BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4168

Length=831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA74714.1|  transcription factor TEIL                              154   5e-39   Nicotiana tabacum [American tobacco]
ref|XP_009587969.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     153   9e-39   Nicotiana tomentosiformis
ref|XP_009801714.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     152   2e-38   Nicotiana sylvestris
ref|XP_011080514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          152   2e-38   Sesamum indicum [beniseed]
gb|AFH56407.1|  EIN3-like protein EIL1                                  145   4e-36   Diospyros kaki [Japanese persimmon]
emb|CDP19134.1|  unnamed protein product                                145   6e-36   Coffea canephora [robusta coffee]
ref|NP_001234721.1|  EIL2 protein                                       142   5e-35   Solanum lycopersicum
gb|AAP70005.1|AF498235_1  EIL                                           139   1e-34   Solanum lycopersicum
gb|AHA93899.1|  ethylene insensitive 3                                  140   2e-34   Coffea arabica [arabica coffee]
ref|XP_006364491.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     138   1e-33   Solanum tuberosum [potatoes]
ref|XP_006361129.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    134   4e-32   Solanum tuberosum [potatoes]
ref|XP_011090234.1|  PREDICTED: LOW QUALITY PROTEIN: protein ETHY...    130   6e-31   
ref|XP_009798827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    129   4e-30   Nicotiana sylvestris
ref|NP_001234541.1|  EIL1 protein                                       126   3e-29   Solanum lycopersicum
ref|XP_009607986.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    126   4e-29   Nicotiana tomentosiformis
gb|AAP04000.1|  EIL4                                                    122   1e-27   Nicotiana tabacum [American tobacco]
ref|XP_009798829.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    122   1e-27   Nicotiana sylvestris
ref|XP_009607827.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     120   4e-27   Nicotiana tomentosiformis
ref|NP_001233931.1|  EIN3-like protein                                  119   1e-26   Solanum lycopersicum
ref|XP_006361131.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     117   3e-26   Solanum tuberosum [potatoes]
gb|ACP56697.1|  EIN3-like protein                                       117   7e-26   Lithospermum erythrorhizon
gb|KHG00335.1|  ethylene insensitive 3 -like protein                    114   9e-26   Gossypium arboreum [tree cotton]
gb|AID55343.1|  EIN3-like protein EIL1                                  113   1e-24   Actinidia chinensis
gb|KJB26156.1|  hypothetical protein B456_004G227800                    112   2e-24   Gossypium raimondii
ref|XP_007016682.1|  Ethylene insensitive 3 family protein              112   3e-24   
gb|KJB56070.1|  hypothetical protein B456_009G105400                    112   3e-24   Gossypium raimondii
gb|KHG04095.1|  ethylene insensitive 3 -like protein                    109   6e-24   Gossypium arboreum [tree cotton]
gb|AGK07288.1|  EIN3-3                                                  111   7e-24   Rosa hybrid cultivar
gb|ABY28269.1|  EIN3-like protein EIL1                                  110   1e-23   Actinidia deliciosa [Chinese gooseberry]
gb|ACJ70675.1|  EIN3-like protein EIL2                                  108   7e-23   Actinidia deliciosa [Chinese gooseberry]
gb|AID55344.1|  EIN3-like protein EIL2                                  108   8e-23   Actinidia chinensis
ref|XP_008451093.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          106   3e-22   Cucumis melo [Oriental melon]
gb|AHB18380.1|  ethylene insensitive 3                                  106   4e-22   Momordica charantia [balsam pear]
ref|XP_002275284.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3          105   6e-22   Vitis vinifera
ref|XP_004288382.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          105   7e-22   Fragaria vesca subsp. vesca
ref|XP_010031647.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     105   8e-22   Eucalyptus grandis [rose gum]
ref|XP_004144109.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3          104   1e-21   Cucumis sativus [cucumbers]
ref|XP_011006497.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     104   2e-21   Populus euphratica
gb|AFK80347.1|  ethylene-insensitive 3                                  102   7e-21   Cucumis sativus [cucumbers]
ref|XP_002276380.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    101   2e-20   Vitis vinifera
gb|KJB20248.1|  hypothetical protein B456_003G140600                    101   2e-20   Gossypium raimondii
ref|XP_006384758.1|  EIN3-like family protein                           100   4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_004501972.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    100   4e-20   Cicer arietinum [garbanzo]
ref|XP_002312841.2|  EIN3-like family protein                         99.4    9e-20   
dbj|BAB64344.1|  EIN3-like protein                                    98.6    2e-19   Cucumis melo [Oriental melon]
gb|KHG09663.1|  ethylene insensitive 3 -like protein                  97.1    5e-19   Gossypium arboreum [tree cotton]
gb|AFK45610.1|  unknown                                               93.2    6e-19   Lotus japonicus
ref|XP_006470438.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  96.3    8e-19   Citrus sinensis [apfelsine]
ref|XP_002530192.1|  ETHYLENE-INSENSITIVE3 protein, putative          95.5    1e-18   Ricinus communis
gb|KDO66378.1|  hypothetical protein CISIN_1g0070172mg                95.5    1e-18   Citrus sinensis [apfelsine]
gb|KHN33829.1|  Protein ETHYLENE INSENSITIVE 3                        94.7    3e-18   Glycine soja [wild soybean]
ref|XP_012066274.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   94.7    3e-18   
ref|XP_003543159.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        94.7    3e-18   Glycine max [soybeans]
ref|XP_006446380.1|  hypothetical protein CICLE_v10014617mg           94.4    4e-18   
ref|XP_011043514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        94.4    4e-18   Populus euphratica
ref|XP_006446382.1|  hypothetical protein CICLE_v10014617mg           94.4    4e-18   Citrus clementina [clementine]
ref|XP_003555660.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        91.7    3e-17   Glycine max [soybeans]
gb|KJB83827.1|  hypothetical protein B456_013G266300                  91.3    4e-17   Gossypium raimondii
gb|AHC70433.1|  ethylene insensitive 3 protein                        91.3    4e-17   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_002310961.1|  hypothetical protein POPTR_0008s01200g           89.7    1e-16   
gb|KDO66375.1|  hypothetical protein CISIN_1g0070172mg                89.4    1e-16   Citrus sinensis [apfelsine]
ref|XP_010247605.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   88.6    3e-16   Nelumbo nucifera [Indian lotus]
gb|AFI61908.1|  ethylene insensitive 3-like 2 protein                 87.8    5e-16   Paeonia suffruticosa [moutan peony]
ref|XP_003543154.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        87.4    6e-16   Glycine max [soybeans]
emb|CAB95830.1|  hypothetical protein                                 85.9    7e-16   Cicer arietinum [garbanzo]
gb|KDO53815.1|  hypothetical protein CISIN_1g007174mg                 87.0    1e-15   Citrus sinensis [apfelsine]
ref|XP_010106127.1|  Protein ETHYLENE INSENSITIVE 3                   86.7    1e-15   Morus notabilis
ref|XP_006432540.1|  hypothetical protein CICLE_v10000617mg           86.7    1e-15   Citrus clementina [clementine]
ref|XP_006432536.1|  hypothetical protein CICLE_v10000608mg           85.9    2e-15   
ref|XP_004491182.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  84.7    5e-15   Cicer arietinum [garbanzo]
ref|NP_001275851.1|  ethylene-insensitive 3-like 1 protein            84.3    8e-15   Citrus sinensis [apfelsine]
ref|XP_002315400.1|  EIN3-like family protein                         83.6    1e-14   
ref|XP_010106128.1|  Protein ETHYLENE INSENSITIVE 3                   82.4    3e-14   
gb|AAL76271.1|AF467783_1  transcription factor EIL2                   81.6    5e-14   Vigna radiata [mung bean]
ref|XP_010067064.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  81.3    7e-14   Eucalyptus grandis [rose gum]
ref|XP_008368189.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  80.5    1e-13   
ref|XP_007146084.1|  hypothetical protein PHAVU_006G011300g           80.1    2e-13   Phaseolus vulgaris [French bean]
ref|XP_003545483.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        80.1    2e-13   Glycine max [soybeans]
gb|ADE41153.1|  ethylene insensitive 3 class transcription factor     80.1    2e-13   Malus domestica [apple tree]
gb|AGI41323.1|  EIN3-like protein                                     80.1    2e-13   Malus domestica [apple tree]
