +F  EVS+  +QGES+E A  +
Sbjct  509  EHLNGSSPVIPDKLTSSILRSSKFQMDLFCLRERDLLKQFVEEVSLHLAQGESREKALML  568

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDL RAF +R I Q F+E E +V S  +K  LGL+RS+Y +  +DE  +FLRYG+
Sbjct  569  SYQVAEDLARAFTERTILQIFLEDEMNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGH  628

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN A +RKEV KLCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA S+
Sbjct  629  LSRDNVALVRKEVLKLCSELRPHALAVVSSFGIPDAFLSPLAFDWIEANALST  681



>tpg|DAA56859.1| TPA: putative acyl-CoA oxidase family protein [Zea mays]
Length=684

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N SSPVIP +L+S  LRS +FQ D+ CLRERDLL +F  EVS+  +QGES+E A  +
Sbjct  509  EHLNGSSPVIPDKLTSSILRSSKFQMDLFCLRERDLLKQFVEEVSLHLAQGESREKALML  568

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDL RAF +R I Q F+E E +V S  +K  LGL+RS+Y +  +DE  +FLRYG+
Sbjct  569  SYQVAEDLARAFTERTILQIFLEDEMNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGH  628

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN A +RKEV KLCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA S+
Sbjct  629  LSRDNVALVRKEVLKLCSELRPHALAVVSSFGIPDAFLSPLAFDWIEANALST  681



>ref|XP_009119067.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal 
[Brassica rapa]
Length=676

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   PV+P+QL+S ALR   FQ +   +RERDLL R+ +EV   Q +GES+E++F +
Sbjct  503  EHMNSPRPVLPTQLTSSALRCSHFQKNAFSIRERDLLERYTSEVEEIQGKGESREFSFLL  562

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QL EDL +AFA++AI Q  ++AEA +     K+ LG+VRSMYAL  ++ED +FLRYGY
Sbjct  563  SHQLYEDLSKAFAEKAILQAVLDAEAKLPIGSTKDVLGIVRSMYALICMEEDPSFLRYGY  622

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DN   +R+EV+KLC ELRPHALALV SFGIPDAFL PIAFNW++ANAWSS+
Sbjct  623  LSRDNVGDVRREVSKLCGELRPHALALVTSFGIPDAFLGPIAFNWVEANAWSSV  676



>emb|CDY57822.1| BnaA10g28090D [Brassica napus]
Length=675

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 136/173 (79%), Gaps = 1/173 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQ-TDILCLRERDLLNRFAAEVSVRQSQGESKEYAFA  672
            EHMN   PV+P+QL+S  LR   FQ  ++ CLRERDLL R+  EV+  Q +G+S+E++F 
Sbjct  503  EHMNSPRPVLPTQLTSSTLRCSHFQQKNVFCLRERDLLERYTCEVAELQERGKSREFSFL  562

Query  671  MSYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYG  492
            +S+QL+EDL +AFA++AI Q  ++AEA + +  IK+ +GLVRSMYAL  ++ED +FLRYG
Sbjct  563  LSHQLSEDLSKAFAEKAILQAVLDAEAKLPAGSIKDVVGLVRSMYALICMEEDPSFLRYG  622

Query  491  YLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            YLS D+   +R+EV+KLC ELRPHALALV SFGIPDAFL PIAFNWI+ANAWS
Sbjct  623  YLSRDSVGDVRREVSKLCRELRPHALALVTSFGIPDAFLGPIAFNWIEANAWS  675



>ref|XP_004965421.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Setaria 
italica]
Length=687

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N  SPVIP +L+   LRS +FQ D+ CLRERDLL +FA EVS+  ++GES+E A  +
Sbjct  512  EHLNGPSPVIPDKLTGSILRSSKFQMDLFCLRERDLLKQFAEEVSLHLARGESREKALML  571

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            S+QLAEDL RAF +R I Q F+E E +V S  +K  LGL+RS+Y + ++DE A+FLRYGY
Sbjct  572  SFQLAEDLARAFTERTILQIFLEDEMNVPSGSLKELLGLLRSLYVMVSIDESASFLRYGY  631

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS  N A +RKEV KLCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA S+
Sbjct  632  LSRGNVAGVRKEVLKLCSELRPHALAVVSSFGIPDAFLSPLAFDWIEANALST  684



>gb|EMT28672.1| Acyl-coenzyme A oxidase 3, peroxisomal [Aegilops tauschii]
Length=594

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 131/173 (76%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PVIP  L+S  LRS +FQ D+ CLRERDLL +FA EV+   +QGES+E A  +
Sbjct  419  EHLNGPCPVIPHSLTSVILRSSKFQMDLFCLRERDLLKQFAEEVARHLAQGESRERALML  478

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDL RAF +R I Q F+E E +  +  +K+ L L+RSMY +  +DE A+FLRYGY
Sbjct  479  SYQIAEDLARAFTERTILQIFLEDEMNAPAGSLKDVLVLLRSMYVMVCIDESASFLRYGY  538

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN  T+RKEV  LCSELRPHALA+V SFGIPDAFLSP+AF+WI+ANA SS
Sbjct  539  LSRDNVTTVRKEVMILCSELRPHALAIVGSFGIPDAFLSPLAFDWIEANALSS  591



>emb|CDY10194.1| BnaC05g04370D [Brassica napus]
Length=674

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQ-TDILCLRERDLLNRFAAEVSVRQSQGESKEYAFA  672
            EHMN   PV+P+QL+S  LR   FQ  ++ CLRERDLL R+  EV+  Q +GES+E +F 
Sbjct  502  EHMNSPLPVLPTQLTSSTLRCSHFQQKNVFCLRERDLLERYTCEVAELQERGESRELSFL  561

Query  671  MSYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYG  492
            +S+QL+EDL +AFA++AI Q  ++AEA + +  IK+ +GLVRSMYAL  ++ED +FLRYG
Sbjct  562  LSHQLSEDLSKAFAEKAILQAVLDAEAKLPAGSIKDVVGLVRSMYALICMEEDPSFLRYG  621

Query  491  YLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            Y S D+   +R+EV+KLC ELRPHALALV SFGIPDAFL PIAFNWI+ANAWS
Sbjct  622  YHSRDSVGDVRREVSKLCIELRPHALALVTSFGIPDAFLGPIAFNWIEANAWS  674



>ref|XP_003573815.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Brachypodium 
distachyon]
Length=686

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 131/173 (76%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   P+IP  L+S  LRS +FQ D+ CLRER+LL +F  +VS   +QGES+E A  +
Sbjct  511  EHLNGPCPIIPDSLTSGILRSSKFQMDLFCLRERNLLKQFTEDVSHHLAQGESREKALML  570

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQ+AEDL RAF +R I Q F+E E +  +  +K+ LGL+RSMY +  +DE A+FLRYGY
Sbjct  571  SYQIAEDLARAFTERTILQIFLEDEMNATAGSLKDVLGLLRSMYVMTCIDESASFLRYGY  630

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS DN AT+RKEV  LCS LRPH LA+V+SFGIPDAFLSP+AF+WI+ANA SS
Sbjct  631  LSRDNVATVRKEVMTLCSNLRPHVLAIVSSFGIPDAFLSPLAFDWIEANALSS  683



>gb|EAZ36947.1| hypothetical protein OsJ_21282 [Oryza sativa Japonica Group]
Length=685

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 131/173 (76%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PVIP  L+S  LRS  FQ D+LCLRERDLL RF  EVS   +QGE++E A  +
Sbjct  510  EHLNGPCPVIPDYLTSGTLRSSSFQMDLLCLRERDLLKRFTTEVSNYLAQGENREKALML  569

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF +R I Q F+E E ++ +  +K+ LGL+RS+Y +  +DE A+FLRYG 
Sbjct  570  SYQLAEDLARAFTERTILQIFLEDEKNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGC  629

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS +N A  RKEV  LCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA SS
Sbjct  630  LSRENVAAARKEVMTLCSELRPHALAIVSSFGIPDAFLSPLAFDWIEANARSS  682



>gb|EAZ00875.1| hypothetical protein OsI_22900 [Oryza sativa Indica Group]
Length=688

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 131/173 (76%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PVIP  L+S  LRS  FQ D+LCLRERDLL RF  EVS   +QGE++E A  +
Sbjct  513  EHLNGPCPVIPDYLTSGTLRSSSFQMDLLCLRERDLLKRFTTEVSNYLAQGENREKALML  572

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF +R I Q F+E E ++ +  +K+ LGL+RS+Y +  +DE A+FLRYG 
Sbjct  573  SYQLAEDLARAFTERTILQIFLEDEKNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGC  632

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS +N A  RKEV  LCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA SS
Sbjct  633  LSRENVAAARKEVMTLCSELRPHALAIVSSFGIPDAFLSPLAFDWIEANARSS  685



>gb|ACN41105.1| unknown [Picea sitchensis]
Length=680

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN + P+IP+ L S  LR+I FQ DI  LRERDLL R AAE+S   SQG +   AF M
Sbjct  505  EHMNNNRPIIPAILDSSTLRNIEFQMDIFHLRERDLLERLAAEISQCVSQGTTTAVAFTM  564

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SY+LAEDLGRAF++RA+  +F+ AE  + +  +K+ LGL+R++YAL TL+ED +FLRYGY
Sbjct  565  SYELAEDLGRAFSERAVLDSFILAETKLAAGSMKDILGLLRTIYALITLEEDISFLRYGY  624

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS   +   RKE+AKLC+ELRPHAL+LV+SFGIP  +LSPIAF+WI+AN+W+++
Sbjct  625  LSPQQSQMGRKEIAKLCNELRPHALSLVDSFGIPQPYLSPIAFDWIEANSWAAV  678



>ref|NP_001057591.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAD35410.1| putative acyl-CoA oxidase ACX3 [Oryza sativa Japonica Group]
 dbj|BAF19505.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAG90186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=685

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 131/173 (76%), Gaps = 0/173 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PVIP  L+S  LRS  FQ D+LCLRERDLL RF  EVS   +QGE++E A  +
Sbjct  510  EHLNGPCPVIPDYLTSGTLRSSSFQMDLLCLRERDLLKRFTTEVSNYLAQGENREKALML  569

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF +R I Q F+E E ++ +  +K+ LGL+RS+Y +  +DE A+FLRYG 
Sbjct  570  SYQLAEDLARAFTERTILQIFLEDEKNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGC  629

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSS  330
            LS +N A  RKEV  LCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA SS
Sbjct  630  LSRENVAAARKEVMTLCSELRPHALAIVSSFGIPDAFLSPLAFDWIEANARSS  682



>ref|XP_006656066.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like, partial 
[Oryza brachyantha]
Length=647

 Score =   218 bits (554),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N   PVIP  L+S  LRS  FQ D+LCLRERDLL +F  EVS   +QG+S+E A  +
Sbjct  472  EHLNGPCPVIPDYLTSGILRSSNFQMDLLCLRERDLLKQFTTEVSNHLAQGKSREKALML  531

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDL RAF +R I Q F+E E ++ +  +K+ LGL+RS+Y +  +DE A+FLRYG 
Sbjct  532  SYQLAEDLARAFTERTILQIFLEDEKNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGC  591

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            LS +N A  RKEV  LCSELRPHALA+V+SFGIPDAFLSP+AF+WI+ANA S
Sbjct  592  LSKENVAAARKEVMTLCSELRPHALAIVSSFGIPDAFLSPLAFDWIEANARS  643



>ref|XP_007043727.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
 gb|EOX99558.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
Length=642

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 117/174 (67%), Gaps = 35/174 (20%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIPSQL+S  LR  +FQ D LCLRERDLL  F  +VS  Q++GESKE+AF M
Sbjct  502  EHMNKPCPVIPSQLTSATLRCSQFQMDALCLRERDLLKCFVLDVSQHQAKGESKEHAFIM  561

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
                                              + LG++RS+YAL  + ED AFLRYGY
Sbjct  562  ----------------------------------DVLGMLRSLYALICI-EDVAFLRYGY  586

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNAA +R+E+ K+CSELRPHALALV+SFGIPDAFLSP+AFNWIDAN+WSS+
Sbjct  587  LSVDNAAAVRREITKVCSELRPHALALVSSFGIPDAFLSPVAFNWIDANSWSSV  640



>ref|XP_010038681.1| PREDICTED: putative acyl-coenzyme A oxidase At3g06690 [Eucalyptus 
grandis]
Length=140

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 113/172 (66%), Gaps = 34/172 (20%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            MN   PV+  QL S  LRS +FQ D   +RERDLLNRFA E+  RQ++GE KE+A     
Sbjct  1    MNGPCPVLLQQLPSTVLRSGQFQVDAFHVRERDLLNRFAEEILQRQARGERKEHAL----  56

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLS  483
                                          + + L L+RSMYAL  +++DA+FLRYGYLS
Sbjct  57   ------------------------------LSDMLALLRSMYALTCMEDDASFLRYGYLS  86

Query  482  TDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            T+NAA +RKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNW++AN+W S+
Sbjct  87   TENAADVRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWVEANSWFSV  138



>ref|XP_002994091.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
 gb|EFJ04838.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
Length=678

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 115/171 (67%), Gaps = 3/171 (2%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMNE  P I +  +   +R ++FQ  +  LRERDLL + A +V    S+G +   A   
Sbjct  504  EHMNEPPPTIGTNAN---VRDVKFQLALFRLRERDLLVKLAQQVRELVSKGSTMANATLA  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF++R++ ++ +  E S+   P K  LGL+RS++   T+DED  FLR+ Y
Sbjct  561  SYQLAEDLGRAFSERSVLESILSVENSLAPSPEKTILGLLRSLFVATTVDEDPVFLRHSY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAW  336
            LS D A +I+KEVA LC E+RP  L+LV++FGIP  FL PIAF+WI AN+W
Sbjct  621  LSPDQALSIQKEVASLCREIRPFILSLVDAFGIPAPFLGPIAFDWIAANSW  671



>emb|CBI36628.3| unnamed protein product [Vitis vinifera]
Length=128

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -2

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF+DRAI QTF++AE +V+S  +K+ L L+RSM+ L  L+E A+FLRYGY
Sbjct  5    SYQLAEDLGRAFSDRAILQTFLDAEVAVSSSLLKSMLSLLRSMHVLIILEECASFLRYGY  64

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            LS DNA  IRKEV  LCSELRPHALALV+SFGIP+AF SPIAFNWI+AN+WSS+
Sbjct  65   LSPDNAVGIRKEVTILCSELRPHALALVSSFGIPNAFFSPIAFNWINANSWSSV  118



>ref|XP_002985513.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
 gb|EFJ13387.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
Length=678

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 113/171 (66%), Gaps = 3/171 (2%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN   P I +  +   +R + FQ  +  LRERDLL + A +V    S+G +   A   
Sbjct  504  EHMNGPPPTIGTNAN---VRDVTFQLALFRLRERDLLVKLAQQVRELVSKGSTMANATLA  560

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLGRAF++R++ ++ +  E S+   P K  LGL+RS++   T+DED  FLR+ Y
Sbjct  561  SYQLAEDLGRAFSERSVLESILSVENSLAPSPEKTILGLLRSLFVATTVDEDPVFLRHAY  620

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAW  336
            LS D A +I+KEVA LC E+RP  L+LV++FGIP  FL PIAF+WI AN+W
Sbjct  621  LSPDQALSIQKEVASLCREIRPFILSLVDAFGIPAPFLGPIAFDWIAANSW  671



>emb|CDY57819.1| BnaA10g28070D [Brassica napus]
Length=253

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 107/170 (63%), Gaps = 26/170 (15%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM-  669
            HMN   PV+P+QL+S ALR   FQ +   +RERDLL R+ +E           ++ F + 
Sbjct  95   HMNSPRPVLPTQLTSSALRCSHFQKNAFSIRERDLLERYTSE-----------KFTFLLI  143

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             +QL+EDL +AFA++ I Q  ++A   +    IK+ LG+ R MYAL  ++ED +FLR   
Sbjct  144  CHQLSEDLSKAFAEKTILQAVLDAITKLPIGSIKDVLGIARLMYALICMEEDPSFLR---  200

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANA  339
                       EV+KLC ELRPHALALV SFGIPDAFL PIAFNW++ANA
Sbjct  201  -----------EVSKLCRELRPHALALVTSFGIPDAFLGPIAFNWVEANA  239



>emb|CAN66151.1| hypothetical protein VITISV_035129 [Vitis vinifera]
Length=272

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 102/146 (70%), Gaps = 19/146 (13%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            MN+S PV+PSQL+S  LRS +FQT+I CLRERDLL  FAAE+S  Q+ G S+EYA     
Sbjct  1    MNKSCPVVPSQLTSSTLRSSQFQTNIFCLRERDLLIHFAAEISQLQAHGLSREYA-----  55

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLS  483
                          + Q F++AEA+V+S P+K+ L L+RSM+ L  L+EDA+FLRYGYLS
Sbjct  56   --------------LLQIFLDAEAAVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGYLS  101

Query  482  TDNAATIRKEVAKLCSELRPHALALV  405
             DNAA I K+V  L SELRPHALAL+
Sbjct  102  PDNAAGISKKVTILYSELRPHALALL  127



>gb|AAG50996.1|AC036106_9 unknown protein; 4820-5433 [Arabidopsis thaliana]
Length=98