ref|XP_007146083.1|  hypothetical protein PHAVU_006G011200g           79.7    2e-13   Phaseolus vulgaris [French bean]
ref|XP_009341360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  78.2    7e-13   Pyrus x bretschneideri [bai li]
gb|ADE41155.1|  ethylene insensitive 3 class transcription factor     77.4    1e-12   Malus domestica [apple tree]
gb|KHN38437.1|  Protein ETHYLENE INSENSITIVE 3                        77.0    1e-12   Glycine soja [wild soybean]
ref|XP_008231880.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  77.4    1e-12   Prunus mume [ume]
gb|EYU46131.1|  hypothetical protein MIMGU_mgv1a003270mg              76.3    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_003519487.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        75.9    4e-12   Glycine max [soybeans]
ref|XP_008357657.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  75.9    5e-12   
gb|AGI41325.1|  EIN3-like protein                                     75.9    5e-12   Malus domestica [apple tree]
ref|XP_010243659.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   75.5    5e-12   Nelumbo nucifera [Indian lotus]
gb|KHN26027.1|  Protein ETHYLENE INSENSITIVE 3                        75.1    7e-12   Glycine soja [wild soybean]
gb|KGN46075.1|  hypothetical protein Csa_6G051520                     73.6    2e-11   Cucumis sativus [cucumbers]
ref|XP_004140927.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  73.2    4e-11   Cucumis sativus [cucumbers]
gb|AHC70432.1|  ethylene insensitive 3-like protein                   72.8    4e-11   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_008456656.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  72.4    6e-11   Cucumis melo [Oriental melon]
ref|NP_001284429.1|  ETHYLENE INSENSITIVE 3-like 1 protein            72.4    6e-11   Cucumis melo [Oriental melon]
gb|AIS20827.1|  EIL                                                   70.1    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_009355060.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  70.1    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_009759370.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  69.3    5e-10   Nicotiana sylvestris
gb|AAP04001.1|  EIL5                                                  69.3    5e-10   Nicotiana tabacum [American tobacco]
gb|EYU35998.1|  hypothetical protein MIMGU_mgv1a003505mg              68.9    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_007141570.1|  hypothetical protein PHAVU_008G207000g           68.6    1e-09   Phaseolus vulgaris [French bean]
ref|XP_008346133.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.2    1e-09   
gb|AGV54673.1|  ethylene insensitive protein 3                        67.8    2e-09   Phaseolus vulgaris [French bean]
ref|XP_009595535.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  67.8    2e-09   Nicotiana tomentosiformis
gb|AGV54306.1|  transcription factor EIL1                             67.4    3e-09   Phaseolus vulgaris [French bean]
gb|ADE41154.1|  ethylene insensitive 3 class transcription factor     66.6    4e-09   Malus domestica [apple tree]
ref|XP_008231879.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  66.2    6e-09   Prunus mume [ume]
gb|ACM89299.1|  EIN3-like protein EIL1                                66.2    6e-09   Eriobotrya japonica [loquat]
gb|ACD87815.1|  putative ethylene insensitive transcription factor    66.2    7e-09   Vicia faba [broad bean]
ref|XP_007220648.1|  hypothetical protein PRUPE_ppa003493mg           65.5    1e-08   
gb|ABK35086.1|  EIL2                                                  65.5    1e-08   Prunus persica
gb|AGI41324.1|  EIN3-like protein                                     65.1    2e-08   Malus domestica [apple tree]
gb|ADZ97022.2|  EIL6                                                  65.1    2e-08   Nicotiana tabacum [American tobacco]
emb|CBI29154.3|  unnamed protein product                              61.6    2e-08   Vitis vinifera
ref|XP_008364747.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.7    2e-08   
ref|XP_010544313.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   63.5    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_009355361.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  63.2    6e-08   Pyrus x bretschneideri [bai li]
gb|AAL76272.1|AF467784_1  transcription factor EIL1                   63.2    7e-08   Vigna radiata [mung bean]
gb|ACJ85584.1|  unknown                                               62.4    1e-07   Medicago truncatula
gb|AAK67355.1|AF387795_1  transcription factor                        62.4    1e-07   Cucumis melo [Oriental melon]
ref|XP_003617086.1|  Ethylene insensitive 3-like protein              62.4    1e-07   Medicago truncatula
emb|CDP16004.1|  unnamed protein product                              62.0    2e-07   Coffea canephora [robusta coffee]
ref|XP_004306440.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.0    2e-07   Fragaria vesca subsp. vesca
dbj|BAI44821.1|  ethylene insensitive 3-like                          61.6    2e-07   Daucus carota [carrots]
emb|CDY06379.1|  BnaC05g31510D                                        61.6    2e-07   
ref|XP_009339245.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  60.1    7e-07   
ref|NP_001234546.1|  EIL3 protein                                     59.7    1e-06   Solanum lycopersicum
emb|CDY19606.1|  BnaA05g20140D                                        59.3    1e-06   Brassica napus [oilseed rape]
ref|XP_011091876.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   59.3    1e-06   
ref|XP_009145590.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  59.3    1e-06   
ref|XP_009145591.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  59.3    1e-06   Brassica rapa
ref|XP_010544311.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   58.2    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_011032978.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  56.6    1e-05   Populus euphratica
ref|XP_011046481.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  56.6    1e-05   Populus euphratica
ref|XP_010509323.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  55.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010509301.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  55.5    2e-05   
ref|XP_010689360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  55.1    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009417872.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  54.7    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO53812.1|  hypothetical protein CISIN_1g009144mg                 53.9    7e-05   Citrus sinensis [apfelsine]
gb|KDO53813.1|  hypothetical protein CISIN_1g009144mg                 53.5    8e-05   Citrus sinensis [apfelsine]
gb|KDO53810.1|  hypothetical protein CISIN_1g009144mg                 53.5    1e-04   Citrus sinensis [apfelsine]
ref|XP_009135708.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   53.5    1e-04   Brassica rapa
gb|ACJ85709.1|  unknown                                               52.8    1e-04   Medicago truncatula
ref|XP_010488063.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   53.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009110178.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   52.8    2e-04   Brassica rapa
ref|XP_006406351.1|  hypothetical protein EUTSA_v10020292mg           52.8    2e-04   Eutrema salsugineum [saltwater cress]
gb|EPS63662.1|  hypothetical protein M569_11122                       52.8    2e-04   Genlisea aurea
dbj|BAJ33948.1|  unnamed protein product                              52.8    2e-04   Eutrema halophilum
gb|ACX54782.1|  ethylene insensitive-like protein 1                   52.8    2e-04   Medicago truncatula
ref|XP_011012998.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  52.8    2e-04   Populus euphratica
ref|XP_003638449.1|  Ethylene insensitive 3-like protein              52.4    2e-04   
ref|XP_010466283.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   52.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006297205.1|  hypothetical protein CARUB_v10013213mg           52.4    3e-04   Capsella rubella
emb|CDY60391.1|  BnaA01g36840D                                        51.6    3e-04   Brassica napus [oilseed rape]
ref|XP_010521603.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  51.6    4e-04   
dbj|BAF44110.1|  ethylene signal transcription factor                 51.6    5e-04   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010521602.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  51.6    5e-04   
ref|XP_010521598.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   51.2    6e-04   Tarenaya hassleriana [spider flower]
ref|XP_006347695.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   50.8    7e-04   Solanum tuberosum [potatoes]
ref|XP_009404687.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  50.8    8e-04   Musa acuminata subsp. malaccensis [pisang utan]



>dbj|BAA74714.1| transcription factor TEIL [Nicotiana tabacum]
Length=615

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSG+GVPEDGQRMIN+LMSFYD NIQGNK S   N   +KEQP QQ +IQ  Q  +L
Sbjct  474  SFDLSGIGVPEDGQRMINELMSFYDNNIQGNKSSMAANVVMSKEQPRQQPSIQ--QNNYL  531

Query  651  QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
             NQGII  GNIF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct  532  HNQGIILDGNIFGDTNISANHSMFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQS  591

Query  474  SDYSEGLLGVPP--LPKKDILSWY  409
            +DY+E L G+    +PK+D+  WY
Sbjct  592  TDYTEALSGITQDNMPKQDVPVWY  615



>ref|XP_009587969.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 gb|AAP03997.1| EIL1 [Nicotiana tabacum]
Length=618

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSG+GVPEDGQRMIN+LMSFYD NIQGNK S   N   +KEQP QQ +IQ  Q  +L
Sbjct  477  SFDLSGIGVPEDGQRMINELMSFYDNNIQGNKSSMAGNVVMSKEQPRQQPSIQ--QNNYL  534

Query  651  QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
             NQGII  GNIF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct  535  HNQGIILDGNIFGDTNISANHSMFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQS  594

Query  474  SDYSEGLLGVPP--LPKKDILSWY  409
            +DY+E L G+    +PK+D+  WY
Sbjct  595  TDYTEALSGITQDNMPKQDVPVWY  618



>ref|XP_009801714.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana sylvestris]
 gb|AAP03998.1| EIL2 [Nicotiana tabacum]
Length=616

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 5/144 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSGLGVPEDGQRMIN+LMSFYD+NIQGNK S   N   +KEQP QQ +IQ  Q  +L
Sbjct  475  SFDLSGLGVPEDGQRMINELMSFYDSNIQGNKNSMAGNVVMSKEQPRQQPSIQ--QNNYL  532

Query  651  QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
             NQGI+  GNIF ++NIS+   +F  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct  533  HNQGIVLDGNIFGDTNISANHSVFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQS  592

Query  474  SDYSEGLLGVPP--LPKKDILSWY  409
            +DY+E L G+    +PK+D+  WY
Sbjct  593  TDYTEALSGITQDNMPKQDVPVWY  616



>ref|XP_011080514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
 ref|XP_011080515.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
Length=616

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 99/144 (69%), Gaps = 3/144 (2%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSGLGVPE+GQRMIN+LMSFYD N+QGNK SN  N+  AKEQ LQQ + Q  Q G+L
Sbjct  473  SFDLSGLGVPEEGQRMINELMSFYDNNVQGNKNSNTGNAANAKEQSLQQHSAQSRQDGYL  532

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
            QNQG ++ GNIF++  I +   +F   D+F+  K + SPFN +  E    MF  PFN+PP
Sbjct  533  QNQGLVLEGNIFEDKTIPNNLSIFRPPDRFDHSKVITSPFNPNPTENFQLMFSSPFNIPP  592

Query  474  SDYSEGLLGVPP--LPKKDILSWY  409
             DY+E   GVP   LPK+DI  WY
Sbjct  593  VDYTENFPGVPRNNLPKQDITIWY  616



>gb|AFH56407.1| EIN3-like protein EIL1, partial [Diospyros kaki]
Length=594

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 102/150 (68%), Gaps = 9/150 (6%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISN----PRNSGPAKEQPLQQTNIQCHQ  664
            SF+LSGLGVPEDGQ+MI++LMSFYD N+QGNK+S+    P       +Q L Q N+ C Q
Sbjct  445  SFDLSGLGVPEDGQKMISELMSFYDANVQGNKLSHSINIPITKDQTPQQALSQPNLHCQQ  504

Query  663  -GGFLQNQGIIPG-NIFQESNISSTRPMFTS-GDQFEQPKALNSPFNVSSIETLPFMFGP  493
               ++  QG++ G NIF+E+N+SS R MF+  GDQF+Q KALNSPF  +  +    MFG 
Sbjct  505  ENNYIHGQGVVMGVNIFEEANMSSNRSMFSRQGDQFDQCKALNSPFEANPNDNFHLMFGS  564

Query  492  PFNLPPSDYSEGLLGVPP--LPKKDILSWY  409
            PFNLPP DY+EG+ GV    L K D+  WY
Sbjct  565  PFNLPPVDYTEGIPGVARDMLSKPDVSIWY  594



>emb|CDP19134.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 105/162 (65%), Gaps = 22/162 (14%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFNLSG+GVPEDGQRMINDLMSFY++NIQGNK ++  N+   KEQ +QQ  +QC    +L
Sbjct  473  SFNLSGIGVPEDGQRMINDLMSFYESNIQGNKNADSGNAAVIKEQSVQQPGMQCQSDNYL  532