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = -2

Query  620  IFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKL  441
            + QT ++AEA + +  +K+ LGLVRSMYAL +L+ED + LRYGYLS DN   +R+EV+KL
Sbjct  1    MLQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKL  60

Query  440  CSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            C ELRPHALALV SFGIPD+FLSPIAFNW++AN WSS+
Sbjct  61   CGELRPHALALVTSFGIPDSFLSPIAFNWVEANTWSSV  98



>ref|XP_001772379.1| predicted protein [Physcomitrella patens]
 gb|EDQ62850.1| predicted protein [Physcomitrella patens]
Length=678

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 116/174 (67%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N S+PV+P +L+  ALR  +FQ  +  LRER LL    ++V+    +G S   A   
Sbjct  505  EHINGSAPVVPEELNRSALRDSKFQLALFQLRERGLLELLTSQVTTLVLKGVSMTDAVIS  564

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
             YQ+AEDLG+AF++R++ ++F++ E       +K+ LGL+RS+Y L + DE   FLRYGY
Sbjct  565  GYQVAEDLGQAFSERSVLESFLKVEQQTTG-SMKDILGLLRSLYVLSSADETPVFLRYGY  623

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            L+   +  I  EV  LC ELRP AL LV++FGIP AFL PIAF+W++ N+WS++
Sbjct  624  LTPKQSQLIHTEVDSLCGELRPQALNLVDAFGIPQAFLGPIAFDWVEYNSWSNV  677



>ref|XP_001759376.1| predicted protein [Physcomitrella patens]
 gb|EDQ75678.1| predicted protein [Physcomitrella patens]
Length=680

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 111/174 (64%), Gaps = 1/174 (1%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EH+N  + VIP  L+   LR  +FQ  +  LRER LL   +++VS   S+G S   A   
Sbjct  507  EHINGPALVIPEDLTRSVLRDSKFQLALFQLRERGLLELLSSQVSSLVSKGVSMADAVIS  566

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            SYQLAEDLG+AF++R+I ++ + AE        K  LGL+RS+Y L   DE   FLRYGY
Sbjct  567  SYQLAEDLGQAFSERSILESVLRAEQQTTG-STKEVLGLLRSLYVLSAADEGPVFLRYGY  625

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            L    +  I  EVA LC ELRP A+ LV++FGIP AFL PIAF+W++ N+W+++
Sbjct  626  LLPKQSQLISTEVASLCGELRPQAVNLVDAFGIPQAFLGPIAFDWVEYNSWNNV  679



>ref|XP_011466939.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=596

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAM  669
            EHMN+  PVIP  L+S  L+SI FQ D  CLRERDLLNRFA EVS RQ QGESKEY+  +
Sbjct  498  EHMNKPCPVIPPHLTSSTLQSIEFQMDAFCLRERDLLNRFALEVSQRQKQGESKEYSVLL  557

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGL  552
            SYQLAEDLGRAF+DR I QTF++ EA+V +  +KN L +
Sbjct  558  SYQLAEDLGRAFSDRTILQTFIDVEATVPAGSLKNVLAM  596



>emb|CAN66343.1| hypothetical protein VITISV_040587 [Vitis vinifera]
Length=82

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -2

Query  542  MYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIA  363
            M+ L  L+EDA+FLRYGYLS DNAA IRKEV  LCSELRPHALALV+SFGI DAFLSPIA
Sbjct  1    MHVLIILEEDASFLRYGYLSPDNAAGIRKEVTILCSELRPHALALVSSFGILDAFLSPIA  60

Query  362  FNWIDANAWSSI  327
            FNWIDAN+WSS+
Sbjct  61   FNWIDANSWSSV  72



>emb|CAN77404.1| hypothetical protein VITISV_009474 [Vitis vinifera]
Length=75

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  542  MYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIA  363
            M+ L  L+ED +FLRYGYLS DNAA IRKEV  LCSELRPHALALV+SFGIPDA LSPIA
Sbjct  1    MHVLIILEEDVSFLRYGYLSPDNAAGIRKEVTILCSELRPHALALVSSFGIPDALLSPIA  60

Query  362  FNWIDANAWSSI  327
            FNWIDAN+WS +
Sbjct  61   FNWIDANSWSLV  72



>gb|AAF63829.1| hypothetical protein [Arabidopsis thaliana]
Length=72

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  542  MYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIA  363
            MYAL +L+ED + LRYGYLS DN   +R+EV+KLC ELRPHALALV SFGIPD+FLSPIA
Sbjct  1    MYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIA  60

Query  362  FNWIDANAWSSI  327
            FNW++AN WSS+
Sbjct  61   FNWVEANTWSSV  72



>emb|CDP21363.1| unnamed protein product [Coffea canephora]
Length=71

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 3/72 (4%)
 Frame = -2

Query  542  MYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIA  363
            MYAL TL+ED+AFLRYG+LS DNAA +RKEVAK   + RPHAL+LV+SFGIPDAFLSPIA
Sbjct  1    MYALVTLEEDSAFLRYGFLSVDNAAAVRKEVAK---QSRPHALSLVSSFGIPDAFLSPIA  57

Query  362  FNWIDANAWSSI  327
            FNW++ N+WSS+
Sbjct  58   FNWLETNSWSSV  69



>emb|CBI39134.3| unnamed protein product [Vitis vinifera]
Length=84

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -2

Query  668  SYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGY  489
            +YQL EDLGRAF+DRAI  TF++ EA+V+S P+K+ L L+RSM+ L  L+EDA+FLRYGY
Sbjct  5    NYQLVEDLGRAFSDRAILHTFLDVEATVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGY  64

Query  488  LSTDNAATIRKEVAKLCSEL  429
            LS DNAA IRKEV  LCSEL
Sbjct  65   LSPDNAAGIRKEVTILCSEL  84



>gb|AEW08613.1| hypothetical protein CL814Contig1_06, partial [Pinus radiata]
 gb|AFB34598.1| hypothetical protein CL814Contig1_06, partial [Pinus mugo]
 gb|AFB34599.1| hypothetical protein CL814Contig1_06, partial [Pinus mugo]
 gb|AFG46042.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46043.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46044.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46045.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46046.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46047.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46048.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46049.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46050.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46051.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46052.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46053.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46054.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46055.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46056.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46057.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46058.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46059.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
Length=66

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -2

Query  569  KNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGI  390
            K+ +GL+R+ YAL TL+ED AFLRYGYLS   +  IRKE+AKLC ELRPHALALV+SFGI
Sbjct  1    KDIIGLLRNTYALITLEEDIAFLRYGYLSPQQSQMIRKEIAKLCDELRPHALALVDSFGI  60

Query  389  PDAFLS  372
            P  +LS
Sbjct  61   PQPYLS  66



>emb|CBI31502.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            MN+S PV+PSQL+S  LRS +FQTDI CLRE+DLL  FAAE+S  Q+ G S+EYA   SY
Sbjct  1    MNKSCPVVPSQLTSSTLRSSQFQTDIFCLREQDLLIHFAAEISQLQAHGLSREYALLQSY  60

Query  662  QLAEDLGRAF  633
            QLAEDLGR+F
Sbjct  61   QLAEDLGRSF  70



>emb|CBI24556.3| unnamed protein product [Vitis vinifera]
 emb|CBI24557.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            MN+S PV+PSQL+S  LRS +FQT+I CLRERDLL  FAAE+S  Q+ G S+EYA   SY
Sbjct  1    MNKSCPVVPSQLTSSTLRSSQFQTNIFCLRERDLLIHFAAEISQLQAHGLSREYALLQSY  60

Query  662  QLAEDLGRAF  633
            QLAEDLGR+F
Sbjct  61   QLAEDLGRSF  70



>ref|XP_005707013.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 ref|XP_005707014.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
 gb|EME30493.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 gb|EME30494.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
Length=640

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 99/176 (56%), Gaps = 6/176 (3%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMS  666
            +MN+ S  +  +L  D +RSI F   IL   E  L+   A EV+ R  QG+S    +   
Sbjct  468  YMNDQS-FLTGRLPED-IRSITFSRLILQRLESKLVASLAKEVAKRSKQGKSSFEVWNEC  525

Query  665  YQLAEDLGRAFADRAIFQ---TFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRY  495
              LA ++GRA  +  I +     +E +AS   +  +N L   ++++ L  +D+ + FLRY
Sbjct  526  LDLAAEVGRAHTELLIAELSEKLIE-QASQTDLSTRNILKQCQTLFLLHLIDKQSCFLRY  584

Query  494  GYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
              LS ++A  + + V +LC +LR  AL LV+SFGIP   L+PIAF+WI+ N+ S +
Sbjct  585  NCLSPEDAQRLHRVVVELCMQLREQALPLVDSFGIPPHLLAPIAFDWIEHNSRSKL  640



>ref|XP_005712269.1| unnamed protein product [Chondrus crispus]
 emb|CDF77395.1| unnamed protein product [Chondrus crispus]
Length=672

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 88/176 (50%), Gaps = 3/176 (2%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMS  666
            ++N+   +    LS+   RS  +   ++  RE  L  R AAE+  + + G S   AF  S
Sbjct  497  YLNDREALRRVDLSTTDPRSAMYALTVMRRREAALFARLAAEIQKKIAAGMSSLQAFNHS  556

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNS---IPIKNALGLVRSMYALFTLDEDAAFLRY  495
              L ED GRA  D  + Q F +  + + S     + N L L  +++    +D    FLR 
Sbjct  557  AVLVEDAGRAHVDLLMLQLFHQTLSDLKSRGETELVNILTLCGALHTARLIDSQVIFLRN  616

Query  494  GYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
            G LS  +A  +   V   C +LRPH L LV+SFG P   L+PIAF+++  N+ S +
Sbjct  617  GALSAKDAQNVHSNVQIFCMQLRPHVLHLVDSFGYPPHLLAPIAFDYVSHNSRSRL  672



>gb|AAB97825.1| acyl-CoA oxidase [Myxococcus xanthus DK 1622]
Length=433

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            + +P    +  SD LR   +    L  RE +LL   +  +  R S G     AF      
Sbjct  268  DRNPFAARRTDSDHLRDNDYHLRALRFREEELLATVSQRIRKRLSAGVEAFEAFNQVQVH  327

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE-DAAFLRYGYLST  480
              +L  A  +R + + F++  A V    +K  LG +  +Y L  L+  +  F  +G+L  
Sbjct  328  LLELAHAHVERLVLEQFLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEG  387

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                 IRKEV +LC+ELRP A+ALVN+FG+PD  L +PI   
Sbjct  388  TKVKAIRKEVTRLCAELRPDAVALVNAFGVPDTCLAAPIGLG  429



>ref|XP_005712968.1| acyl-CoA oxidase [Chondrus crispus]
 ref|XP_005712969.1| Acyl-COA oxydase [Chondrus crispus]
 emb|CDF33165.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF33166.1| Acyl-COA oxydase [Chondrus crispus]
Length=672

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 79/164 (48%), Gaps = 3/164 (2%)
 Frame = -2

Query  809  LSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFA  630
            LS    RS  F   ++  RE  L  R AA++  R + G S   AF     L ED GRA  
Sbjct  509  LSGMDARSAAFALTVMRRREAALFARLAADLQKRTATGVSSLQAFNDCAVLVEDAGRAHV  568

Query  629  DRAIFQTFVEAEASV---NSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAATIR  459
            +  + + F      +       + + L L  +++   T+DE   FLR G +S   A  + 
Sbjct  569  ELLMVELFHHTLGDLQRGGETEVADMLRLCGALHTARTVDEQVVFLRCGAVSVGEAQMMH  628

Query  458  KEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
              V + C  LRPH L+LV SFG P   L+PIAF+++  N+ S +
Sbjct  629  ANVGRFCETLRPHVLSLVESFGYPPHLLAPIAFDYVAHNSKSRL  672



>gb|ABF87186.1| putative acyl-CoA dehydrogenase [Myxococcus xanthus DK 1622]
Length=660

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            + +P    +  SD LR   +    L  RE +LL   +  +  R S G     AF      
Sbjct  495  DRNPFAARRTDSDHLRDNDYHLRALRFREEELLATVSKRIRKRLSAGVEAFEAFNQVQVH  554

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE-DAAFLRYGYLST  480
              +L  A  +R + + F++  A V    +K  LG +  +Y L  L+  +  F  +G+L  
Sbjct  555  LLELAHAHVERLVLEQFLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEG  614

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                 IRKEV +LC+ELRP A+ALVN+FG+PD  L +PI   
Sbjct  615  TKVKAIRKEVTRLCAELRPDAVALVNAFGVPDTCLAAPIGLG  656



>ref|WP_020478009.1| acyl-CoA dehydrogenase [Myxococcus xanthus]
Length=777

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            + +P    +  SD LR   +    L  RE +LL   +  +  R S G     AF      
Sbjct  612  DRNPFAARRTDSDHLRDNDYHLRALRFREEELLATVSKRIRKRLSAGVEAFEAFNQVQVH  671

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE-DAAFLRYGYLST  480
              +L  A  +R + + F++  A V    +K  LG +  +Y L  L+  +  F  +G+L  
Sbjct  672  LLELAHAHVERLVLEQFLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEG  731

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                 IRKEV +LC+ELRP A+ALVN+FG+PD  L +PI   
Sbjct  732  TKVKAIRKEVTRLCAELRPDAVALVNAFGVPDTCLAAPIGLG  773



>ref|WP_015352554.1| acyl-CoA dehydrogenase [Myxococcus stipitatus]
 gb|AGC48300.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=780

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 80/164 (49%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            M + +P    +  S+ LR   FQ  +L  RE DLL   A  +  R + G     AF    
Sbjct  613  MADRNPFAARRTDSEHLRDGDFQLRLLRYREEDLLASVAKRLRKRMAAGVEAFTAFNQVQ  672

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLR-YGYL  486
                 L  A  +R + + F+     V    +K  LG +  +Y L  L+  + + + +G +
Sbjct  673  AHLVALSEAHVERVVLEQFLLGVEKVQDPGLKTVLGRLCDLYGLSCLESGSGWFQEHGLV  732

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                A  IRKEV KLC+ELRP A+ALV++FGIPD  L +PI   
Sbjct  733  EASKALAIRKEVVKLCTELRPDAVALVDAFGIPDTCLAAPIGLG  776



>ref|WP_013062161.1| acyl-CoA oxidase [Salinibacter ruber]
 emb|CBH24828.1| acyl-Coenzyme A oxidase [Salinibacter ruber M8]
Length=768

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 77/163 (47%), Gaps = 2/163 (1%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMS  666
             + E +PV+      D LR++ FQ   L  R    L      +  R   G     AF   
Sbjct  598  QVQELNPVVTRTTDPDHLRALPFQQSALTYRAEKQLQNVGRRLQRRIDDGMEPFDAFVDV  657

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGY  489
                    RA A+R I + F +A   V    ++  L  +R ++AL  ++ D   FL  GY
Sbjct  658  QDHLVQCARADAERVILERFADAVEGVEDADLRETLTTLRRLFALSRIEADLDWFLEAGY  717

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            +S   A  IR  V  LC E+RP A ALVN+FGIPDA L +PIA
Sbjct  718  VSGSKAKAIRGAVNDLCDEVRPQAEALVNAFGIPDALLGAPIA  760



>ref|WP_011404446.1| acyl-CoA oxidase [Salinibacter ruber]
 ref|YP_445820.1| acyl-coenzyme A oxidase I [Salinibacter ruber DSM 13855]
 gb|ABC46051.1| acyl-coenzyme A oxidase I, putative [Salinibacter ruber DSM 13855]
Length=786

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 77/163 (47%), Gaps = 2/163 (1%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMS  666
             + E +PV+      D LR++ FQ   L  R    L      +  R   G     AF   
Sbjct  616  QVQELNPVVTRTTDPDHLRALPFQQSALTYRAEKQLQNVGRRLQRRIDDGMEPFDAFVDV  675

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGY  489
                    RA A+R I + F +A   V    ++  L  +R ++AL  ++ D   FL  GY
Sbjct  676  QDHLVQCARADAERVILERFADAVEGVEDADLRETLTTLRRLFALSRIEADLDWFLEAGY  735

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            +S   A  IR  V  LC E+RP A ALVN+FGIPDA L +PIA
Sbjct  736  VSGSKAKAIRGAVNDLCDEVRPQAEALVNAFGIPDALLGAPIA  778



>ref|WP_020534466.1| hypothetical protein [Lewinella cohaerens]
Length=769

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 86/165 (52%), Gaps = 6/165 (4%)
 Frame = -2

Query  839  NESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYA--FAMS  666
            +E++P          LRS  FQ      RER LL   A  +      G+S   A     +
Sbjct  607  SETNPFAIRNTDGGHLRSTEFQLAAFQFRERRLLFSLAQRLRGHIKDGKSAYEAGLICQT  666

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGY  489
            + LA  L  AF +R   ++  +A +      I N L  +RS+YAL T+++ AA +L   Y
Sbjct  667  HMLA--LAEAFIERVTLESTAKAVSEAKGTSIYNILRKLRSLYALHTIEKHAAWYLEQDY  724

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
            L+   +  IRK+V +LC ELRP A+ALV +FGIP++ + +PI  +
Sbjct  725  LAGTKSKAIRKQVDQLCGELRPEAVALVEAFGIPESLIAAPIVMD  769



>ref|XP_004365565.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89168.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
Length=705