Query  651  QNQGI-IPGNIFQESNISS------------------TRPMFTSGDQFEQPKALNSPFNV  529
              QGI + GNIF+++N+SS                  +RPMF  GD+F+Q K  +SPFN 
Sbjct  533  HGQGIMMEGNIFEDTNVSSNRSIFQQGDRFEDTNIPASRPMFQHGDRFDQCKITSSPFNN  592

Query  528  SSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  409
            S+ E   FMFG PFNLP  D++EGL G+      K+D+  WY
Sbjct  593  SN-ENFQFMFGSPFNLPSVDFTEGLPGISRDNASKQDLPIWY  633



>ref|NP_001234721.1| EIL2 protein [Solanum lycopersicum]
 gb|AAK58858.1|AF328785_1 EIL2 [Solanum lycopersicum]
Length=614

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+ SGLGVP DGQR+IN+LMSFY++N+QGNK S   NS  +KEQPLQQ +IQ  Q  +L
Sbjct  473  SFDTSGLGVPADGQRVINELMSFYESNVQGNKSSMAGNSVMSKEQPLQQPSIQ--QNNYL  530

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
            Q+QG ++ G+IF ++NIS+   MF  GD+F+Q K L SPFN SS +   FMFG PFN+  
Sbjct  531  QSQGNVLEGSIFGDTNISANNSMFVQGDRFDQSKVLTSPFNASSTDDFNFMFGSPFNMQS  590

Query  474  SDYSEGLLGVP--PLPKKDILSWY  409
            +D SE L G+    + K+D   WY
Sbjct  591  TDLSECLSGISHDDVTKQDASVWY  614



>gb|AAP70005.1|AF498235_1 EIL [Solanum lycopersicum]
Length=359

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+ SGLGVP DGQR+IN+LMSFY++N+QGNK S   NS  +KEQPLQQ +IQ  Q  +L
Sbjct  215  SFDTSGLGVPADGQRVINELMSFYESNVQGNKSSMAGNSVMSKEQPLQQPSIQ--QNNYL  272

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
            Q+QG ++ G+IF ++NIS++  MF  GD+F+Q K L SPFN SS +   FMFG PFN+  
Sbjct  273  QSQGNVLEGSIFGDTNISASNSMFVQGDRFDQSKVLTSPFNASSTDDFNFMFGSPFNMQS  332

Query  474  SDYSEGLLGV  445
            +D SE L G+
Sbjct  333  TDLSECLSGI  342



>gb|AHA93899.1| ethylene insensitive 3 [Coffea arabica]
Length=589

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 103/162 (64%), Gaps = 22/162 (14%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFNLSG+GVPEDGQRMINDLMSFY++NIQGNK ++  N+   KEQ +QQ  +QC    +L
Sbjct  418  SFNLSGIGVPEDGQRMINDLMSFYESNIQGNKNADSGNAAVIKEQSVQQPGMQCQSDNYL  477

Query  651  QNQGI-IPGNIFQESNISS------------------TRPMFTSGDQFEQPKALNSPFNV  529
              QGI + GNIF+++N+SS                  +RPMF  GD+F+Q K  +SPFN 
Sbjct  478  HGQGIMMEGNIFEDTNVSSNRSIFQQGDRFEDTNIPASRPMFQHGDRFDQCKITSSPFNN  537

Query  528  SSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  409
            S+ E   FMFG PFNLP  D++  L G+      K+D+  WY
Sbjct  538  SN-EKFQFMFGSPFNLPSVDFTXSLPGISRDNASKQDLPIWY  578



>ref|XP_006364491.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=614

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+ SGLGVP DGQR+IN+LMSFY++N+QGNK S   N   +KEQPLQQ +IQ  Q  +L
Sbjct  473  SFDTSGLGVPADGQRVINELMSFYESNVQGNKSSMAGNVVMSKEQPLQQPSIQ--QNNYL  530

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
            Q+QG ++ G+IF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct  531  QSQGNVLEGSIFGDTNISANNSMFVQGDRFDQSKVLTSPFNAGSNDDFNFMFGSPFNLQS  590

Query  474  SDYSEGLLGVP--PLPKKDILSWY  409
            +D SE L G+    + K+D   WY
Sbjct  591  TDLSECLSGISHDDMTKQDTSVWY  614



>ref|XP_006361129.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361130.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 96/143 (67%), Gaps = 4/143 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSG+GVPEDGQRMIN+LM+ YD+++QG+K  N  N    KEQP QQ  +  HQ  +L
Sbjct  476  SFDLSGIGVPEDGQRMINELMTIYDSDVQGSKRQNRGNVTLTKEQPHQQPRV--HQDNYL  533

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QGI+ GNIF+ +NIS+T+ M    D F+Q KALNS FN  S ++  FMFG  FN+  +
Sbjct  534  LSQGIMEGNIFKNTNISTTQSMLPQVDPFDQSKALNSAFNAGSNDSFHFMFGSSFNIQST  593

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y+  L  +G    PK+D   WY
Sbjct  594  NYNGNLPSIGYDTTPKQDAPIWY  616



>ref|XP_011090234.1| PREDICTED: LOW QUALITY PROTEIN: protein ETHYLENE INSENSITIVE 
3 [Sesamum indicum]
Length=598

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 94/143 (66%), Gaps = 7/143 (5%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSGLGVPEDGQRMIN+LMS YD N+QGN  SN  N    KE+ LQ  N Q    G+L
Sbjct  461  SFDLSGLGVPEDGQRMINELMSLYDNNVQGN--SNMGNGTATKEKSLQHRNGQYQPDGYL  518

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
            + QG+   NIF+++NI +   +F+  D+F+Q K +NSPF+ +  E    MF  PFN+P  
Sbjct  519  RGQGM---NIFEDNNIPNNPSIFSPPDRFDQCKVMNSPFSSNPAENFQLMFSSPFNVPSI  575

Query  471  DYSEGLLGVPP--LPKKDILSWY  409
            DY+E   GVP   LPK+D+  WY
Sbjct  576  DYTEAFPGVPRDNLPKQDVTIWY  598



>ref|XP_009798827.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798828.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=615

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L G+GVPEDGQRMI++LMSFYD+ I GNK  N  N    KEQP QQ  +  +Q  +L
Sbjct  475  SFDLFGVGVPEDGQRMIDELMSFYDSKIHGNKSQNTGNVALTKEQPHQQPRL--NQDNYL  532

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QG++  NIF+++NIS++ P+   G+  +Q K LNS F+  S +   FMFG PFNL  +
Sbjct  533  HSQGMMERNIFKDTNISASHPILPQGNLADQCKVLNSSFDTGSSDNFNFMFGSPFNLQST  592