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -2

Query  791  RSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQ  612
            R+  FQ  I  +RE D + R  A +S +++ G + + A+ +  +LA   G+A+ +R +  
Sbjct  538  RNAEFQMRIFEIREYDAIKRLIAALSAKKAAGHNDDSAWNLCGELAAVCGQAYIERFVLT  597

Query  611  TFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSE  432
             F+E   + +S P +  L  +R+++A++ +    +FL Y ++   +   +  EV  + +E
Sbjct  598  RFIEDIQTESSAPERLVLEKLRALHAMWRITTQPSFLAYQFIPRQDIEIMADEVNVILAE  657

Query  431  LRPHALALVNSFGIPDAFLSPIAFNWIDANAWS  333
            LRPH   LV +FG+P   L  I  +++ A++W+
Sbjct  658  LRPHLANLVKAFGVPQHLLPAITSDYVAAHSWA  690



>ref|WP_043324301.1| acyl-CoA oxidase, partial [Corallococcus coralloides]
Length=781

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 78/163 (48%), Gaps = 2/163 (1%)
 Frame = -2

Query  839  NESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQ  660
             + +P+   +  +D LR   FQ   L  RE  LL   +  +  R + G     AF     
Sbjct  615  TDRNPIAGRRTDTDHLRDSDFQLRALRFREEALLASVSKRIRKRLTAGVEAFEAFNQVQA  674

Query  659  LAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLS  483
                L  A  +R + + F+   A V    +K  LG +  ++ L  L+  +  FL +G+L+
Sbjct  675  HLLALAHASVERIVLEQFLRGVADVKDEALKPVLGRMADLFGLSCLESASGWFLEHGWLT  734

Query  482  TDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
               A  IRKE  KLC ELRP A+ LV++FGIPD  L +PI   
Sbjct  735  APKAQAIRKERVKLCEELRPDAVGLVDAFGIPDTCLAAPIGLG  777



>gb|AFE09438.1| putative acyl-CoA dehydrogenase [Corallococcus coralloides DSM 
2259]
Length=804

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 78/163 (48%), Gaps = 2/163 (1%)
 Frame = -2

Query  839  NESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQ  660
             + +P+   +  +D LR   FQ   L  RE  LL   +  +  R + G     AF     
Sbjct  615  TDRNPIAGRRTDTDHLRDSDFQLRALRFREEALLASVSKRIRKRLTAGVEAFEAFNQVQA  674

Query  659  LAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLS  483
                L  A  +R + + F+   A V    +K  LG +  ++ L  L+  +  FL +G+L+
Sbjct  675  HLLALAHASVERIVLEQFLRGVADVKDEALKPVLGRMADLFGLSCLESASGWFLEHGWLT  734

Query  482  TDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
               A  IRKE  KLC ELRP A+ LV++FGIPD  L +PI   
Sbjct  735  APKAQAIRKERVKLCEELRPDAVGLVDAFGIPDTCLAAPIGLG  777



>ref|WP_022834726.1| acyl-CoA oxidase [Salisaeta longa]
Length=758

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 78/162 (48%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P++     ++ LR    Q D L  RER L+   A  +  R   G +   AF    
Sbjct  596  VTEMNPIVKRATDTEHLREADMQGDALRFRERALVQSAAQRLKHRMDNGAAPFDAFVEVQ  655

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLD-EDAAFLRYGYL  486
                 L  A A+R +F+ FV+  A+V     ++ L  +R +Y L  L+   A FL  GY 
Sbjct  656  DHLLTLAHAHAERVVFERFVDRIATVEDASSRSVLNTIRCLYGLHRLEAHRAWFLEKGYF  715

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                +  IR EV  LC E+RP A AL +++ IP   L +PIA
Sbjct  716  EAPKSKAIRTEVNTLCGEIRPWARALTDAWQIPSGALQAPIA  757



>ref|WP_043394213.1| acyl-CoA oxidase [Cystobacter violaceus]
 gb|KFA92834.1| acyl-CoA oxidase [Cystobacter violaceus Cb vi76]
Length=779

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 78/164 (48%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + + +P    +  S+ LR   FQ   L  RE DLL   A  +  R S G     AF    
Sbjct  612  LGDRNPFSVRRTGSEHLRDGDFQLRALRFRESDLLASAARRLRERLSAGVDSFEAFNQCQ  671

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTL-DEDAAFLRYGYL  486
                 L  A  +R + + F+   A V    +K  LG +  +Y L  L D    FL   ++
Sbjct  672  DHLLALANAHVERVVLEQFLLGVAEVKDPALKTVLGRLCDVYGLGCLQDASGWFLENDHI  731

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                A  IRKEV +LC+ELRP A+AL  +FGIPD+ L +PIA  
Sbjct  732  EGAKAKAIRKEVTRLCAELRPDAVALTKAFGIPDSCLAAPIALG  775



>ref|WP_002637005.1| acyl-CoA dehydrogenase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK90529.1| Acyl-coenzyme A oxidase 1, peroxisomal protein [Myxococcus sp. 
(contaminant ex DSM 436)]
Length=777

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            + +P    +  SD LR   +    L  RE +LL   +  +  R   G     AF      
Sbjct  612  DRNPFAARRTDSDHLRDNDYHLRALRFREEELLATVSKRIRKRLGAGVEAFEAFNQVQVH  671

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLR-YGYLST  480
              +L  A  +R   + F++  A V    +K  LG +  +Y L  L+  + + + +G+L  
Sbjct  672  MLELAHAHVERLALEQFLKGVAQVKDPGLKTVLGRLCDLYGLSCLEAASGWFQEHGWLEG  731

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
              A  IRKEV +LC+ELRP A+ALV++FGIPD  L +PI   
Sbjct  732  AKAKAIRKEVTRLCAELRPDAVALVDAFGIPDTCLAAPIGLG  773



>ref|WP_044187894.1| acyl-CoA oxidase [Hyalangium minutum]
 gb|KFE69122.1| Acyl-coenzyme A oxidase 1, peroxisomal [Hyalangium minutum]
Length=781

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 78/164 (48%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + + +P    +  S+ LR   FQ   L  RE DLL   AA +  R   G     AF    
Sbjct  614  LTDRNPFQVRRTGSEHLRDGDFQVRALRFRESDLLASAAARLRKRLGTGVDSFQAFIQVQ  673

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
               + L  A  +R + + F+     V    +K  LG +  +Y L  L E +  FL   ++
Sbjct  674  DHLQALAHAHVERVVLEQFLAGVEQVEDPAVKAVLGKLCDLYGLGCLVEASGWFLENDHI  733

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPD-AFLSPIAFN  357
             +  A  IRKEV +LC+ELRP A+ALV +F IPD A  +PI   
Sbjct  734  ESGKAKAIRKEVTRLCAELRPDAVALVRAFDIPDSALAAPIGLG  777



>ref|XP_005712270.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF77396.1| acyl-CoA oxidase [Chondrus crispus]
Length=672

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 76/160 (48%), Gaps = 3/160 (2%)
 Frame = -2

Query  809  LSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFA  630
            LS    RS  F   ++  RE  L    AA++  R + G +   AF     L ED GRA  
Sbjct  509  LSGMDPRSAAFALTVMRRREAALFAMLAADLQKRTAAGLTPLKAFNHCAVLVEDAGRAHV  568

Query  629  DRAIFQTFVEAEASV---NSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAATIR  459
            +  + + F    + +       + + L L  +++   T+DE   FLR G +S   A  + 
Sbjct  569  ELLMVELFHHTLSDLQRRGETELADMLSLCGALHTARTVDEQPVFLRCGAVSVAEAQMMH  628

Query  458  KEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANA  339
              V + C  LRPH L LV SFG P   L+PIAF+++  N+
Sbjct  629  TNVGRFCGTLRPHVLTLVESFGYPPHLLAPIAFDYVAHNS  668



>ref|XP_003294150.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
 gb|EGC29318.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
Length=638

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAA  468
            LG+ + ++ I + F+E  +  +    + AL L+ S+Y L  +++D  FL+YGY+S++ A 
Sbjct  535  LGQVYTEKIILRKFIEGISGYSDEKAQAALQLLVSLYTLNIIEKDPWFLKYGYISSEQAE  594

Query  467  TIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAW  336
             I  +V ++C EL PH ++L ++ G  +  L PIA +WI  N +
Sbjct  595  AITVQVLEICKELVPHCISLTDALGFDNETLGPIANDWISKNKF  638



>ref|WP_002612916.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca]
 gb|EAU67561.1| acyl-coenzyme A oxidase, peroxisomal [Stigmatella aurantiaca 
DW4/3-1]
 gb|ADO74925.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca DW4/3-1]
Length=777

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 76/164 (46%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + + +P    +  S+ LR   FQ   L  RE DL+   A  +  R   G     AF    
Sbjct  610  LTDRNPFQARRTGSEHLRDGDFQLGALRFREADLVASAARRLRKRLGSGMDSFQAFNECQ  669

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTL-DEDAAFLRYGYL  486
                 L  A  +R + + F+   A V  +P +  L  +  +Y L  L D    F+    L
Sbjct  670  DHLLALAHAHVERVVLEQFIAGIAWVEDLPTRTVLSKLCDLYGLGCLMDAGGWFVENDLL  729

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                A  IRKEVA+LC+ELRP A+AL ++FGIPD  L +PI   
Sbjct  730  EGAKAKAIRKEVARLCAELRPDAVALTHAFGIPDTCLAAPIGLG  773



>ref|WP_027064968.1| acyl-CoA oxidase [Maribacter sp. Hel_I_7]
Length=754

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 83/158 (53%), Gaps = 2/158 (1%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+  ++   D L + +F    L  R R L    A  +     +G     AF        
Sbjct  596  NPLYTNKTDKDHLYNPKFHVHALEHRTRRLTYTIAMRIRGYIKKGIPSYQAFLKVQTHLM  655

Query  650  DLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDN  474
             LG+A++    +++F+E  +++  +  K     + ++YAL  + +DA+ +L  GY+S + 
Sbjct  656  TLGKAYSTELAYKSFIEHNSTIADLEYKALFEKLGTLYALHEIRKDASWYLEQGYISGNK  715

Query  473  AATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
            +  IR+ V +LC+ELRPH  +LV+ FGIP+  ++ PIA
Sbjct  716  SKAIRQRVERLCTELRPHLDSLVDGFGIPEHLMTAPIA  753



>ref|WP_013937938.1| acyl-CoA dehydrogenase [Myxococcus fulvus]
 gb|AEI64784.1| putative acyl-CoA dehydrogenase [Myxococcus fulvus HW-1]
Length=777

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 79/164 (48%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            M + +P    +  SD LR   +    L  R  +LL   +  +  R S G     AF    
Sbjct  610  MMDRNPFAARRTDSDHLRDNDYHLRALRFRVEELLATVSRRIRKRLSAGVEAFEAFNQVQ  669

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLR-YGYL  486
                +L  A  +R   + F+   A V    +K  LG +  +Y L  L+  + + + +G+L
Sbjct  670  VHLLELAHAHVERLALEQFLAGVAEVKEPGLKTVLGRLCDLYGLSCLEAASGWFQEHGWL  729

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                A  IRKEV +LC+ELRP A+ALV++FG+PD  L +PI   
Sbjct  730  EGTKAKAIRKEVTRLCAELRPDAVALVDAFGVPDTCLAAPIGLG  773



>ref|WP_026707256.1| acyl-CoA oxidase [Flavobacterium frigidarium]
Length=750

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 84/164 (51%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+   +  S+ L   +F       RER +L   A  +      G     AF +  
Sbjct  587  ITEKNPIATRKTDSEHLLDGQFHLQAFEHRERTILASAARRLKKLIESGLEAYDAFNVVQ  646

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                D+ +A+ DR + + F  A A+V     KN L  +  +YAL  ++++ + +L  GY+
Sbjct  647  HQMIDVAQAYLDRVVLEQFQVAIATVKDSDEKNILDKLAQLYALSQIEKNKSWYLEDGYM  706

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                   IRK V +LC ++RP A+ALV++F IPD+ L +PIAFN
Sbjct  707  EAVKTKAIRKMVNQLCWDIRPSAVALVDAFAIPDSCLAAPIAFN  750



>gb|EKF56589.1| acyl-CoA oxidase [Galbibacter marinus]
Length=790

 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 82/158 (52%), Gaps = 2/158 (1%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+  ++   D L    F  + L  + R L    A+ +     +G     AF        
Sbjct  631  NPIFTNKTDKDHLYDSEFHVNALEYKRRRLTFSVASRIQNYTKKGIPSYQAFLKVQTHLV  690

Query  650  DLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDN  474
            +LG+A+++   ++ F++   ++ S  +K   G + +++AL  + ++AA +L  GY+S   
Sbjct  691  ELGKAYSEELSYKAFLDFTKTIQSNDLKFLFGKLGTLFALSEIHDNAAWYLEQGYISGTK  750

Query  473  AATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            +  IR  V +LCSELRPH   LV+ FGIP++ + +PI 
Sbjct  751  SKAIRNRVERLCSELRPHVNTLVDGFGIPNSCITTPIT  788



>ref|WP_040459667.1| acyl-CoA oxidase [Galbibacter marinus]
Length=754

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 82/158 (52%), Gaps = 2/158 (1%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+  ++   D L    F  + L  + R L    A+ +     +G     AF        
Sbjct  595  NPIFTNKTDKDHLYDSEFHVNALEYKRRRLTFSVASRIQNYTKKGIPSYQAFLKVQTHLV  654

Query  650  DLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDN  474
            +LG+A+++   ++ F++   ++ S  +K   G + +++AL  + ++AA +L  GY+S   
Sbjct  655  ELGKAYSEELSYKAFLDFTKTIQSNDLKFLFGKLGTLFALSEIHDNAAWYLEQGYISGTK  714

Query  473  AATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            +  IR  V +LCSELRPH   LV+ FGIP++ + +PI 
Sbjct  715  SKAIRNRVERLCSELRPHVNTLVDGFGIPNSCITTPIT  752



>ref|XP_005703885.1| acyl-CoA oxidase [Galdieria sulphuraria]
 gb|EME27365.1| acyl-CoA oxidase [Galdieria sulphuraria]
Length=636

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 84/172 (49%), Gaps = 12/172 (7%)
 Frame = -2

Query  833  SSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLA  654
            S  +   +L      SI +   I   RE + L   A E++ R+ QG+S   A+     LA
Sbjct  466  SKDIFSGKLPEHNEVSIEYLRTIFRRREANALATLAKELANREHQGKSSFDAWNACLDLA  525

Query  653  EDLGRA-----FADRA--IFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRY  495
             + GRA     F D +  I  +  E +AS+ S+     L L + ++    +D+ + FLR 
Sbjct  526  AEAGRAHTELLFVDLSEEIISSINEEDASIGSV-----LKLCQQLFLFHLVDKQSVFLRT  580

Query  494  GYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANA  339
              L++  A     +V +L  +LR  AL +V SFGIP   L PIAFNWI  N+
Sbjct  581  SCLTSKEAEYCHDKVIELSKQLRLVALPIVESFGIPSHLLGPIAFNWIAHNS  632



>ref|XP_004333085.1| acylCoA oxidase [Acanthamoeba castellanii str. Neff]
 gb|ELR11072.1| acylCoA oxidase [Acanthamoeba castellanii str. Neff]
Length=194

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNA  471
            LG+A+ DR   + FVE   +      K  L  +  ++AL  ++++   ++   Y +   A
Sbjct  17   LGKAYVDRITCEKFVETIRACKEPGTKAVLKQLCRLWALSAIEKNMGWYVANSYFAPIKA  76

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFNWIDANA  339
              ++ E+ KLCSELRPHALALV SF +PD  + +PIAF+W++  +
Sbjct  77   RAMQAEINKLCSELRPHALALVESFALPDHVVCAPIAFDWVEKGS  121



>gb|ERJ18395.1| acyl-CoA oxidase protein [Salinisphaera shabanensis E1L3A]
Length=779

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 85/163 (52%), Gaps = 9/163 (6%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+   +   D LRS  F  ++L LR+ +LL   +  +  R  Q + + +   M++   +
Sbjct  602  NPLTARKTDEDHLRSADFHLELLKLRKHNLLVAASRRLYKRVQQEDMEPF---MAFSDIQ  658

Query  650  DLGRAFAD----RAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
            D   AFA       I QTF +A   +   P K+AL  +R + A+ TL E A  +L YGY+
Sbjct  659  DHMMAFAHADMHHHIAQTFADAVEPLADGPEKDALERMRQLSAIDTLLEHAEWYLTYGYI  718

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIAF  360
            S+     +R     L  E+RP ALA V +FGIPD  LS PIAF
Sbjct  719  SSGKYKALRNLRGALLGEIRPDALAYVEAFGIPDELLSAPIAF  761



>ref|XP_636605.1| hypothetical protein DDB_G0288735 [Dictyostelium discoideum AX4]
 gb|EAL63099.1| hypothetical protein DDB_G0288735 [Dictyostelium discoideum AX4]
Length=652

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 78/143 (55%), Gaps = 7/143 (5%)
 Frame = -2

Query  779  FQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVE  600
            FQ   L  RE DL++  ++++  +  QG S E  +         LG+AF DR   + F  
Sbjct  497  FQIQTLKWRESDLVSTLSSKIMSQLDQGLSLEQGWNTCLDTITLLGKAFVDRITLEEF--  554

Query  599  AEASVNSIP--IKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSEL  429
             ++ +N+ P  +K  L L R+++  + ++ED   FL    L+T  A  I+  + KLCS++
Sbjct  555  -QSGINNAPSSLKQVLELCRNLFFSWKVNEDLGYFLCNDGLATPAALKIQGSINKLCSDM  613

Query  428  RPHALALVNSFGIPDAFL-SPIA  363
             P  L LVNSF IP+ F+ +PI+
Sbjct  614  LPIGLDLVNSFNIPEQFIHAPIS  636



>ref|XP_005716306.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF36487.1| acyl-CoA oxidase [Chondrus crispus]
Length=656

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 73/146 (50%), Gaps = 3/146 (2%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEAEASVNS-  579
            RE  L  R A E+  +   G+S   AF  S  L ED GRA  +  + + F +  +++ S 
Sbjct  511  REAALFARLATEIKKKVEAGQSSLQAFNHSAVLVEDTGRAHVELLMMELFHQTLSNLQSR  570

Query  578  --IPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALV  405
                + + L L  +++    +D  A F+R G L+   A      V   C +LRP  L LV
Sbjct  571  GESELFDILSLCGALHIARLVDSQAVFIRSGALTALEAQNAHNNVQIFCQQLRPQVLHLV  630

Query  404  NSFGIPDAFLSPIAFNWIDANAWSSI  327
            +SFG P   L+PIAF+++  N+ S +
Sbjct  631  DSFGYPPHLLAPIAFDYVRHNSRSRL  656



>ref|WP_017497064.1| acyl-CoA oxidase [Flavobacterium sp. WG21]
Length=752

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 79/163 (48%), Gaps = 2/163 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+   +   + L    F       RE+ +L   A  +      G     AF +  
Sbjct  590  LTEKNPIATRKTDDEHLLDGDFHLQAFVHREKTILASAARRIKKLVDGGLEPYDAFNVVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                D+ +A+ DR + + F  A  SV     K  L  +  +YAL  L+++ A +L  GY+
Sbjct  650  HQMIDVAQAYLDRVVLEQFQLAIKSVEDSKTKEILTKLNQLYALSQLEKNKAWYLEDGYM  709

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIAF  360
                   IRK V +LC ++RP A+ALVN+F IP++ LS PIAF
Sbjct  710  EAVKTKAIRKIVNQLCWDIRPDAVALVNAFDIPESCLSAPIAF  752



>ref|XP_003293845.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
 gb|EGC29627.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
Length=648

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 77/148 (52%), Gaps = 7/148 (5%)
 Frame = -2

Query  794  LRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIF  615
            + S  FQ   L  RE +L+   ++ +  +  QG S E  +     +   LG+AF DR   
Sbjct  488  IHSYDFQIQSLKWRESNLVQTLSSRIMAQLDQGRSLEQGWNTCLDVVTQLGKAFVDRITL  547

Query  614  QTFVEAEASVNSIP--IKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAK  444
            + F   +A + + P   K  L L R+++  + ++ED   FL +  ++T  A  ++  +  
Sbjct  548  EEF---QAGIKNAPSSTKPVLELCRNLFFSWKVNEDLGYFLCHDGIATQTAQKVQDSINI  604

Query  443  LCSELRPHALALVNSFGIPDAFL-SPIA  363
            LC+E+ P  L LVNSF +P+ F+ +PIA
Sbjct  605  LCAEMLPIGLDLVNSFNVPEQFIHAPIA  632



>ref|WP_025744009.1| acyl-CoA oxidase [Aquimarina sp. SW150]
Length=754

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 83/166 (50%), Gaps = 6/166 (4%)
 Frame = -2

Query  848  EHMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAF--  675
            + +N  +PV  + +  D L S +F       R R L    A  +     +G     AF  
Sbjct  590  DKLNTINPVYTNNVDKDHLYSSKFHKHAFDFRTRRLTYTIAMRIRDYVKKGMPSYQAFLK  649

Query  674  AMSYQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLR  498
              ++ LA  LG+A++    + TFV+   ++     +     +  +YAL  L +DA+ +L 
Sbjct  650  VQTHLLA--LGKAYSVELAYATFVDFTDTIEDEKNRLLFQKLGVLYALHELRKDASWYLE  707

Query  497  YGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
             GY+S   +  +R+ V +LC+ELRPH   L++ FGIPD  +S PIA
Sbjct  708  QGYISGTKSKAMRQRVERLCTELRPHLGILIDGFGIPDHCMSAPIA  753



>ref|WP_019598670.1| hypothetical protein [Rhodonellum psychrophilum]
 gb|ERM81639.1| hypothetical protein P872_19995 [Rhodonellum psychrophilum GCM71 
= DSM 17998]
Length=767

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 85/163 (52%), Gaps = 2/163 (1%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMS  666
            +++E +P+I    +S+ L    F  +    RE+ +L   A+ +    + G     AF + 
Sbjct  600  YVSEKNPLIIRSTNSEHLLDFDFHLNAFRYREQAILGSAASRLKRLINGGMDSFDAFNVC  659

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGY  489
                 ++G+A+ +R + + F E   S+     K AL  +  +YAL TL+++   FL   Y
Sbjct  660  QHHLINVGQAYIERVVLEQFQEKIKSIADKGSKKALTQMCQLYALHTLEKNRGWFLEQDY  719

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
            +       IRK V +LC E+RP A+AL ++F IP++ LS PIA
Sbjct  720  MEGVKTKAIRKMVNQLCWEIRPDAIALTDAFAIPESCLSAPIA  762



>ref|WP_013993723.1| acyl-CoA oxidase [Zobellia galactanivorans]
 ref|YP_004736804.1| acyl-coenzyme A oxidase [Zobellia galactanivorans]
 emb|CAZ96523.1| Acyl-coenzyme A oxidase [Zobellia galactanivorans]
Length=754

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 81/160 (51%), Gaps = 6/160 (4%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAF--AMSYQL  657
            +P+  +++  D L + +F    L  R R L    A  +     QG     AF    ++ L
Sbjct  596  NPIYSNKVDKDHLYNPKFHKHALEYRTRRLTYTLAMRIRDYIKQGVPSYQAFLKVQTHLL  655

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDA-AFLRYGYLST  480
            A  LG+A+++   + TF++    +     +     + +++AL T+ +DA  +L  GY+  
Sbjct  656  A--LGKAYSNELAYNTFIDFIQDIEDDKNRTLFQKLGTLHALHTIRQDAEWYLEQGYIGG  713

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
              +  IR+ V +LC+ELRPH   LV+ FGIP+  ++ PI 
Sbjct  714  TKSKAIRQRVERLCTELRPHIGVLVDGFGIPEHCMTAPIT  753



>ref|WP_036151893.1| acyl-CoA oxidase [Maribacter forsetii]
Length=754

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 78/158 (49%), Gaps = 2/158 (1%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+  ++   D L + +F       R R L    A  +     +G     AF        
Sbjct  596  NPLYTNKTDKDHLYNPKFHVHAFEHRTRRLTYTIAMRIRGYIKKGIPSYQAFLKVQTHLM  655

Query  650  DLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDN  474
             LG+A++    +++F+    ++     K     + ++YAL  + +DA+ +L  GY+S   
Sbjct  656  TLGKAYSAELAYKSFIAHNDTMTDPEYKALFEKLGTLYALHEIRKDASWYLEQGYISGTK  715

Query  473  AATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
            +  IR+ V +LC+ELRPH  +LV+ FGIPD  ++ PIA
Sbjct  716  SKAIRQRVERLCTELRPHLNSLVDGFGIPDHLMTAPIA  753



>ref|XP_005536533.1| acyl-CoA oxidase ACX3 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80497.1| acyl-CoA oxidase ACX3 [Cyanidioschyzon merolae strain 10D]
Length=773

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 82/173 (47%), Gaps = 7/173 (4%)
 Frame = -2

Query  827  PVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFA---MSYQL  657
            P +P+  S   L    F T  L      L+ R A  ++    Q   K + FA   M   L
Sbjct  538  PAVPAITSDRELAEPAFITASLARLHDALVRRLAERLTYATKQNSMKPF-FAWNKMCLDL  596

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLSTD  477
            A D+G+ +     ++   +    ++   +K  LG   ++Y L  LD+  A L    +  D
Sbjct  597  AIDVGKVYTCLLAYRIACDEVRQIDDPALKQILGYCCALYGLHMLDKYGALLTRMNVYAD  656

Query  476  NAAT---IRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAWSSI  327
               T   I ++V  L S LRP+ALALV++F IP   L+PIAF+WI  NA + I
Sbjct  657  APNTLERIHQQVEYLSSLLRPNALALVDAFSIPPMLLAPIAFDWITRNARAHI  709



>ref|WP_040608171.1| hypothetical protein, partial [Salinisphaera shabanensis]
Length=746

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 83/161 (52%), Gaps = 9/161 (6%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+   +   D LRS  F  ++L LR+ +LL   +  +  R  Q + + +   M++   +
Sbjct  589  NPLTARKTDEDHLRSADFHLELLKLRKHNLLVAASRRLYKRVQQEDMEPF---MAFSDIQ  645

Query  650  DLGRAFAD----RAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDA-AFLRYGYL  486
            D   AFA       I QTF +A   +   P K+AL  +R + A+ TL E A  +L YGY+
Sbjct  646  DHMMAFAHADMHHHIAQTFADAVEPLADGPEKDALERMRQLSAIDTLLEHAEWYLTYGYI  705

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PI  366
            S+     +R     L  E+RP ALA V +FGIPD  LS PI
Sbjct  706  SSGKYKALRNLRGALLGEIRPDALAYVEAFGIPDELLSAPI  746



>ref|WP_016988806.1| acyl-CoA oxidase [Flavobacterium sp. ACAM 123]
Length=752

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 80/166 (48%), Gaps = 8/166 (5%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            ++E +P++  +     L    F  D    RE+  L   A  +      G     AF +  
Sbjct  590  ISEKNPIVTRKTDDSHLIDEEFHLDAFQYREKTTLASAAKRIKKLIDSGLDPYDAFNIVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE----DAAFLRY  495
                D+ +A+ +R + + F EA   V +I  KN+  ++  +Y L+ L +       +L  
Sbjct  650  HQMIDVAQAYLERVVLEQFQEA---VQNIEDKNSKEVMLKLYQLYALSQIEKNKGWYLED  706

Query  494  GYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAF  360
            GY+       IRK V +LC E+RP A++LV +F IPD+ L +PIAF
Sbjct  707  GYMEAVKTKAIRKMVNQLCWEIRPDAVSLVKAFDIPDSCLAAPIAF  752



>ref|WP_033431876.1| acyl-CoA oxidase [Saccharothrix syringae]
Length=617

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 80/154 (52%), Gaps = 12/154 (8%)
 Frame = -2

Query  806  SSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGR  639
            SSDAL    +Q      RER +L   A     R+ +  S E AF + +  A+D      R
Sbjct  469  SSDALLDRGWQVRQFEDRERHVLEGLA-----RRLRRASPENAFDV-FNAAQDHVLHAAR  522

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATI  462
            A  DR + + FV A        +   LG V  +YAL  ++ D A FL +G L+   A  +
Sbjct  523  AHVDRVVLEAFVAALERGTDPEVTALLGKVCDLYALSVIEADRAWFLEHGRLTPQRAKAV  582

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
             + V +LC +LRPHA  LV++FGIP+ +L +PIA
Sbjct  583  SQAVNELCGQLRPHARDLVDAFGIPEPWLAAPIA  616



>ref|WP_026716117.1| acyl-CoA oxidase [Flavobacterium gelidilacus]
Length=755

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 80/161 (50%), Gaps = 2/161 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P+       + L    F       RE+ ++   A  +     +G     AF +    
Sbjct  594  EKNPITTRNTDEEHLLDNDFHLKAFQYREKSIVASAANRIKKLIDKGMEPYDAFNVVQHQ  653

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              ++ +A+ +R   + F +A  ++    +K AL  V  +YAL  ++++ A +L  GY+  
Sbjct  654  MLEVAQAYLERVTLEQFQQAIETIEDEAVKTALTKVAQLYALHQIEKNKAWYLEQGYMEA  713

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAF  360
                 +RK V +LC ++RP A+ALV++F IPD+ L +PIAF
Sbjct  714  VKTKAVRKMVNQLCWDIRPDAIALVDAFAIPDSCLAAPIAF  754



>ref|XP_642669.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL68701.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=638

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIP---IKNALGLVRSMYALFTLDEDAAFLRYGYLSTD  477
            LG A+ ++ I   F+   A+VN+ P    +NAL L+ S+Y L  +D D  FL+Y ++S  
Sbjct  535  LGVAYTEKTILDKFI---AAVNNYPDENTRNALKLLVSLYVLNIIDRDNWFLKYQFISPQ  591

Query  476  NAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAW  336
             + +I  ++ +LC E+ P++++L ++ G     L PIA +WI  N +
Sbjct  592  QSESISIQILELCKEIVPYSISLTDALGFDHQRLGPIAGDWISRNKF  638



>ref|WP_014773637.1| acyl-CoA oxidase [Belliella baltica]
 gb|AFL85697.1| acyl-CoA dehydrogenase [Belliella baltica DSM 15883]
Length=763

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+I        L  + F       RER +L+  A  +      G     AF +  
Sbjct  599  ITEKNPLIIRSTEQTHLLDMDFHLSAFKYRERAILSSAAQRIKRHIDDGMDSFDAFNVVQ  658

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYL  486
                ++G+A+ +R + + F +     N    K+AL  +  +YAL T++++   +L  GY+
Sbjct  659  HHLVNVGQAYIERVVLEEFQKEVMDTNDGDCKDALLQLCQLYALNTIEKNRGWYLEQGYM  718

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                   IRKEV +LC E+R +ALAL ++F IP++ + +PIA
Sbjct  719  EGVKTKAIRKEVNQLCWEVRKNALALTDAFDIPESCIAAPIA  760



>ref|WP_039819999.1| acyl-CoA oxidase [Nocardiopsis halophila]
Length=663

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 79/159 (50%), Gaps = 7/159 (4%)
 Frame = -2

Query  818  PSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGR  639
            P +  +D LR   +Q  +L  RE   +   A  +  R++ G     AFA   Q  + L R
Sbjct  491  PGRGDADELRDRGWQLRLLEDREEHTVAGLARRL--RRAGGGDGRSAFAAFNQAQDHLLR  548

Query  638  A---FADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            A     DR + + FV      +    +  L  V  +Y L  ++ED A FL +  LS   A
Sbjct  549  AARVHVDRVVLEAFVAGIDRCSDAGARRLLEKVCDLYVLSVVEEDRAWFLEHERLSGTRA  608

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
              + K V +LC++LRPHA  LV++FG+PD +L +PIA  
Sbjct  609  KAVVKAVDELCADLRPHARTLVDAFGLPDEWLAAPIALG  647



>ref|WP_033441505.1| acyl-CoA oxidase [Saccharothrix sp. NRRL B-16314]
Length=617

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 11/150 (7%)
 Frame = -2

Query  806  SSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGR  639
            SSDAL    +Q      RE+ +L   A     R+ +  SKE AF + +  A+D      R
Sbjct  469  SSDALLDRGWQVRQFEDREKHVLEGLA-----RRLRRASKENAFDV-FNAAQDHVLHAAR  522

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATI  462
            A  DR + + FV A            L  V  +YAL T++ D A FL +G L+   A  +
Sbjct  523  AHVDRVVLEAFVAAVDRCGDPSTSALLDEVCDLYALSTIEADRAWFLEHGRLTPQRAKAV  582

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFLS  372
             + V +LC  LRPHA ALV++FGIP++ L+
Sbjct  583  SQAVNELCGRLRPHARALVDAFGIPESLLT  612



>ref|WP_007810516.1| acyl-CoA oxidase [Flavobacterium sp. CF136]
 gb|EJL60869.1| acyl-CoA dehydrogenase [Flavobacterium sp. CF136]
Length=753

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 80/160 (50%), Gaps = 2/160 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P+I  +   + L   +F       RE+ +L   A  +     +G     AF +    
Sbjct  592  EKNPIITRKTDGEHLLDNQFHLQAFHHREKTILASAARRIKKLIDEGLEAYDAFNVVQHQ  651

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              D+ +A+ +R + + F EA  SV     K  L  +  +YAL  ++++   +L  GY+  
Sbjct  652  MIDVAQAYLERVVLEQFQEAVKSVEDEKSKEILIKLNQLYALSQIEKNKGWYLEDGYMEA  711

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                 IRK V +LC ++RP A++LVN+F IP++ L +PIA
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVSLVNAFDIPESCLAAPIA  751



>ref|WP_026978660.1| acyl-CoA oxidase [Flavobacterium tegetincola]
Length=753

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 82/163 (50%), Gaps = 2/163 (1%)
 Frame = -2

Query  845  HMNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMS  666
            +++E +P      S   L    F  +    RE ++    A  +      G +   AF + 
Sbjct  588  YLSERNPFATRDTSDTHLLDAAFHLNAFYYREHEITVSAAKRIKNLIDSGLNAYDAFNVV  647