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y+  L  +G    PK+DI  WY
Sbjct  593  NYTGSLPGIGCDNTPKQDIPIWY  615



>ref|NP_001234541.1| EIL1 protein [Solanum lycopersicum]
 gb|AAK58857.1|AF328784_1 EIL1 [Solanum lycopersicum]
Length=610

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 8/143 (6%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSG+GVPEDGQRMIN+LMS YD+++QG+K  N  N    KEQP QQ  +  HQ  +L
Sbjct  474  SFDLSGIGVPEDGQRMINELMSIYDSDVQGSKRQNRGNIALTKEQPHQQPRV--HQDNYL  531

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QGI+ GNIF+ +NIS+T+ M    D F+Q KA    FN  S +   FMFG PFN+  +
Sbjct  532  LSQGIMDGNIFKNTNISTTQSMLPQVDPFDQSKA----FNAGSNDNFHFMFGSPFNIQST  587

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y+  L  +G    PK+D   WY
Sbjct  588  NYNGNLPSIGYDTTPKQDAPIWY  610



>ref|XP_009607986.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
 ref|XP_009607987.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=615

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 93/143 (65%), Gaps = 4/143 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF L G+GVPEDGQRMI++LMSFYD+NIQGNKI N  N    K QP QQ  +  +Q  +L
Sbjct  475  SFGLFGVGVPEDGQRMIDELMSFYDSNIQGNKIQNTGNVALTKGQPHQQPRL--NQDNYL  532

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QG++ GNIF++++IS+  P+   G+  +Q K LNS FN  S +   FM G  F+L  +
Sbjct  533  HSQGMMEGNIFKDTSISAIHPILPQGNLTDQCKVLNSSFNAGSSDNFNFMLGSLFDLQST  592

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +YS  L  +G    PK+DI  WY
Sbjct  593  NYSGSLPGIGCDNTPKQDIPIWY  615



>gb|AAP04000.1| EIL4 [Nicotiana tabacum]
Length=603

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 93/143 (65%), Gaps = 14/143 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            +F+LSG+GVPEDGQRMI +LMSFYD+NIQGNK  N  N    KEQP QQ  +  +Q  +L
Sbjct  473  TFDLSGVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVALTKEQPHQQPRV--NQDNYL  530

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QGI+ GNIF+++NIS++  M         P+A  SPFN    +   FMFG PFNL  +
Sbjct  531  HSQGIMEGNIFKDANISTSHSML--------PQA--SPFNAGPNDNFHFMFGSPFNLQSA  580

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y+  L  +G    PK+++ +WY
Sbjct  581  NYTGNLPGIGYDTTPKQNLPTWY  603



>ref|XP_009798829.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=603

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 93/143 (65%), Gaps = 14/143 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            +F+LSG+GVPEDGQRMI +LMSFYD+NIQGNK  N  N    KEQP QQ  +  +Q  +L
Sbjct  473  TFDLSGVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVALTKEQPHQQPRV--NQDNYL  530

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QGI+ GNIF+++NIS++  M         P+A  SPFN    +   FMFG PFNL  +
Sbjct  531  HSQGIMEGNIFKDANISTSHSML--------PQA--SPFNAGPNDNFHFMFGSPFNLQSA  580

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y+  L  +G    PK+++ +WY
Sbjct  581  NYTGNLPGIGYDTTPKQNLPTWY  603



>ref|XP_009607827.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 ref|XP_009607828.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
Length=600

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 89/143 (62%), Gaps = 17/143 (12%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            +F+LSG+GVPEDGQRMIN+LMSFYD+NIQGNK  N  N    KEQP QQ      +  +L
Sbjct  473  TFDLSGVGVPEDGQRMINELMSFYDSNIQGNKSQNTGNIALTKEQPHQQP-----RDNYL  527

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             +QGI+ GNIF+++NIS++  M   G          SPFN    +    MFG PFNL  +
Sbjct  528  HSQGIMEGNIFKDANISTSHSMLPHG----------SPFNAGPNDNFHCMFGSPFNLQSA  577

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y+  L  +G    PK+D+ +WY
Sbjct  578  NYTGNLPCIGYDTTPKQDLPTWY  600



>ref|NP_001233931.1| EIN3-like protein [Solanum lycopersicum]
 dbj|BAC99307.1| EIN3-like protein [Solanum lycopersicum]
Length=605

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 91/143 (64%), Gaps = 11/143 (8%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-QPLQQTNIQCHQGGFL  652
            F+L G+GVPEDGQRMI+DLMSFYD NIQGNK  N  N    KE QP QQ  +   Q  +L
Sbjct  471  FDLFGVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNVAVTKEQQPHQQPRVD--QVNYL  528

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  472
             ++G++ GNIF++ N+S+++ M   G+  +Q K LNS  N      L FMFGPPFNL  +
Sbjct  529  HSRGMMEGNIFKDINVSASQSMQPQGNLVDQCKILNSSDN------LQFMFGPPFNLQST  582

Query  471  DYSEGL--LGVPPLPKKDILSWY  409
            +Y   L  +G    PK+DI  WY
Sbjct  583  NYPGSLPGIGCDTTPKQDIPIWY  605



>ref|XP_006361131.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=605

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 88/142 (62%), Gaps = 9/142 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F L G+GVPEDGQRMI+DLMSFYD NIQGNK  N  N    KEQ L Q   +  Q  +L 
Sbjct  471  FGLFGVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNVAVTKEQQLHQ-QPRVDQVNYLH  529

Query  648  NQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  469
            ++G++ GNIF++ N+S+++ M    +  +Q K LNS  N      L FMFGPPFNL  ++
Sbjct  530  SRGMMEGNIFKDINVSASQSMHPQSNPVDQCKILNSSDN------LHFMFGPPFNLQSTN  583

Query  468  YSEGL--LGVPPLPKKDILSWY  409
            Y   L  +G    PK+DI  WY
Sbjct  584  YPGSLSGIGCDATPKQDIPIWY  605



>gb|ACP56697.1| EIN3-like protein [Lithospermum erythrorhizon]
Length=635

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 90/163 (55%), Gaps = 23/163 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQRMIN LMSFYDTNIQGNK     N     EQ + Q NI C Q  +L 
Sbjct  473  FDLSGLGVPEDGQRMINGLMSFYDTNIQGNKNLPASNITFNGEQSVHQPNIHCQQVNYLP  532

Query  648  NQG--------------------IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-N  532
             QG                    +I GN+FQ+SNI++    +  GD F+Q K L+SPF N
Sbjct  533  TQGATHQQTGTQGLSNNYQGQGLMIEGNMFQDSNINANPSPYPQGDHFDQRKVLSSPFDN  592

Query  531  VSSIETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  409
              + E    MFG PFN+   DY+EG  G     + K+D   W+
Sbjct  593  NHNNENFQLMFGSPFNMASGDYTEGFPGATRDNMSKQDESIWF  635