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGY  489
                 D+ +A+ DR + + F+    ++  +  K+ L  +  ++AL  ++E+ A +L   Y
Sbjct  648  QHQMIDVAKAYLDRVVLEQFLHKIETIKEVATKSMLQKLAQVFALHKMEENRAWYLENNY  707

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            +    +  IRK V +LC E+RP A+ALV++FGIP++ L +PIA
Sbjct  708  MEAVKSKAIRKMVNQLCWEIRPDAVALVDAFGIPESCLAAPIA  750



>ref|WP_035847687.1| acyl-CoA oxidase [Cryptosporangium arvum]
 gb|EXG79190.1| acyl-CoA dehydrogenase [Cryptosporangium arvum DSM 44712]
Length=645

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 81/150 (54%), Gaps = 11/150 (7%)
 Frame = -2

Query  794  LRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFAD  627
            LR   +   +   RE+ +L   A  +   +  GE    AFA+ +  A+D    L R   +
Sbjct  480  LRDREWHLALFEDREKHVLEGLAKRL---RKAGEPDADAFAV-FNDAQDHVLRLARVHVE  535

Query  626  RAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEV  450
            R + + F EA A      +++ LG V +++AL T++ D A FL +G ++   A  +   V
Sbjct  536  RVLLEAFTEAVAEAPD-GLRDVLGRVCALFALSTIEADLAWFLGHGRMTPSRAKRVTSTV  594

Query  449  AKLCSELRPHALALVNSFGIPDAFL-SPIA  363
             +LC ELRPHAL LV+ FGIP+ +L +PIA
Sbjct  595  NELCRELRPHALFLVDGFGIPEEWLDAPIA  624



>ref|WP_035680554.1| acyl-CoA oxidase [Flavobacterium reichenbachii]
 gb|KFF04375.1| acyl-CoA oxidase [Flavobacterium reichenbachii]
Length=753

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQG-ESKEYAFAMS  666
            ++E +P+   +   + L    F       RE+ +L   A  +      G E  +    + 
Sbjct  590  ISEKNPIATRKTDEEHLLDGEFHLQAFVHREKTILASAARRIKKLVDSGLEPYDAVNVVQ  649

Query  665  YQLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGY  489
            +Q+  D+ +A+ +R + + F +A  ++    +KN L  +  +YAL  ++++ A +L  GY
Sbjct  650  HQMI-DVSQAYLERVVLEQFQKAIETIEDQQVKNILQKLNQLYALSQIEKNKAWYLEDGY  708

Query  488  LSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            +       IRK V +LC ++RP A+ALVN+F IP++ L +PIA
Sbjct  709  MEAVKTKAIRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIA  751



>ref|WP_026985441.1| acyl-CoA oxidase [Flavobacterium sp. URHB0058]
Length=753

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 79/164 (48%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+   +   + L   +F       RE+ +L   A  +      G     AF +  
Sbjct  590  ITEKNPIATRRTDDEHLLDDQFHLQAFIHREKTILASAAQRIKKLVDNGLEPYDAFNVVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                D+ +A+ +R + + F  A  +V     K  L  +  +YAL  L+++   +L  GY+
Sbjct  650  HQMIDVAQAYLERVVLEQFQAAIKTVQDEKSKEILTKLNQLYALSQLEKNKGWYLEDGYM  709

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                   IRK V +LC ++RP A+ALVN+F IP++ L +PIA N
Sbjct  710  EAVKTKAIRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAVN  753



>ref|WP_009183890.1| acyl-CoA oxidase [Cecembia lonarensis]
 gb|EKB50464.1| Acyl-CoA dehydrogenase, short-chain specific [Cecembia lonarensis 
LW9]
Length=764

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+I        L    F       RER +L+  A  +      G     AF +  
Sbjct  599  ITEKNPIITRSTDESHLLDFNFHLSAFRYRERAILSSAARRIKRHIDDGMDSFDAFNVVQ  658

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYL  486
                ++G+A+ +R I ++F E    +++   K  L  +  ++AL+TL+ +   +L  GY+
Sbjct  659  HHLVNVGQAYIERVILESFQEGIQKISNAGCKAVLSQLCQLFALYTLENNRGWYLEQGYM  718

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                   IRK V +LC ++R  ALAL ++F IP++ + +PIA
Sbjct  719  EGVKTKAIRKMVNQLCWDVRKDALALTDAFDIPESCIKAPIA  760



>ref|WP_028709678.1| acyl-CoA oxidase [Propionicicella superfundia]
Length=653

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 75/148 (51%), Gaps = 7/148 (5%)
 Frame = -2

Query  806  SSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDL---GRA  636
             +D +    +Q  +   RER ++ R AA +   +S   S E AFA + +  + +    RA
Sbjct  498  GADTVEHRGWQVSMFEERERHVVGRLAARL---RSAARSGEAAFAATNKAQDHMLYAARA  554

Query  635  FADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLD-EDAAFLRYGYLSTDNAATIR  459
              D+ + ++FV    +     +K+ LG +  +YAL  L+ E A +L  G +S   A  + 
Sbjct  555  HMDKVVLESFVAGIEACPDPAVKDVLGRLCDLYALSVLEAERAWYLERGRISPQRAKALT  614

Query  458  KEVAKLCSELRPHALALVNSFGIPDAFL  375
            + V +LC ELRP A  LV   GIP A+L
Sbjct  615  QAVNRLCGELRPLADDLVTGLGIPTAWL  642



>ref|WP_042564417.1| acyl-CoA oxidase [Flavobacterium sp. MEB061]
 gb|KIQ22343.1| acyl-CoA oxidase [Flavobacterium sp. MEB061]
Length=753

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 81/164 (49%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            ++E +P+   +   + L    F       RE+ +L   A  +      G     AF +  
Sbjct  590  ISEKNPIATRRTDDEHLLDSEFHLQAFIHREKTILASAARRIKKLVDGGLEPYDAFNVVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                D+ +A+ +R + + F EA  +V     K  L  +  +YAL  ++++ A +L  GY+
Sbjct  650  HQMIDVAQAYLERIVLEQFQEAIKTVEDEKSKEILTKLYQLYALSQIEKNKAWYLEDGYM  709

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                   +RK V +LC ++RP A+ALVN+F IP++ L +PIA N
Sbjct  710  EAVKTKAVRKIVNQLCWDIRPDAVALVNAFDIPESCLAAPIAVN  753



>ref|WP_043716325.1| acyl-CoA oxidase [Kutzneria sp. 744]
 gb|EWM11475.1| acyl-CoA oxidase [Kutzneria sp. 744]
Length=639

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -2

Query  644  GRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAA  468
            GR   +R + Q F EA        +K+ L  V ++YAL  ++ED A FL +G L++    
Sbjct  524  GRVHTERVVLQAFAEAVEGCADPEVKHLLDRVCTLYALHIVNEDLAWFLAHGRLTSGRGK  583

Query  467  TIRKEVAKLCSELRPHALALVNSFGIPDAFL  375
             +   V  LC+ELRPHA  LV++F IP+ FL
Sbjct  584  AVNGAVNALCAELRPHARTLVDAFAIPERFL  614



>ref|WP_035644791.1| acyl-CoA oxidase [Flavobacterium sp. Fl]
Length=753

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 81/165 (49%), Gaps = 8/165 (5%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            ++E +P+   +   + L    F       RE+ +L   A  +      G     AF +  
Sbjct  590  LSEKNPIATRRTEDEHLLDAEFHHQAFVHREKTILASAAKRIKKLVDGGLEAYDAFNVVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE----DAAFLRY  495
                D+ +A+ +R + + F EA   + +I  +N+  ++  +Y LF L +     A +L  
Sbjct  650  HQMIDVAQAYLERIVLEQFQEA---LKTISDENSKQILTKLYQLFALSQIEKNKAWYLED  706

Query  494  GYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
            GY+       IRK V +LC ++RP A+ALVN+F IP++ LS PIA
Sbjct  707  GYMEAVKTKAIRKIVNQLCWDIRPDAVALVNAFDIPESCLSAPIA  751



>ref|WP_017557135.1| hypothetical protein [Nocardiopsis baichengensis]
Length=663

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 78/159 (49%), Gaps = 7/159 (4%)
 Frame = -2

Query  818  PSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGR  639
            P +  +D LR   +Q  +L  RE   +   A  +  R++ G     AF    Q  + L R
Sbjct  491  PGRGDADELRDRGWQLRLLEDREEHTVAGLARRL--RRAGGGDGRSAFDAFNQAQDHLLR  548

Query  638  A---FADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            A     DR + + FV      +    +  L  V  +Y L  ++ED A FL +  LS   A
Sbjct  549  AARVHVDRVVLEAFVAGIDRCSDAGARRLLEKVCDLYVLSVVEEDRAWFLEHERLSGTRA  608

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
              + K V +LC++LRPHA  LV++FG+PD +L +PIA  
Sbjct  609  KAVVKAVDELCADLRPHARTLVDAFGLPDEWLAAPIALG  647



>ref|WP_018178700.1| hypothetical protein [Gordonia kroppenstedtii]
Length=649

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 78/140 (56%), Gaps = 9/140 (6%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQT  609
            Q  +L  RE  LL R AA+   R +  E  E AF + +  A+D    +G A A+R   + 
Sbjct  508  QLRMLGEREDHLL-RSAAQRMRRAN--EPDEDAFEV-FNNAQDHIIAVGEAHAERVALEA  563

Query  608  FVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEVAKLCSE  432
            FV+A   +   P K+ L  V  +Y   TL++  + +L Y  +S + A  IR+ V +LC+E
Sbjct  564  FVDALHGMEEAPAKDLLRRVCDLYVYATLEKHLSWYLSYRMVSVERAKAIRRGVNELCAE  623

Query  431  LRPHALALVNSFGIPDAFLS  372
            LRPHA  LV++FGIP+  L+
Sbjct  624  LRPHARTLVDAFGIPEELLA  643



>ref|WP_035690755.1| acyl-CoA oxidase [Flavobacterium sp. F52]
Length=752

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 2/161 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P+   +   + L    F       RE+ +L   A  +      G     AF +    
Sbjct  592  EKNPIATRRTEDEHLLDGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNVVQHQ  651

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              D+ +A+ +R + + F  A  +V   P K  L  +  +YAL T++++ A +L  GY+  
Sbjct  652  MIDVAQAYLERIVLEQFQIAIKAVEDEPSKAILTKLNQLYALSTIEKNKAWYLEDGYMEA  711

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAF  360
                 +RK V +LC ++RP A+ALVN+F IP++ L +PIA 
Sbjct  712  VKTKAVRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAI  752



>gb|EJG02802.1| acyl-CoA oxidase [Flavobacterium sp. F52]
Length=765

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 2/161 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P+   +   + L    F       RE+ +L   A  +      G     AF +    
Sbjct  605  EKNPIATRRTEDEHLLDGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNVVQHQ  664

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              D+ +A+ +R + + F  A  +V   P K  L  +  +YAL T++++ A +L  GY+  
Sbjct  665  MIDVAQAYLERIVLEQFQIAIKAVEDEPSKAILTKLNQLYALSTIEKNKAWYLEDGYMEA  724

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAF  360
                 +RK V +LC ++RP A+ALVN+F IP++ L +PIA 
Sbjct  725  VKTKAVRKMVNQLCWDIRPDAVALVNAFDIPESCLAAPIAI  765



>ref|WP_036382477.1| acyl-CoA oxidase [Muricauda sp. MAR_2010_75]
Length=754

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 82/160 (51%), Gaps = 6/160 (4%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAF--AMSYQL  657
            +P+  +++ ++ L + +F       R R L    A  +     +G     AF    ++ L
Sbjct  596  NPLYSNKVDAEHLYNPKFHKHAFNYRTRRLTYTLAMRIRSYIKKGMPSYQAFLKVQTHLL  655

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDA-AFLRYGYLST  480
            A  LG+A++    +Q F +  ASV     K+ L  + ++YAL  +  DA  +L  GY+S 
Sbjct  656  A--LGKAYSVELAYQIFSDFCASVQDDKYKSLLEKLGALYALHQIHLDARWYLEQGYISG  713

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
              +  IR+ V +L +ELRPH   LV+ FGIP+  L+ PIA
Sbjct  714  TKSKAIRQRVERLSTELRPHIEVLVDGFGIPEHCLTAPIA  753



>ref|WP_030096915.1| acyl-CoA oxidase [Mycobacterium abscessus]
Length=649

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 71/136 (52%), Gaps = 1/136 (1%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEVAKLCSELRPH  420
              S +S   +  L  +  ++   TL+ D + FL + ++ST+ A  IR+ V +LC ELRPH
Sbjct  567  IDSCDSKSAQELLEKLCDLFVYSTLEADLSWFLMHRHVSTERAKAIRRGVNQLCEELRPH  626

Query  419  ALALVNSFGIPDAFLS  372
               LV++FGIP+A L+
Sbjct  627  LSTLVDAFGIPEALLA  642



>ref|WP_026812503.1| acyl-CoA oxidase [Arenibacter certesii]
Length=754

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 76/156 (49%), Gaps = 5/156 (3%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAF--AMSYQL  657
            +P   +++  D L + +F       R R L    A  +     +G     AF    ++ L
Sbjct  596  NPAYSNKVDKDHLYNPKFHQHAFKFRTRRLTYSLAMRIKDYIKKGVPSYQAFLKVQTHLL  655

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
            A  LG+A++    + TFV +  S+  +  +     +  ++AL  + EDA+ FL  GY+  
Sbjct  656  A--LGKAYSCELAYSTFVNSTDSIEDLKYQELFRKLGILFALHEIREDASWFLEQGYIGG  713

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS  372
              +  IR+ V +L +ELRPH   LV+ FGIPD  ++
Sbjct  714  TKSKAIRQRVERLSTELRPHIEVLVDGFGIPDHCMT  749



>ref|WP_012813658.1| acyl-CoA oxidase [Robiginitalea biformata]
 gb|EAR15963.1| acyl-coenzyme A oxidase I, putative [Robiginitalea biformata 
HTCC2501]
Length=760

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNA  471
            LGRA+A    F+ F+E    ++  P  + +  + +++AL  +  DAA +L  GY+    +
Sbjct  657  LGRAYAALLAFELFLEHTEDLSDDPHADLIRKLGTLHALSEIRADAAWYLEQGYIGKRKS  716

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFLS--PIA  363
              IR  V +LC+ELRPHA ALV+ FGIP   LS  PIA
Sbjct  717  KAIRSRVERLCTELRPHARALVDGFGIPPTRLSEVPIA  754



>ref|WP_013453510.1| acyl-CoA oxidase [Marivirga tractuosa]
 gb|ADR21361.1| acyl-CoA oxidase domain-containing protein [Marivirga tractuosa 
DSM 4126]
Length=764

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 76/164 (46%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+         L    F  +    RER ++      +     +G     A  ++ 
Sbjct  601  ITEKNPITVRSTDEKHLLDFEFHLNAFKYRERAIVASAGQRIKRLVDEGMDSFDAVNVAQ  660

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                ++GR++ +R + + F  A  +  +   + AL  +  +YAL T++++   +L  GY+
Sbjct  661  HHLINVGRSYIERKVLERFQLAVETTQNKACREALQQLCQLYALHTIEQNKGWYLEQGYM  720

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                   IRK V +LC E R  A+   ++FGIPD  L +PIAFN
Sbjct  721  EGVKTKAIRKMVNQLCWESRQDAIGFTDAFGIPDKLLAAPIAFN  764



>ref|WP_008611975.1| acyl-CoA oxidase [Joostella marina]
 gb|EIJ38714.1| acyl-CoA dehydrogenase [Joostella marina DSM 19592]
Length=752

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 77/157 (49%), Gaps = 2/157 (1%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P+  ++   + L    F  +    R R L    A+ V     +G     AF        
Sbjct  595  NPIFTNKTDKEHLFDTEFHKEAFEYRTRRLTFSVASRVQKYIKKGIPSYQAFLKVQTHMV  654

Query  650  DLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDN  474
             LG+A+++   +  F+     +    ++     + +++AL  ++  AA +L +GY+S + 
Sbjct  655  MLGKAYSEELSYNEFLNFVEKIQEEELRFLFKKLGALFALSEINHHAAWYLEHGYISANK  714

Query  473  AATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPI  366
            +  IRK+V ++CSELRPH   LV+ FGIP + L +PI
Sbjct  715  SKAIRKQVERICSELRPHVNTLVDGFGIPKSCLKTPI  751



>ref|WP_010853776.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacteriaceae bacterium 
AK24]
 gb|EON77924.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacteriaceae bacterium 
AK24]
Length=768

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 2/164 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+I        L    FQ +    R   L++  A  +    S+G     AF +  
Sbjct  601  LTEKNPLIVRNTDESHLTDPDFQLNAFEYRANGLVDSAARRMRRLISEGMDPFDAFNVCQ  660

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                ++G+AF ++ + + F+EA  +         L  +  +YAL T++E+   +L  GY+
Sbjct  661  HHFVNVGKAFIEKVVLEQFIEAAKTAQKESYGEVLKKLCDLYALHTMEENKGWYLEQGYM  720

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                   IRK + +LC E+R  A+ LVN+F IP++ L +PI  N
Sbjct  721  EGVKTKAIRKLINQLCWEIRRDAVPLVNAFDIPESCLAAPILTN  764



>dbj|GAM28721.1| hypothetical protein SAMD00019534_118970 [Acytostelium subglobosum 
LB1]
Length=658