>gb|KHG00335.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=397

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ+ I +LMS YD NIQGNK  NP N+   K Q + Q  IQ  Q  F +
Sbjct  252  FDLSGLGVPEDGQKTIGELMSVYDNNIQGNKNMNPSNNLVTKGQNVLQPKIQHQQDEFFR  311

Query  648  NQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIET-LPFMFGPPFNLP  478
             QG+ + GN F++S++   + MF+ G+ QFE+ K LNSP + +        MFG PF+L 
Sbjct  312  GQGVMMEGNFFEDSSMLHNQQMFSQGEAQFERFKGLNSPLDSNHNNNGFQLMFGSPFDLA  371

Query  477  PSDYSEGL--LGVPPLPKKDILSWY  409
              DY E L  +G+  +PK+D+  W+
Sbjct  372  SFDYKEDLHAVGMDSMPKQDVSIWF  396



>gb|AID55343.1| EIN3-like protein EIL1 [Actinidia chinensis]
Length=620

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 89/145 (61%), Gaps = 10/145 (7%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN-SGP---AKEQPLQQTNIQCHQ  664
            SF++SGLGVPEDGQ+MI++LMSFYD NIQGN+ SNP N SG    A  Q L Q NIQC Q
Sbjct  472  SFDISGLGVPEDGQKMISELMSFYDANIQGNRQSNPMNISGSLDRALSQSLPQPNIQCQQ  531

Query  663  -GGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
               ++  QG + G++ +E+N+     MF+  + +F+Q K L+S F     +  P MFG P
Sbjct  532  DNNYIHGQGFVEGHVHEEANLPINLSMFSQQENRFDQRKVLSSQFEADPNDNFPLMFGSP  591

Query  489  FNLPPSDYSEGLLGVPPLPKKDILS  415
              LP  DY E L    P   +D LS
Sbjct  592  LYLPCMDYPEHL----PAVARDTLS  612



>gb|KJB26156.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
 gb|KJB26157.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
Length=614

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 91/146 (62%), Gaps = 6/146 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ+ I +LMS YD NIQGNK  NP N+   K Q + Q  IQ  Q  F +
Sbjct  468  FDLSGLGVPEDGQKTIGELMSVYDNNIQGNKNMNPSNNLVTKGQNVLQPKIQHQQDEFFR  527

Query  648  NQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF--NVSSIETLPFMFGPPFNL  481
             QG+ + GN F++S++     MF+ G+ QFE+ K LNSP   N ++  +   MFG  F+L
Sbjct  528  GQGVMMEGNFFEDSSMLHNHQMFSQGEAQFERFKGLNSPLDSNHNNNNSFQLMFGSSFDL  587

Query  480  PPSDYSEGL--LGVPPLPKKDILSWY  409
               DY E L  +G+  +PK+D+  W+
Sbjct  588  ASFDYKEDLHAVGMDSMPKQDVSIWF  613



>ref|XP_007016682.1| Ethylene insensitive 3 family protein [Theobroma cacao]
 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao]
Length=615

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 95/147 (65%), Gaps = 6/147 (4%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LS LGVPEDGQ+MI++LMS YD NIQG K  NP N+   + Q L Q  IQ  Q  + 
Sbjct  468  SFDLSALGVPEDGQKMISELMSIYDNNIQGTKNMNPGNNPVTEGQNLLQPKIQQQQDEYF  527

Query  651  QNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSP-FNVS-SIETLPFMFGPPFN  484
            + QG+I  GN F+ES++ +   MF+ G+ QF++ KALN+P F  + +  +   MFG PF+
Sbjct  528  RGQGVIMEGNFFEESSMPNNNQMFSQGEGQFDRFKALNTPQFETNHNNNSFQLMFGSPFD  587

Query  483  LPPSDYSEGL--LGVPPLPKKDILSWY  409
            L   DY E L  +G+  LPK+D+  W+
Sbjct  588  LASFDYKEDLQAVGMDTLPKQDVSMWF  614



>gb|KJB56070.1| hypothetical protein B456_009G105400 [Gossypium raimondii]
Length=612

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 92/146 (63%), Gaps = 6/146 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            + LSGLGVPEDGQ+MI+DLMS YD NIQGNK  NP N+   + Q L Q+  Q  Q  F  
Sbjct  467  YELSGLGVPEDGQKMISDLMSIYDNNIQGNKNMNPGNNPGTEGQNLLQSKSQPQQDEFFN  526

Query  648  -NQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNL  481
             +QG+ + GN F+ES++     MF  G+ QF++ K LNSPF  + +  +   MFG PF+L
Sbjct  527  GHQGVMMEGNFFEESSMPRNHQMFMQGEGQFDRFKGLNSPFEANHNNNSFQLMFGSPFDL  586

Query  480  PPSDYSEGL--LGVPPLPKKDILSWY  409
               DY E L  +GV  +PK+D+  W+
Sbjct  587  ASFDYKEDLQAVGVDTMPKQDVSIWF  612



>gb|KHG04095.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=469

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (61%), Gaps = 11/148 (7%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSGLGVPEDGQ+MI++LMS YD NIQGNK  NP N+   + Q +    IQ  Q  + 
Sbjct  325  SFDLSGLGVPEDGQKMISELMSVYDNNIQGNKNMNPSNNPITEGQNILHPKIQQPQDEYF  384

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSS----IETLPFMFGPPF  487
            + Q    GN F++S++ +   MF  G+ QF++ K LNSPF          + P MFG PF
Sbjct  385  RGQ----GNFFEDSSMPNNHQMFQQGEGQFDRFKGLNSPFETEHNNNNNNSFPLMFGSPF  440

Query  486  NLPPSDYSEGL--LGVPPLPKKDILSWY  409
            +L   DY E L  +G+  +P++D+  W+
Sbjct  441  DLSTFDYKEDLQTVGMDTIPRQDVSIWF  468



>gb|AGK07288.1| EIN3-3 [Rosa hybrid cultivar]
Length=618

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 6/145 (4%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LSG GVPEDGQ+MI++LMSFYD+N+QG+K +NP NS     Q   Q  +   Q  + 
Sbjct  475  SFDLSG-GVPEDGQKMISELMSFYDSNVQGDKNANP-NSSATNGQNFSQPKVAHQQDEYF  532

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLP  478
            + QG+ + GN F+ESNISS   +F   + QFEQ K ++SPF  +     P MFG PF+L 
Sbjct  533  RGQGVRLDGNFFEESNISSNHHLFPREEGQFEQFKVVSSPFETNHNSNFPMMFGSPFDLA  592

Query  477  PSDYSEGLLGVP-PLPKKDILS-WY  409
              DY E L G+  P+ K+   S W+
Sbjct  593  SFDYKEDLQGLALPMEKQSETSIWF  617