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 76/141 (54%), Gaps = 3/141 (2%)
 Frame = -2

Query  779  FQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVE  600
            FQ   L  +E  L+   + ++     QG   EY++  +  L   LG+A  +R   +TF +
Sbjct  503  FQLHCLKWKESHLVQTLSTKIMTALDQGRGLEYSWNDNLDLVTALGKAHIERITLETF-Q  561

Query  599  AEASVNSIPIKNALGLVRSMY-ALFTLDEDAAFLRYGYLSTDNAATIRKEVAKLCSELRP  423
            A     S+ I+ AL L R+++ +   +D+   +L    ++ + A  +++ +  LC ++ P
Sbjct  562  ASIKKASLNIQPALELCRNLFFSTKVVDDLGFYLCNDGMTQETAVKVQESINLLCGDMLP  621

Query  422  HALALVNSFGIPDAFL-SPIA  363
            HAL LVNSF +P+ ++ +PIA
Sbjct  622  HALDLVNSFDVPEQYIHAPIA  642



>ref|WP_012832911.1| acyl-CoA oxidase [Gordonia bronchialis]
 gb|ACY20333.1| acyl-CoA oxidase domain protein [Gordonia bronchialis DSM 43247]
Length=677

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +GRA  +R + + F+EA    +S      LG V  ++    L++D   FL + ++S + A
Sbjct  578  VGRAHTERVVLEAFIEAINDCDSRSAAELLGKVCDLFVYSALEDDLGWFLMHRHISVERA  637

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFLS  372
              IR+ V  LC ELRPHA  LV++FGIP+  L+
Sbjct  638  KAIRRGVNTLCQELRPHARTLVDAFGIPENLLA  670



>ref|WP_003924602.1| acyl-CoA oxidase [Mycobacterium thermoresistibile]
 gb|EHI13749.1| acyl-CoA dehydrogenase domain-containing protein [Mycobacterium 
thermoresistibile ATCC 19527]
Length=645

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 11/117 (9%)
 Frame = -2

Query  710  RQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEASVNSIPIKNA---LGL  552
            R+ QG+SKE +   +Y   +D      RA  DR I + FV   A +++ P + A   LG+
Sbjct  515  RRLQGKSKEMSEFDAYNAVQDHVLHTARAHIDRVILEAFV---AGIDACPDEEAAHILGM  571

Query  551  VRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPD  384
            V  +YAL  ++ D A F+++ +LST+ A  + + + + C  LRP+A  LV+ FGIP+
Sbjct  572  VCDLYALSVIERDEAWFIKHRFLSTERAKAVTRGINERCRTLRPYAELLVDGFGIPE  628



>ref|WP_009678111.1| acyl-CoA oxidase [Gordonia neofelifaecis]
 gb|EGD56034.1| acyl-CoA oxidase domain protein [Gordonia neofelifaecis NRRL 
B-59395]
Length=655

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  DR + ++FV+A   V+    ++ L  VR+++    L++D A FL + ++S + A
Sbjct  557  VGAAHIDRIVLESFVDAIGRVDDPETRSLLKQVRNLFVYSLLEQDLAWFLMHRHVSVERA  616

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL  375
              IR+ V +LC++LRPHA  LV++FG+P+  L
Sbjct  617  KAIRRGVNELCADLRPHAQTLVDAFGVPEVCL  648



>ref|WP_045823938.1| acyl-CoA oxidase [Williamsia sp. ARP1]
Length=671

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + F+E   + +S    + LG V  ++    L++D   FL + ++S + A
Sbjct  574  VGHAHMERVVLEAFIEGIENCDSKAAADLLGTVCDLFVYSALEDDLDWFLMHRHVSVERA  633

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFLS  372
              IR+ V +LC ELRPHA  LV++FG+P+A L+
Sbjct  634  KAIRRGVNELCKELRPHAQTLVDAFGVPEALLT  666



>ref|WP_044506891.1| acyl-CoA oxidase [Mycobacterium simiae]
Length=646

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 10/136 (7%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQT  609
            Q ++   RE+ LL+  A     R+ Q +SKE +   ++   +D       A  DR + + 
Sbjct  501  QVNMFEEREQYLLSSVA-----RRLQSKSKEMSAFDAFNAVQDHVLHAASAHIDRIVLEA  555

Query  608  FVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSE  432
            FV    +  +   +  LG+V  +YAL  ++ED A ++ +GYLST  A  + + +   C  
Sbjct  556  FVAGIDACENEEARELLGIVCDLYALTAIEEDKAWYIEHGYLSTQRAKAVTRGINDRCRA  615

Query  431  LRPHALALVNSFGIPD  384
            LRPHA  LV+ FGIP+
Sbjct  616  LRPHAQTLVDGFGIPE  631



>ref|WP_039751994.1| acyl-CoA oxidase [Hassallia byssoidea]
 gb|KIF31115.1| acyl-CoA oxidase [Hassallia byssoidea VB512170]
Length=769

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 76/162 (47%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+I      D L    F  +    RERD+L   A  +      G     AF +S 
Sbjct  605  ITELNPIIVRNTDDDHLMDPEFHLNAFKYRERDILTSAAKRLKRHIDSGMDSFDAFNVSQ  664

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                 +G A+ +R I + F++          K  L  + +++AL  ++++   +L  GY+
Sbjct  665  HHLVQVGHAYIERVILEQFIKQVDQTKDAGCKAILKKLCALFALSQIEKNKGWYLEQGYM  724

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
                   IRK + +LC ++R  A+ LV++F IP+  LS PIA
Sbjct  725  EGVKTKAIRKLMNQLCWDIRQEAVPLVDAFNIPNELLSAPIA  766



>ref|WP_031456312.1| acyl-CoA oxidase [Flavobacterium chungangense]
Length=752

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 77/160 (48%), Gaps = 2/160 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P+I  +   + L   +F       RE+ +L   A  +     +G     AF +    
Sbjct  592  EKNPIITRKTDDEHLLDNQFHLQAFVHREKTILASAARRIKKLIDEGLEAYDAFNVVQHQ  651

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              D+  A+ +R + + F      V  +  K  L  +  +YAL  ++++   +L  GY+  
Sbjct  652  MIDVAEAYLERVVLEQFQITIEKVEDVKTKEILLKLNQLYALSQIEKNKGWYLEDGYMEA  711

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                 IRK V +LC ++RP A++LVN+F IP++ L +PIA
Sbjct  712  VKTKAIRKMVNQLCWDIRPDAVSLVNAFDIPESCLAAPIA  751



>ref|WP_018156945.1| hypothetical protein [Demetria terragena]
Length=639

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            R   DR +F+ F EA   ++  P +  L  V S+YAL +++ D A FL +G ++T  +  
Sbjct  541  RTHIDRVVFEAFAEAVDGMDQGPARALLDQVCSLYALSSIEADRAWFLEHGRINTTRSRA  600

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
            I  +V  LC  LRPH   LV+  G+P+A ++ PIA
Sbjct  601  ITTQVNDLCQALRPHVDVLVDGMGVPEALITAPIA  635



>ref|WP_014021931.1| acyl-CoA oxidase [Cyclobacterium marinum]
 gb|AEL27646.1| acyl-CoA oxidase domain-containing protein [Cyclobacterium marinum 
DSM 745]
Length=765

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 76/162 (47%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E + +I        L    F  +    RE  +LN  A  +    S+G     A  ++ 
Sbjct  603  LTEKNLIITRNKGEAHLLDSEFHMNAFYYRENSILNSAANRLKRLMSEGMDPFDAVNVAQ  662

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE-DAAFLRYGYL  486
                 L  AF +R + + F+E     +   +K  L  +  +YAL  +++ +  +L  GY+
Sbjct  663  HHLYTLSLAFIERVVLEKFIEKIEQTSDPELKQVLKQLCDLYALHQIEKHNGWYLEQGYM  722

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                +  IRK V +LC ++R  A+ LVN+F IPDA L +PIA
Sbjct  723  EGGKSKAIRKMVNQLCWDIRKDAVPLVNAFNIPDACLAAPIA  764



>ref|WP_006241046.1| acyl-CoA oxidase [Mycobacterium tusciae]
Length=645

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 65/119 (55%), Gaps = 10/119 (8%)
 Frame = -2

Query  710  RQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEASVNSIPIKNA-----L  558
            R+ QG+SKE +   ++   +D      RA  DR I + FV    S  S  ++       L
Sbjct  511  RRLQGKSKEMSAFDAFNSVQDHVLHTARAHIDRIILEAFVAGIDSCESTSVEGQEAREIL  570

Query  557  GLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPD  384
             LV  +YAL  ++ED A F+ + +LST+ A  + + + + C +LRPHA  LV+ FGIP+
Sbjct  571  NLVCDLYALTVIEEDRAWFMEHRFLSTERAKAVTRGINERCRDLRPHAELLVDGFGIPE  629



>ref|WP_025239597.1| acyl-CoA oxidase [Mycobacterium abscessus]
 gb|EUA44597.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus 21]
Length=649

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCKEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLT  642



>ref|WP_012025377.1| acyl-CoA oxidase [Flavobacterium johnsoniae]
 gb|ABQ06408.1| predicted acyl-CoA oxidase domain protein [Flavobacterium johnsoniae 
UW101]
Length=752

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 79/162 (49%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+   +   + L    F       RE+ +L   A  +      G     AF +  
Sbjct  590  ITEKNPIATRRTDDEHLLDKEFHLQAFVHREKTILASAARRIKKLVDGGLEAYDAFNVVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYL  486
                D+ +A+ +R + + F EA  ++     K  L  +  +YAL  ++++ A +L  GY+
Sbjct  650  HQMIDVAQAYLERIVLEQFQEAVKTIEDENSKQILTKLYQLYALSQIEKNKAWYLEDGYM  709

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
                   +RK V +LC ++RP A+ALVN+F IP++ L +PIA
Sbjct  710  EAVKTKAVRKIVNQLCWDIRPDAVALVNAFDIPESCLAAPIA  751



>ref|WP_004019946.1| acyl-CoA oxidase [Gordonia terrae]
 dbj|GAB43133.1| putative acyl-CoA oxidase [Gordonia terrae NBRC 100016]
Length=697

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S    + LG V  ++    L++D + FL + ++S + A
Sbjct  598  VGHAHIERVVLEAFVEAIENCDSRSAADLLGKVCDLFVYSALEDDLSWFLMHRHISVERA  657

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL  375
              IR+ V +LC ELRPHA +LV++FG+P+  L
Sbjct  658  KAIRRGVNELCQELRPHARSLVDAFGVPEELL  689



>gb|EMP11646.1| acyl-CoA dehydrogenase, middle domain protein [Gordonia sp. NB4-1Y]
Length=621

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +GRA  +R + + FV+A    +S      L  V  ++    L++D A FL + ++S + A
Sbjct  522  VGRAHTERVVLEAFVQAIDDCDSRAAATLLSTVCDLFVYSALEDDLAWFLMHRHVSVERA  581

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFLS  372
              IR+ V +LC +LRPHA ALV++FG+P+  LS
Sbjct  582  KAIRRGVNELCLQLRPHARALVDAFGVPEGLLS  614



>ref|WP_005080876.1| acyl-CoA oxidase [Mycobacterium abscessus]
 gb|EIC67314.1| putative acyl-CoA oxidase [Mycobacterium abscessus M93]
 gb|ETZ74259.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_110811_1470]
 gb|ETZ90678.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_030201_1075]
 gb|ETZ92318.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_030201_1061]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLT  642



>ref|WP_043077692.1| acyl-CoA oxidase [Mycobacterium immunogenum]
 gb|KIU40354.1| acyl-CoA oxidase [Mycobacterium immunogenum]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 72/138 (52%), Gaps = 7/138 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFL  375
            RPH   LV++FGIP+A L
Sbjct  624  RPHLATLVDAFGIPEALL  641



>ref|WP_026729518.1| acyl-CoA oxidase [Flavobacterium denitrificans]
Length=753

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 81/165 (49%), Gaps = 8/165 (5%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            ++E +P+   +   + L    F       RE+ +L   A  +      G     AF +  
Sbjct  590  LSEKNPIATRRTEDEHLLDSEFHHQAFIHREKTILASAARRIKKLVDGGLEAYDAFNVVQ  649

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDE----DAAFLRY  495
                D+ +A+ +R + + F EA   + +I  +N+  ++  +Y LF L +     A +L  
Sbjct  650  HQMIDVAQAYLERIVLEQFQEA---LKTIKDENSKVILTKLYQLFALSQLEKNKAWYLED  706

Query  494  GYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
            GY+       IRK V +LC ++RP A+ALVN+F IP++ L +PIA
Sbjct  707  GYMEAVKTKAIRKIVNQLCWDIRPDAVALVNAFDIPESCLAAPIA  751



>ref|WP_016891967.1| acyl-CoA oxidase [Mycobacterium abscessus]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>ref|WP_035751757.1| acyl-CoA oxidase [Gordonia alkanivorans]
 gb|ETA05688.1| acyl-CoA oxidase [Gordonia alkanivorans CGMCC 6845]
Length=688

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S      LG V  ++    L+ D + F+ + ++S + A
Sbjct  589  VGHAHIERVVLEAFVEAIENCDSRSAAELLGKVGDLFVYSALEADLSWFMMHRHISVERA  648

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIAFN  357
              +R+ V +LC ELRPHA +LV++FG+P+  LS P+  N
Sbjct  649  KAVRRGVNELCQELRPHARSLVDAFGVPEELLSAPMLVN  687



>ref|WP_005056292.1| acyl-CoA oxidase [Mycobacterium abscessus]
 gb|EHC00156.1| putative acyl-CoA oxidase [Mycobacterium abscessus 47J26]
 gb|EHM16522.1| putative acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii 
CCUG 48898 = JCM 15300]
 gb|EIU04612.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-0422]
 gb|EIU08123.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-0421]
 gb|EIU11456.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-0304]
 gb|EIU20560.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-0708]
 gb|EIU25338.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-0817]
 gb|EIU31451.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-1212]
 gb|EIU42451.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-1215]
 gb|EIU63310.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 1S-151-0930]
 gb|EIU68157.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 1S-152-0914]
 gb|EIU73889.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 1S-153-0915]
 gb|EIU77843.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 2B-0626]
 gb|EIU81551.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 1S-154-0310]
 gb|EIU87366.1| acyl-coenzyme A oxidase I, putative [Mycobacterium abscessus 
5S-0921]
 gb|EIV03553.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 2B-0912-R]
 gb|EIV05097.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 2B-0307]
 gb|EIV17967.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 2B-0912-S]
 gb|EIV64681.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii CCUG 48898 = JCM 15300]
 gb|EIV72547.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 2B-1231]
 gb|EIV76701.1| putative acyl-coenzyme A oxidase I [Mycobacterium abscessus subsp. 
bolletii 2B-0107]
 gb|EPQ21952.1| acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii CRM-0020]
 gb|ESV56404.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_082312_2258]
 gb|ESV64810.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_091912_2446]
 gb|ETZ78309.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_082312_2272]
 gb|ETZ83169.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_091912_2455]
 gb|EUA66930.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus subsp. bolletii 1513]
 gb|AIR42217.1| acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii]
 gb|AIV15257.1| acyl-CoA oxidase [Mycobacterium abscessus]
 gb|AIV19784.1| acyl-CoA oxidase [Mycobacterium abscessus]
 dbj|BAP98358.1| acyl-coenzyme A oxidase 3, peroxisomal [Mycobacterium abscessus 
subsp. bolletii CCUG 48898 = JCM 15300]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>ref|WP_005077362.1| acyl-CoA oxidase [Mycobacterium abscessus]
 gb|EHM16825.1| putative acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii 
BD]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>gb|AIC71572.1| acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii str. 
GO 06]
Length=633

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 70/136 (51%), Gaps = 1/136 (1%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  491  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  550

Query  596  EASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEVAKLCSELRPH  420
              S +S   +  L  +  ++    L+ D + FL + ++ST+ A  IR+ V +LC ELRPH
Sbjct  551  IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEELRPH  610