>gb|ABY28269.1| EIN3-like protein EIL1 [Actinidia deliciosa]
Length=570

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 10/145 (7%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN-SGP---AKEQPLQQTNIQCHQ  664
            SF++S LGVPEDGQ+MI++LMSFYD NIQGN+ SNP N SG    A  Q L Q NIQC Q
Sbjct  422  SFDISWLGVPEDGQKMISELMSFYDANIQGNRQSNPMNISGSLDRALSQSLPQPNIQCQQ  481

Query  663  -GGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
               ++  QG + G++ +E+N+     MF+  + +F+Q K L+S F     +  P MFG P
Sbjct  482  DNNYIHGQGFVEGHVHEEANLPINFSMFSQQENRFDQRKVLSSQFEADPNDNFPLMFGSP  541

Query  489  FNLPPSDYSEGLLGVPPLPKKDILS  415
              LP  DY E L    P   +D LS
Sbjct  542  LYLPCMDYPEHL----PAVARDTLS  562



>gb|ACJ70675.1| EIN3-like protein EIL2 [Actinidia deliciosa]
Length=618

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT----NIQCHQ  664
            SF+LSGLGVPEDGQ+MIN+LMSFYD+NIQGNK SNP +   +  Q L Q     NI    
Sbjct  472  SFDLSGLGVPEDGQKMINELMSFYDSNIQGNKQSNPMSISVSSNQTLSQALPQPNI---D  528

Query  663  GGFLQNQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
              ++  QG ++  NI +E+N+     MF+  + +F+  K LNS F  +  + +P MF  P
Sbjct  529  NNYIHGQGFVMERNICEEANLPVNLSMFSQQENRFDHRKVLNSQFEANPNDNVPLMFASP  588

Query  489  FNLPPSDYSEGLLGVPPLPKKDILS  415
            F LP  DY E L   P LP+ D LS
Sbjct  589  FYLPSVDYPEHL---PGLPRGDTLS  610



>gb|AID55344.1| EIN3-like protein EIL2 [Actinidia chinensis]
Length=618

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 12/145 (8%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT----NIQCHQ  664
            SF+LSGLGVPEDGQ+MIN+LMSFYD+NIQGNK SNP +   +  Q L Q     NI    
Sbjct  472  SFDLSGLGVPEDGQKMINELMSFYDSNIQGNKQSNPMSISVSSNQTLSQALPQPNI---D  528

Query  663  GGFLQNQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
              ++  QG ++  NI +E+N+     MF+  + +F+  K LNS F  +  + +P MF  P
Sbjct  529  NNYIHGQGFVMERNICEEANLPVNLSMFSQQENRFDHRKVLNSQFEANPNDNVPLMFASP  588

Query  489  FNLPPSDYSEGLLGVPPLPKKDILS  415
            F LP  DY E L   P LP+ D LS
Sbjct  589  FYLPSVDYPEHL---PGLPRGDTLS  610



>ref|XP_008451093.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis melo]
Length=625

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 12/153 (8%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGF  655
            SF+LS LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  +
Sbjct  472  SFDLSTLGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDY  531

Query  654  LQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN-----VSSIETLPFMFG  496
             +NQG+ + GN F  SN+SS+  MFT  + QF++ K +NSPF       ++      MF 
Sbjct  532  FRNQGLMMEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNSPFENNHHHHNNNNNFHLMFS  591

Query  495  PPFNLPPSDYSEGLLGVPPL----PKKDILSWY  409
             PF+L   DY E + GV  +     ++DI  WY
Sbjct  592  SPFDLSTFDYKEEVPGVAAIDTLSKQQDIPLWY  624



>gb|AHB18380.1| ethylene insensitive 3 [Momordica charantia]
Length=629

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 94/157 (60%), Gaps = 16/157 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGF  655
            SF+LS LGVPEDGQ++I++LMS YDTN+QGNK + N  N+  A+ Q L Q  IQ  Q  +
Sbjct  472  SFDLSSLGVPEDGQKLISELMSIYDTNVQGNKNNVNTVNAAIAENQNLPQLKIQPQQDEY  531

Query  654  LQNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------VSSIETLP  508
             +NQGI + GN F+ SN+SS+ PMF   + QF++ K +N+PF           ++     
Sbjct  532  FRNQGIMMEGNFFEGSNVSSSHPMFPRDEGQFDRFKPMNTPFENNHHQHNHNHNNNNNFH  591

Query  507  FMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  409
             MFG PF+L   DY E + G   +     ++DI  WY
Sbjct  592  LMFGSPFDLSTFDYKEEVPGAAAIDTLSKQQDIPLWY  628



>ref|XP_002275284.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
 ref|XP_010651613.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
Length=610

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 79/145 (54%), Gaps = 12/145 (8%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ+MI DLMSFYDTNIQG+K+SNPR+     +Q LQ    Q HQ     
Sbjct  473  FDLSGLGVPEDGQKMIGDLMSFYDTNIQGSKVSNPRSIAVTNDQNLQHPKRQHHQNNSFH  532

Query  648  NQGIIPGNIFQESNISSTRPMF-TSGDQFEQPKALNSPFNVSSIE-TLPFMFGPPFNLPP  475
                      QESN++    MF     QF++ K LNS F  S  E    F++GP F+L  
Sbjct  533  -------GFLQESNMTHNHHMFPREESQFDRSKLLNSRFETSPNENAFQFIYGPAFDLSS  585

Query  474  SDYSEGLLGVPPL---PKKDILSWY  409
             DY E +          K+D   WY
Sbjct  586  IDYVEDIPATTATDISSKQDASIWY  610



>ref|XP_004288382.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Fragaria vesca subsp. 
vesca]
Length=618

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+LS  GVPEDGQ+MI+DLMSFYD N+QG+K +NP NS     +   Q N+   Q  + 
Sbjct  475  SFDLSA-GVPEDGQKMISDLMSFYDCNVQGDKNANP-NSLVTNVKNFSQPNVAHQQDEYF  532

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLP  478
            + QG+ + GN F+ESNISS   +FT  + QF+Q K  +SPF  +     P MFG  F+L 
Sbjct  533  RGQGVRLDGNFFEESNISSNHHVFTREEGQFDQFKVTSSPFETNHNSNFPMMFGSSFDLA  592

Query  477  PSDYSEGLLGV  445
              DY E L G+
Sbjct  593  SFDYKEDLQGL  603



>ref|XP_010031647.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031648.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031649.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 gb|KCW51004.1| hypothetical protein EUGRSUZ_J00631 [Eucalyptus grandis]
Length=611

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 87/145 (60%), Gaps = 13/145 (9%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ++I+DLMS YDT+IQGNK  NP N    ++Q   Q          LQ
Sbjct  473  FDLSGLGVPEDGQKVISDLMSIYDTSIQGNKNMNPANDAIIEDQSRPQPK--------LQ  524