Query  419  ALALVNSFGIPDAFLS  372
               LV++FGIP+A L+
Sbjct  611  LGTLVDAFGIPEALLA  626



>ref|WP_016888063.1| acyl-CoA oxidase [Mycobacterium abscessus]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>ref|WP_017204937.1| acyl-CoA oxidase [Mycobacterium abscessus]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>ref|WP_005088450.1| MULTISPECIES: acyl-CoA oxidase [Mycobacterium]
 ref|YP_001704317.1| Putative acyl-CoA oxidase [Mycobacterium abscessus]
 emb|CAM63663.1| Putative acyl-CoA oxidase [Mycobacterium abscessus ATCC 19977]
 gb|EIC68915.1| putative acyl-CoA oxidase [Mycobacterium abscessus M94]
 gb|EIT89643.1| acyl-CoA oxidase [Mycobacterium abscessus 4S-0303]
 gb|EIT91636.1| acyl-CoA oxidase [Mycobacterium abscessus 4S-0726-RB]
 gb|EIT95185.1| acyl-CoA oxidase [Mycobacterium abscessus 4S-0726-RA]
 gb|EIU36337.1| acyl-CoA oxidase [Mycobacterium abscessus 6G-0125-S]
 gb|EIU38982.1| acyl-CoA oxidase [Mycobacterium abscessus 6G-0125-R]
 gb|EIU53243.1| acyl-CoA oxidase [Mycobacterium abscessus 6G-0728-S]
 gb|EIU55366.1| acyl-CoA oxidase [Mycobacterium abscessus 6G-1108]
 gb|EIU88809.1| acyl-CoA oxidase [Mycobacterium abscessus 6G-0212]
 gb|EIU94899.1| acyl-CoA oxidase [Mycobacterium abscessus 6G-0728-R]
 gb|EIV09317.1| acyl-CoA oxidase [Mycobacterium abscessus 4S-0206]
 gb|EIV22353.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0119-R]
 gb|EIV24164.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0122-R]
 gb|EIV33347.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0122-S]
 gb|EIV37397.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0731]
 gb|EIV47906.1| acyl-CoA oxidase [Mycobacterium abscessus 4S-0116-R]
 gb|EIV49235.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0930-R]
 gb|EIV49675.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0930-S]
 gb|EIV59617.1| acyl-CoA oxidase [Mycobacterium abscessus 4S-0116-S]
 gb|EIV76090.1| acyl-CoA oxidase [Mycobacterium abscessus 3A-0810-R]
 gb|EPZ22392.1| acyl-CoA oxidase [Mycobacterium abscessus V06705]
 gb|ETZ62117.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus MAB_110811_2726]
 gb|EUA62260.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus 1948]
 gb|EUA74906.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
chelonae 1518]
 gb|EUA79846.1| acyl-CoA dehydrogenase, C-terminal domain protein [Mycobacterium 
abscessus subsp. bolletii 103]
 gb|AIR34747.1| acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii 103]
 gb|AIR39626.1| acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii]
 gb|AIV12324.1| acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii]
Length=649

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>ref|WP_020890884.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacterium qasimii]
 gb|EPR68221.1| Acyl-coenzyme A oxidase 1, peroxisomal [Cyclobacterium qasimii 
M12-11B]
Length=765

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 75/162 (46%), Gaps = 2/162 (1%)
 Frame = -2

Query  842  MNESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSY  663
            + E +P+I      + L    F  +    RE  +L+     +     +G     A  ++ 
Sbjct  603  ITEKNPLIIRNTDENHLLDPEFHLNAFQYRENSILSSAGKRLKRLMDEGMDPFDAVNVAQ  662

Query  662  QLAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLD-EDAAFLRYGYL  486
                 L  AF +R I + F+E         +K  L  +  ++AL+ ++  +  +L  GY+
Sbjct  663  HHLFTLAMAFIERVILEKFIEKIEQTTDPELKQVLKRLCDLFALYQIETHNGWYLEQGYM  722

Query  485  STDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
                +  IRK V +LC E+R  A+ LVN+F IPD+ LS PIA
Sbjct  723  EGIKSKAIRKMVNQLCWEIRKDAVPLVNAFNIPDSCLSAPIA  764



>ref|WP_016343166.1| putative acyl-CoA oxidase [Mycobacterium abscessus]
 gb|AGM30194.1| putative acyl-CoA oxidase [Mycobacterium abscessus subsp. bolletii 
50594]
Length=649

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 7/139 (5%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVEA  597
            Q  +L  RE  LL   A  +   QS  E     F  +      +G A  +R + + F+EA
Sbjct  507  QLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKVGSAHTERVVLEAFIEA  566

Query  596  EASVNSIPIKNALGLVRSMYALFT---LDED-AAFLRYGYLSTDNAATIRKEVAKLCSEL  429
               ++S   K+A  L+  +  LF    L+ D + FL + ++ST+ A  IR+ V +LC EL
Sbjct  567  ---IDSCDSKSAQELLEKLCDLFVYSALEADLSWFLMHRHVSTERAKAIRRGVNQLCEEL  623

Query  428  RPHALALVNSFGIPDAFLS  372
            RPH   LV++FGIP+A L+
Sbjct  624  RPHLGTLVDAFGIPEALLA  642



>ref|WP_015100482.1| Acyl-CoA oxidase [Saccharothrix espanaensis]
 emb|CCH30370.1| Acyl-CoA oxidase [Saccharothrix espanaensis DSM 44229]
Length=615

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 79/153 (52%), Gaps = 12/153 (8%)
 Frame = -2

Query  806  SSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGR  639
            SSDAL    +Q      RER +L   A     R+ +  + E AF + +  A+D      R
Sbjct  467  SSDALLDRGWQVRQFEDRERHVLEGLA-----RRLRRATPENAFDV-FNTAQDHVLHAAR  520

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATI  462
            A  DR + + FV A        +   L  V  +YAL T++ D A FL +G L+   + ++
Sbjct  521  AHVDRVVLEAFVAAVDRCPDPEVSALLDTVCDLYALSTIEADRAWFLEHGRLTAARSKSL  580

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFL-SPI  366
             + V +LC+ LRPHA  LV+ FG+P+ +L +PI
Sbjct  581  TQAVNQLCAGLRPHARRLVDVFGVPEGWLAAPI  613



>ref|WP_029269714.1| acyl-CoA oxidase [Flavobacterium sp. KJJ]
Length=754

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 78/162 (48%), Gaps = 2/162 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P+   +   + L    F       RE+ +L   A  +      G     AF +    
Sbjct  592  EKNPIATRRTDDEHLLDGEFHLQAFIHREKTILASAARRIKKLVDGGLEPYDAFNVVQHQ  651

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              D+ +A+ +R + + F E   +V     K  L  +  +YAL  ++++ A +L  GY+  
Sbjct  652  MIDVAQAYLERIVLEQFQEVIKTVEDEKSKEILIKLYQLYALSQIEKNKAWYLEDGYMEA  711

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
                 +RK V +LC ++RP A+ALVN+F IP++ L +PIA N
Sbjct  712  VKTKAVRKIVNQLCWDIRPDAVALVNAFDIPESCLAAPIAVN  753



>ref|WP_006122746.1| MULTISPECIES: acyl-CoA oxidase [Streptomyces]
 gb|EFE72809.1| acyl-CoA oxidase domain-containing protein [Streptomyces roseosporus 
NRRL 15998]
 gb|ESU50420.1| putative acyl-CoA oxidase [Streptomyces sp. HCCB10043]
 gb|EWS90055.1| acyl-CoA oxidase domain-containing protein [Streptomyces roseosporus 
NRRL 11379]
Length=655

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            RA  +R + + FVE   ++     K ALGL+  +YAL T++ D A F+ +G L+   +  
Sbjct  557  RAHMERLVLEAFVEKTRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRSKA  616

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFL  375
            I +EV  LC ++RP A  LV+++GIPDA L
Sbjct  617  ITREVNDLCRKIRPLAGELVDAWGIPDAML  646



>ref|WP_032779937.1| acyl-CoA oxidase [Streptomyces albus]
Length=655

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            RA  +R + + FVE   ++     K ALGL+  +YAL T++ D A F+ +G L+   +  
Sbjct  557  RAHMERLVLEAFVEKTRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRSKA  616

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFL  375
            I +EV  LC ++RP A  LV+++GIPDA L
Sbjct  617  ITREVNDLCRKIRPLAGELVDAWGIPDAML  646



>ref|WP_032769032.1| acyl-CoA oxidase [Streptomyces sp. CNS654]
Length=655

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            RA  +R + + FVE   ++     K ALGL+  +YAL T++ D A F+ +G L+   +  
Sbjct  557  RAHMERLVLEAFVEKTRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRSKA  616

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFL  375
            I +EV  LC ++RP A  LV+++GIPDA L
Sbjct  617  ITREVNDLCRKIRPLAGELVDAWGIPDAML  646



>ref|WP_038237921.1| acyl-CoA oxidase [Zobellia uliginosa]
Length=754

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 79/160 (49%), Gaps = 6/160 (4%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAF--AMSYQL  657
            +P+  +++  D L + +F       R R L    A  +      G     AF    S+ L
Sbjct  596  NPIYSNKVDKDHLYNPKFHKHAFEYRTRRLTYTLAMRIRDYIKTGVPSYQAFLKVQSHLL  655

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDA-AFLRYGYLST  480
            A  LG+A+++   + T+ +   ++     +     + +++AL T+ +DA  +L  GY+  
Sbjct  656  A--LGKAYSNELAYNTYSDFAETIPDTKNRALFQKLGTLHALHTIRQDAEWYLEQGYIGG  713

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
              +  IR+ V +L SELRPH   LV+ FGIP+  +S PIA
Sbjct  714  TKSKAIRQRVERLSSELRPHIGVLVDGFGIPEYCMSAPIA  753



>ref|WP_008713698.1| Acyl-CoA dehydrogenase domain protein [Rhodococcus sp. AW25M09]
 emb|CCQ15155.1| Acyl-CoA dehydrogenase domain protein [Rhodococcus sp. AW25M09]
Length=655

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 10/133 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ Q +SKE +   ++   +D       A  DR +F+ F+    S
Sbjct  505  REEYLLSTVA-----RRLQSKSKETSSFEAFNAVQDHVLHAASAHIDRIVFEAFIAGIES  559

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  +  L  V  +YAL  +D+D A F+ + YLST+ +  + + + + C  LRPHA  
Sbjct  560  CEDATTRELLEEVCDLYALSVIDKDKAWFIEHRYLSTERSKAVTRAINERCRSLRPHAEL  619

Query  410  LVNSFGIPDAFLS  372
            LV+ FGIPDA + 
Sbjct  620  LVDGFGIPDALVG  632



>ref|WP_013154234.1| acyl-CoA oxidase [Nocardiopsis dassonvillei]
 gb|ADH68627.1| acyl-CoA dehydrogenase domain protein [Nocardiopsis dassonvillei 
subsp. dassonvillei DSM 43111]
Length=656

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 73/156 (47%), Gaps = 2/156 (1%)
 Frame = -2

Query  818  PSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGR  639
            P +    +L +  +Q ++L  RE+ ++   AA +      GE     F  +       GR
Sbjct  487  PGRGEEASLYNRGWQLELLEDREKHVIEGLAARLRRSGRNGEDAFDVFNRAQDHVLAAGR  546

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATI  462
            A  DR + + FV              L  +  +Y +  ++ED A FL +  LST  A  +
Sbjct  547  AHMDRVVLEAFVAGIDRCGDTATAKLLNRLCDLYVMSVVEEDRAWFLEHERLSTSRAKAV  606

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
             + V  LC  LRP+A+ LVN+FG+ D +L +PIA  
Sbjct  607  TQAVNDLCRGLRPYAVQLVNAFGLRDEWLAAPIALG  642



>ref|WP_019609734.1| acyl-CoA oxidase [Nocardiopsis sp. CNS639]
Length=656

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 73/156 (47%), Gaps = 2/156 (1%)
 Frame = -2

Query  818  PSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGR  639
            P +    +L +  +Q ++L  RE+ ++   AA +      GE     F  +       GR
Sbjct  487  PGRGEEASLYNRGWQLELLEDREKHVIEGLAARLRRSGRNGEDAFDVFNRAQDHVLAAGR  546

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATI  462
            A  DR + + FV              L  +  +Y +  ++ED A FL +  LST  A  +
Sbjct  547  AHMDRVVLEAFVAGIDRCGDTATAKLLNRLCDLYVMSVVEEDRAWFLEHERLSTSRAKAV  606

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
             + V  LC  LRP+A+ LVN+FG+ D +L +PIA  
Sbjct  607  TQAVNDLCRGLRPYAVQLVNAFGLRDEWLAAPIALG  642



>ref|WP_030811972.1| acyl-CoA oxidase [Streptomyces mediolani]
Length=655

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            RA  +R + + FVE   ++     K ALGL+  +YAL T++ D A F+ +G L+   +  
Sbjct  557  RAHMERLVLEAFVEKMRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRSKA  616

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFL  375
            I +EV  LC ++RP A  LV+++GIPDA L
Sbjct  617  ITREVNDLCRKIRPLAGELVDAWGIPDAML  646



>ref|WP_044376178.1| acyl-CoA oxidase [Streptomyces griseus]
 gb|KIX33233.1| Acyl-coenzyme A oxidase 1, peroxisomal [Streptomyces griseus]
Length=655

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            RA  +R + + FVE   ++     K ALGL+  +YAL T++ D A F+ +G L+   +  
Sbjct  557  RAHMERLVLEAFVEKMRTLPDGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRSKA  616

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFL  375
            I +EV  LC ++RP A  LV+++GIPDA L
Sbjct  617  ITREVNDLCRKIRPLAGELVDAWGIPDAML  646



>ref|WP_029182498.1| acyl-CoA oxidase [Streptomyces globisporus]
Length=655

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = -2

Query  641  RAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAAT  465
            RA  +R + + FVE   ++     K ALGL+  +YAL T++ D A F+ +G L+   +  
Sbjct  557  RAHMERLVLEAFVEKMRTLPEGGNKVALGLLCDLYALSTIEADRAWFMEHGRLTVQRSKA  616

Query  464  IRKEVAKLCSELRPHALALVNSFGIPDAFL  375
            I +EV  LC ++RP A  LV+++GIPDA L
Sbjct  617  ITREVNDLCRKIRPLAGELVDAWGIPDAML  646



>ref|WP_007619749.1| putative acyl-CoA oxidase [Gordonia soli]
 dbj|GAC68001.1| putative acyl-CoA oxidase [Gordonia soli NBRC 108243]
Length=682

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 57/93 (61%), Gaps = 1/93 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + ++FV+A    +S   +  LG V  +Y   TL+ D + F+ + ++S + A
Sbjct  583  VGSARTERMVLESFVQAIDECDSRSAQQLLGKVCDLYVYSTLEADLSWFMMHRHISVERA  642

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFLS  372
              IR+ V  LC ELRP+A  LV++FGIP+A L+
Sbjct  643  KAIRRGVNDLCQELRPYASVLVDAFGIPEALLA  675



>ref|WP_014925550.1| acyl-CoA oxidase [Gordonia sp. KTR9]
 gb|AFR47564.1| Acyl-CoA dehydrogenase [Gordonia sp. KTR9]
Length=694

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S    + LG V  ++    L++D + FL + ++S + A
Sbjct  595  VGHAHIERVVLEAFVEAIENCDSRSAADLLGKVCDLFVYSALEDDLSWFLMHRHISVERA  654

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL  375
              IR+ V +LC ELRPHA +LV++FG+P+  L
Sbjct  655  KAIRRGVNELCLELRPHARSLVDAFGVPEELL  686



>ref|WP_010842026.1| Acyl-CoA dehydrogenase [Gordonia terrae]
 gb|EON33273.1| Acyl-CoA dehydrogenase [Gordonia terrae C-6]
Length=694

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S    + LG V  ++    L++D + FL + ++S + A
Sbjct  595  VGHAHIERVVLEAFVEAIENCDSRSAADLLGKVCDLFVYSALEDDLSWFLMHRHISVERA  654

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL  375
              IR+ V +LC ELRPHA +LV++FG+P+  L
Sbjct  655  KAIRRGVNELCLELRPHARSLVDAFGVPEELL  686



>ref|WP_045539202.1| acyl-CoA oxidase [Gordonia sp. no. 9]
 gb|KJR06490.1| acyl-CoA oxidase [Gordonia sp. no. 9]
Length=657

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G+A  +R + +TFVE    V     +  L  VR ++    L+ED + FL + ++S + A
Sbjct  558  VGQAHIERIVLETFVEVIGRVQDRETRRLLKRVRDLFVYSVLEEDLSWFLMHRHISVERA  617

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIP  387
              +R+ V +LC++LRPHA  LV++FG+P
Sbjct  618  KAVRRGVNELCADLRPHAQTLVDAFGVP  645



>ref|WP_019809905.1| acyl-CoA oxidase [Saccharomonospora halophila]
Length=631

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 73/140 (52%), Gaps = 11/140 (8%)
 Frame = -2

Query  779  FQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQ  612
            +Q  +   RE  +L+       VR+ +   ++ AFA ++  A+D      RA  DR + +
Sbjct  491  WQCKLFEDREEHILDGL-----VRRLRSAGRDDAFA-AFNDAQDHVLHAARAHVDRLVLE  544

Query  611  TFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEVAKLCS  435
             FV A    +    ++ LG V  +Y L T++ D A FL +G LS   A  +   V +LC+
Sbjct  545  AFVAAVDRCSDDTARDLLGRVCDLYVLSTVEADRAWFLEHGRLSGSRAKAVSAGVNRLCA  604

Query  434  ELRPHALALVNSFGIPDAFL  375
            ELRPHA  LV++F +P+  L
Sbjct  605  ELRPHARTLVDAFAVPEDLL  624



>dbj|GAM25056.1| hypothetical protein SAMD00019534_082310 [Acytostelium subglobosum 
LB1]
Length=646

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (46%), Gaps = 0/168 (0%)
 Frame = -2

Query  839  NESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQ  660
            N  S    S+  S  LRS  F    +  R    +   AA++      G+    A+     
Sbjct  479  NVPSDAYRSKTDSKHLRSQDFIMAAMTARVHQYIPAVAAKLMEAVGNGKPVLDAWNDCGN  538

Query  659  LAEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAAFLRYGYLST  480
            +  +LG  F +R + + F++          ++A+ L+ S+  L  +++D  F+++ ++S 
Sbjct  539  IILNLGIVFTERYLLERFIDGVNKCPDAKQRHAMSLLVSLMGLVIIEKDTWFVKHQFISV  598

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWIDANAW  336
            D +  I  E+A LC E+ P A+ L  +FG      +PI  +WI  N +
Sbjct  599  DQSDAISNEIADLCREVVPLAVDLCEAFGFNQLTTAPIGRDWIQHNKY  646



>ref|WP_030580799.1| acyl-CoA oxidase [Streptomyces globisporus]
Length=655

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 70/136 (51%), Gaps = 1/136 (1%)
 Frame = -2

Query  779  FQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAEDLGRAFADRAIFQTFVE  600
            +Q  ++  RE  +L   A  +     +G      F+        + RA  +R + + FVE
Sbjct  511  YQLAMVRYREEHMLAGVARRLKSGIDRGRDPGAVFSEVQDHVIAVARAHMERLVLEAFVE  570

Query  599  AEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNAATIRKEVAKLCSELRP  423
               ++     K ALGL+  ++AL T++ D A F+ +G L+   +  I +EV  LC ++RP
Sbjct  571  KTRTLPEGGNKVALGLLCDLFALSTIEADRAWFMEHGRLTVQRSKAITREVNDLCRKIRP  630

Query  422  HALALVNSFGIPDAFL  375
             A  LV+++GIPDA L
Sbjct  631  LAAELVDAWGIPDAML  646



>ref|WP_037186992.1| acyl-CoA oxidase [Rhodococcus fascians]
Length=655

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 10/133 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ Q +SKE +   ++   +D       A  DR IF+ F+    S
Sbjct  505  REEYLLSTVA-----RRLQSKSKETSPFEAFNAVQDHVLHAASAHIDRIIFEAFIAGIES  559

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  K+ L  V  +YAL  ++ D A F+ + YLST+ +  + + + + C  LRPHA  
Sbjct  560  CEDPATKDLLDEVCDLYALSVIEADKAWFIEHRYLSTERSKAVTRAINERCRTLRPHAEL  619

Query  410  LVNSFGIPDAFLS  372
            LV+ FGIPDA + 
Sbjct  620  LVDGFGIPDALVG  632



>ref|WP_006898335.1| putative acyl-CoA oxidase [Gordonia sihwensis]
 dbj|GAC62902.1| putative acyl-CoA oxidase [Gordonia sihwensis NBRC 108236]
Length=657

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G+A  +R + +TFVE    V     +  L  VR ++    L+ED + FL + ++S + A
Sbjct  558  VGQAHIERIVLETFVEVIGRVQDRETRRLLKRVRDLFVYSVLEEDLSWFLMHRHVSVERA  617

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIP  387
              +R+ V +LC++LRPHA  LV++FG+P
Sbjct  618  KAVRRGVNELCADLRPHAQTLVDAFGVP  645



>ref|WP_042377454.1| acyl-CoA oxidase [Gordonia alkanivorans]
Length=683

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S      LG V  ++    L++D + F+ + ++S + A
Sbjct  584  VGDAHIERVVLEAFVEAIENCDSRSAAELLGKVCDLFVYSALEDDLSWFMMHRHISVERA  643

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
              +R+ V +LC ELRPHA +LV++FG+P+  L +P+  N
Sbjct  644  KAVRRGVNELCQELRPHARSLVDAFGVPEELLRAPMLVN  682



>ref|WP_011856090.1| acyl-CoA oxidase [Mycobacterium sp. JLS]
 gb|ABN99224.1| acyl-CoA dehydrogenase domain protein [Mycobacterium sp. JLS]
Length=645

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ QG+SKE +   ++   +D      +A  DR + + FV    +
Sbjct  503  REEYLLSSVA-----RRLQGKSKEMSAFDAFNAVQDHVLHTAQAHIDRIVLEAFVAGIDA  557

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  +N LG+V  +YAL  ++ED A ++ + +LST+ A  + + + + C  LRP+A  
Sbjct  558  CEDEEARNILGMVCDLYALSVIEEDKAWYIEHRFLSTERAKAVTRGINERCRSLRPYAEL  617

Query  410  LVNSFGIPD  384
            LV+ FGIP+
Sbjct  618  LVDGFGIPE  626



>ref|WP_011560818.1| MULTISPECIES: acyl-CoA oxidase [Mycobacterium]
 gb|ABG09542.1| acyl-CoA dehydrogenase-like protein [Mycobacterium sp. MCS]
 gb|ABL92692.1| acyl-CoA dehydrogenase domain protein [Mycobacterium sp. KMS]
Length=645

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ QG+SKE +   ++   +D      +A  DR + + FV    +
Sbjct  503  REEYLLSSVA-----RRLQGKSKEMSAFDAFNAVQDHVLHTAQAHIDRIVLEAFVAGIDA  557

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  +N LG+V  +YAL  ++ED A ++ + +LST+ A  + + + + C  LRP+A  
Sbjct  558  CEDEEARNILGMVCDLYALSVIEEDKAWYIEHRFLSTERAKAVTRGINERCRSLRPYAEL  617

Query  410  LVNSFGIPD  384
            LV+ FGIP+
Sbjct  618  LVDGFGIPE  626



>ref|WP_027391884.1| acyl-CoA oxidase [Aquimarina latercula]
Length=754

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 72/158 (46%), Gaps = 2/158 (1%)
 Frame = -2

Query  830  SPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAE  651
            +P   + +  D L + +F       R R L    A  +     +G     AF        
Sbjct  596  NPAYTNNVDKDHLYNPKFHKHAFDYRTRRLTYTLAMRIRDYVKKGIPSYQAFLKVQTHLL  655

Query  650  DLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDN  474
             LG+A++    + TF     ++     +     + ++YAL  L +DA+ +L  GY+ +  
Sbjct  656  SLGKAYSTELAYSTFTSFVDTIEDKKYQQLFQKIGTLYALHELRKDASWYLEQGYIGSAK  715

Query  473  AATIRKEVAKLCSELRPHALALVNSFGIPDAFLS-PIA  363
            +  IR  V +L +ELRPH   LV+ +GIP+  +S PIA
Sbjct  716  SKAIRNRVERLSTELRPHIKTLVDGYGIPEHCMSAPIA  753



>ref|WP_036344488.1| acyl-CoA oxidase [Mycobacterium aromaticivorans]
 gb|KDF01626.1| acyl-CoA oxidase [Mycobacterium aromaticivorans JS19b1 = JCM 
16368]
Length=638

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -2

Query  710  RQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRS  543
            R+ Q +SKE +   ++   +D      +A  DR + + FV    +      +N LG+V  
Sbjct  510  RRLQRKSKEMSAFDAFNSVQDHVLHTAKAHIDRIVLEAFVAGIDACEDEDARNILGMVCD  569

Query  542  MYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPD  384
            +YAL  +++D A F+ + +LST+ A  + + + + C +LRPHA  LV+ FGIP+
Sbjct  570  LYALSVIEDDKAWFIEHRFLSTERAKAVTRGINQRCRDLRPHAELLVDGFGIPE  623



>ref|WP_027504516.1| acyl-CoA oxidase [Rhodococcus sp. UNC23MFCrub1.1]
Length=649

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -2

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATI  462
            A  DR + + FV    +      K  LG V  +YAL T+D D A F+ + Y+ST+ +  +
Sbjct  541  AHVDRVVLEAFVAGIDNCEDDDAKELLGEVCDLYALTTIDADKAWFIEHRYISTERSKAV  600

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFLS  372
             + + + C  LRPHA  L+++FG+P+A L 
Sbjct  601  TRGINERCRTLRPHAHTLIDAFGVPEALLG  630



>ref|WP_022827387.1| acyl-CoA oxidase [Flavobacterium antarcticum]
Length=753

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 75/160 (47%), Gaps = 2/160 (1%)
 Frame = -2

Query  836  ESSPVIPSQLSSDALRSIRFQTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQL  657
            E +P      S   L    F       RE ++    A  +      G     AF ++   
Sbjct  591  EKNPFTTRDTSDSHLLDTEFHLKAFYYREHEITTSAAKRIKKLIDSGLDAYDAFNVAQHQ  650

Query  656  AEDLGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLST  480
              D+ +A+ DR + + F+    ++     K  L  +  ++AL  ++E+ A +L   Y  T
Sbjct  651  MIDVAKAYLDRVVLEQFLIKIETLEDSSSKTMLVKLAQLFALHKMEENKAWYLENHYFET  710

Query  479  DNAATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIA  363
              +  IRK V +LC ++RP A+ALV++F IP++ L +PIA
Sbjct  711  SKSKAIRKMVNQLCWDIRPDAVALVDAFAIPESCLAAPIA  750



>gb|KIQ18411.1| acyl-CoA oxidase [Rhodococcus sp. MEB064]
Length=645

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -2

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATI  462
            A  DR + + FV    +      K  LG V  +YAL T+D D A F+ + Y+ST+ +  +
Sbjct  537  AHVDRVVLEAFVAGIDNCEDDDAKELLGEVCDLYALSTIDADKAWFIEHRYISTERSKAV  596

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFLS  372
             + + + C  LRPHA  L+++FG+P+A L 
Sbjct  597  TRGINERCRSLRPHAHTLIDAFGVPEALLG  626



>ref|WP_006437568.1| putative acyl-CoA oxidase [Gordonia amicalis]
 dbj|GAC54509.1| putative acyl-CoA oxidase [Gordonia amicalis NBRC 100051 = JCM 
11271]
Length=683

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 55/92 (60%), Gaps = 1/92 (1%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S      LG V  ++    L+ D A F+ + ++S + A
Sbjct  584  VGHAHIERVVLEAFVEAIENCDSRSAAELLGKVCDLFVYSALEADLAWFMMHRHISVERA  643

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL  375
              +R+ V +LC ELRPHA +LV++FG+P+  L
Sbjct  644  KAVRRGVNELCQELRPHARSLVDAFGVPEELL  675



>ref|WP_042574090.1| acyl-CoA oxidase [Rhodococcus sp. MEB064]
Length=663

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -2

Query  638  AFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATI  462
            A  DR + + FV    +      K  LG V  +YAL T+D D A F+ + Y+ST+ +  +
Sbjct  555  AHVDRVVLEAFVAGIDNCEDDDAKELLGEVCDLYALSTIDADKAWFIEHRYISTERSKAV  614

Query  461  RKEVAKLCSELRPHALALVNSFGIPDAFLS  372
             + + + C  LRPHA  L+++FG+P+A L 
Sbjct  615  TRGINERCRSLRPHAHTLIDAFGVPEALLG  644



>ref|WP_006358547.1| acyl-CoA oxidase [Gordonia alkanivorans]
 dbj|GAA12411.1| putative acyl-CoA oxidase [Gordonia alkanivorans NBRC 16433]
Length=688

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S      LG V  ++    L+ D + F+ + ++S + A
Sbjct  589  VGHAHIERVVLEAFVEAIENCDSRSAAELLGKVCDLFVYSALEADLSWFMMHRHISVERA  648

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
              +R+ V +LC ELRPHA +LV++FG+P+  L +P+  N
Sbjct  649  KAVRRGVNELCQELRPHARSLVDAFGVPEELLRAPMLVN  687



>ref|WP_024445310.1| acyl-CoA oxidase [Mycobacterium iranicum]
Length=653

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 5/114 (4%)
 Frame = -2

Query  710  RQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRS  543
            R+ Q +SKE +   ++   +D    + +A  DR I + FV   AS      +  LG+V  
Sbjct  510  RRLQSKSKEMSAFEAFNSVQDHVLHVAQAHIDRIILEAFVAGIASCEDRTAREILGMVCD  569

Query  542  MYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPD  384
            +YAL  ++ED A F+ + +LST+ A  + + +   C  LRP+A  LV+ FGIP+
Sbjct  570  LYALSVIEEDKAWFVEHRFLSTERAKAVTRGINDRCRRLRPYAELLVDGFGIPE  623



>ref|WP_005194221.1| acyl-CoA oxidase [Gordonia rubripertincta]
 dbj|GAB83517.1| putative acyl-CoA oxidase [Gordonia rubripertincta NBRC 101908]
Length=683

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = -2

Query  647  LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRSMYALFTLDED-AAFLRYGYLSTDNA  471
            +G A  +R + + FVEA  + +S      LG V  ++    L+ D + F+ + ++S + A
Sbjct  584  VGHAHIERVVLEAFVEAIENCDSRSAAELLGKVCDLFVYSALEADLSWFMMHRHISVERA  643

Query  470  ATIRKEVAKLCSELRPHALALVNSFGIPDAFL-SPIAFN  357
              +R+ V +LC ELRPHA +LV++FG+P+  L +P+  N
Sbjct  644  KAVRRGVNELCQELRPHARSLVDAFGVPEELLRAPMLVN  682



>ref|WP_036470198.1| acyl-CoA oxidase [Mycobacterium triplex]
 emb|CDO89561.1| acyl-CoA dehydrogenase [Mycobacterium triplex]
Length=648

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 70/136 (51%), Gaps = 10/136 (7%)
 Frame = -2

Query  776  QTDILCLRERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQT  609
            Q ++   RE+ LL+  A     R+ QG+SKE +   ++   +D       A  DR + + 
Sbjct  501  QVNMFEEREQYLLSSVA-----RRLQGKSKEMSEFDAFNAVQDHVLHAASAHIDRIVLEA  555

Query  608  FVEAEASVNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSE  432
            FV       +   +  L +V  +YAL  +++D A ++ +GYLST  A  + + +   C  
Sbjct  556  FVAGIDGCENEAARELLEIVCDLYALSVIEDDKAWYIEHGYLSTGRAKAVTRGINDRCRA  615

Query  431  LRPHALALVNSFGIPD  384
            LRPHA  LV+ FGIP+
Sbjct  616  LRPHAKTLVDGFGIPE  631



>ref|WP_032380392.1| acyl-CoA oxidase [Rhodococcus fascians]
Length=655

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 69/133 (52%), Gaps = 10/133 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ Q +SKE +   ++   +D       A  DR IF+ F+    S
Sbjct  505  REEYLLSTVA-----RRLQSKSKETSPFEAFNAVQDHVLHAASAHIDRIIFEAFIAGIES  559

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  ++ L  V  +YAL  +++D A F+ + YLST+ +  + + + + C  LRPHA  
Sbjct  560  CEDAATQDLLHEVCDLYALSVIEKDKAWFIEHRYLSTERSKAVTRAINERCRTLRPHAEL  619

Query  410  LVNSFGIPDAFLS  372
            LV+ FG+PDA + 
Sbjct  620  LVDGFGVPDALVG  632



>ref|WP_037171831.1| acyl-CoA oxidase [Rhodococcus fascians]
Length=655

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 69/133 (52%), Gaps = 10/133 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ Q +SKE +   ++   +D       A  DR IF+ F+    S
Sbjct  505  REEYLLSTVA-----RRLQSKSKETSPFEAFNAVQDHVLHAASAHIDRIIFEAFIAGIES  559

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  ++ L  V  +YAL  +++D A F+ + YLST+ +  + + + + C  LRPHA  
Sbjct  560  CEDAATQDLLHEVCDLYALSVIEKDKAWFIEHRYLSTERSKAVTRAINERCRTLRPHAEL  619

Query  410  LVNSFGIPDAFLS  372
            LV+ FG+PDA + 
Sbjct  620  LVDGFGVPDALVG  632



>ref|WP_032390396.1| acyl-CoA oxidase [Rhodococcus fascians]
Length=655

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 69/133 (52%), Gaps = 10/133 (8%)
 Frame = -2

Query  755  RERDLLNRFAAEVSVRQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEAS  588
            RE  LL+  A     R+ Q +SKE +   ++   +D       A  DR IF+ F+    S
Sbjct  505  REEYLLSTVA-----RRLQSKSKESSSFDAFNAVQDHVLHAASAHIDRIIFEAFIAGIES  559

Query  587  VNSIPIKNALGLVRSMYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALA  411
                  K+ L  V  +YAL  ++ED A F+ + YLST+ +  + + + + C  LRPHA  
Sbjct  560  CEDETTKDLLEEVCDLYALSVIEEDKAWFIEHRYLSTERSKAVTRAINERCRTLRPHAEL  619

Query  410  LVNSFGIPDAFLS  372
            LV+ FG+P+A + 
Sbjct  620  LVDGFGVPEALVG  632



>ref|WP_037114191.1| acyl-CoA oxidase [Rhodococcus fascians]
Length=654

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 5/118 (4%)
 Frame = -2

Query  710  RQSQGESKEYAFAMSYQLAED----LGRAFADRAIFQTFVEAEASVNSIPIKNALGLVRS  543
            R+ Q +SKE +   ++   +D       A  DR I + FV   +S      K  L  V  
Sbjct  515  RRLQSKSKETSAFDAFNAVQDHVLHAASAHIDRIILEAFVAGISSCEDEAAKELLEQVCD  574

Query  542  MYALFTLDEDAA-FLRYGYLSTDNAATIRKEVAKLCSELRPHALALVNSFGIPDAFLS  372
            +YAL  ++ED A F+ + YLST+ +  + + + + C  LRPHAL LV  FG+P+  L 
Sbjct  575  LYALSVIEEDKAWFIEHRYLSTERSKAVTRGINERCRTLRPHALELVEGFGVPEQLLG  632



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1853757769455