Query  648  NQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF--NVSSIETLPFMFGPPFNLP  478
             Q    G+ FQ+ N S+   MF+  D QF++ K +NS F  N  + + L  MFG PF+L 
Sbjct  525  QQNEFVGSFFQQPNASANHHMFSREDIQFDRFKTMNSSFEANNHNHDNLQLMFGSPFDLS  584

Query  477  PSDYSEGLLG--VPPLPKKDILSWY  409
              D+ E L G  + PLPK+D+  W+
Sbjct  585  SFDFKEELPGGVMDPLPKQDVTIWF  609



>ref|XP_004144109.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis sativus]
 gb|KGN66413.1| EIN3-like protein [Cucumis sativus]
Length=630

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 91/157 (58%), Gaps = 17/157 (11%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFL  652
            F+LS LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + 
Sbjct  473  FDLSTLGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYF  532

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN----------VSSIETLP  508
            +NQG+ I GN F  SN+SS+  MFT  + QF++ K +N+PF            ++     
Sbjct  533  RNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNNNNNNNNNFH  592

Query  507  FMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  409
             MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  593  LMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  629



>ref|XP_011006497.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
 ref|XP_011006504.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
Length=617

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (63%), Gaps = 8/147 (5%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFNLSG  VPEDGQ+MI++LMS YDTNIQGNK +N  N+   ++  + Q  IQ  Q    
Sbjct  473  SFNLSG--VPEDGQKMISELMSIYDTNIQGNKNTNRGNNLVTEDHNVFQPKIQHQQDNHF  530

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSG-DQFEQPKALNSPFNVSSIET-LPFMFGPPFNL  481
            + Q  +I GNIF+ESNI+    MF+    QF++ K LNSPF  +   +    MFG PF+L
Sbjct  531  RGQSNMINGNIFEESNINQNHQMFSQEVGQFDRFKPLNSPFETNQNNSGFSLMFGSPFDL  590

Query  480  PPSDYSEGL--LGVPPLPK-KDILSWY  409
               DY + L  LG+  LPK +D+ +W+
Sbjct  591  SSFDYKDDLQVLGMDTLPKHQDVSTWF  617



>gb|AFK80347.1| ethylene-insensitive 3 [Cucumis sativus]
Length=635

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 91/162 (56%), Gaps = 22/162 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFL  652
            F+LS LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + 
Sbjct  473  FDLSTLGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYF  532

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------------VSS  523
            +NQG+ I GN F  SN+SS+  MFT  + QF++ K +N+PF                 ++
Sbjct  533  RNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNNNNNNNNNNN  592

Query  522  IETLPFMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  409
                  MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  593  NNNFHLMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  634



>ref|XP_002276380.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
 ref|XP_010659025.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
Length=616

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 92/150 (61%), Gaps = 15/150 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH-----  667
            +FN+SGLG+PEDGQ+MI+DLMSFYDTN+Q NK  NP N    ++Q   Q   Q       
Sbjct  472  AFNVSGLGLPEDGQKMISDLMSFYDTNLQRNKSLNPGNLNVMEDQNQPQQQQQQQKFQLQ  531

Query  666  -QGGFLQNQGIIP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMF  499
                F  NQG++  GNI +E+N+     +F+S + QF+Q KA +SPF+ +  + +  F F
Sbjct  532  LDDNFF-NQGVMMGGNITEETNMPLNHSVFSSSEIQFDQCKAFDSPFDTNPNDNIADFRF  590

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
            G PFNL   DY+     V PLPK+D+  WY
Sbjct  591  GSPFNLAAVDYT-----VDPLPKQDVSMWY  615



>gb|KJB20248.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20249.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20250.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
Length=615

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 91/145 (63%), Gaps = 9/145 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ+MI++LMS YD NIQG+K  NP N+  A+ Q +    IQ  Q  + +
Sbjct  474  FDLSGLGVPEDGQKMISELMSVYDNNIQGSKNMNPGNNPIAEGQNILHPKIQQPQDEYFR  533

Query  648  NQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNV--SSIETLPFMFGPPFNLP  478
             +    GN F++S++ +   MF  G+ QF++ K LNS F    ++  + P MFG PF+L 
Sbjct  534  GE----GNFFEDSSMPNNHQMFPQGEGQFDRFKGLNSLFETEHNNNNSFPLMFGSPFDLS  589

Query  477  PSDYSEGL--LGVPPLPKKDILSWY  409
              DY E L  +G+  +P++D+  W+
Sbjct  590  TFDYKEDLQTVGMDTIPRQDVSIWF  614



>ref|XP_006384758.1| EIN3-like family protein [Populus trichocarpa]
 gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa]
Length=617

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 92/147 (63%), Gaps = 8/147 (5%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFNLSG  VPEDGQ+MI++LMS YDTNIQGNK +N  N+   +   + Q  IQ  Q    
Sbjct  473  SFNLSG--VPEDGQKMISELMSIYDTNIQGNKNTNRGNNLVTEGHNVFQPKIQHQQDNHF  530

Query  651  QNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNVSSIET-LPFMFGPPFNL  481
            ++Q  +I G+IF+ SNI+    MF+  G QF++ K LNSPF  +   +    MFG PF+L
Sbjct  531  RSQSNMINGSIFEGSNINQNHQMFSQEGGQFDRFKPLNSPFETNQNNSGFNLMFGSPFDL  590

Query  480  PPSDYSEGL--LGVPPLPK-KDILSWY  409
               DY + L  LG+  LPK +D+ +W+
Sbjct  591  SSFDYKDDLQVLGMDTLPKHQDVSTWF  617



>ref|XP_004501972.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501973.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=624

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 91/151 (60%), Gaps = 16/151 (11%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQP-LQQTNIQCHQGGF  655
            S +L+GLGVPEDGQ+MI DLM+ YDTN+QGN      N   A E P L Q NIQ  QG F
Sbjct  479  SIDLTGLGVPEDGQKMIGDLMTGYDTNVQGN------NRVAAVENPNLPQPNIQPQQGSF  532

Query  654  LQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN----VSSIETLPFMFGP  493
             ++QGI+  GN+FQE+++S+   MF   + QF++ KALNSPF      +       MFG 
Sbjct  533  YRSQGIVMGGNLFQETSMSNNHHMFARDEGQFDRFKALNSPFENHHNHNHNNNYHLMFGS  592

Query  492  PFNLPPSDYSEGL--LGVPPLPKK-DILSWY  409
              +L   D+ + +  +GV  L K+ DI  WY
Sbjct  593  HCDLTSFDFKDDMHGVGVDGLQKQPDISIWY  623



>ref|XP_002312841.2| EIN3-like family protein [Populus trichocarpa]
 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa]
Length=625

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 98/162 (60%), Gaps = 23/162 (14%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNS----GPAKEQPL---QQTN--  679
            SF+LSG  VPEDGQ+MI++LMS YDTNIQGNK +NP N+    G    QP    QQ N  
Sbjct  466  SFDLSG--VPEDGQKMISELMSNYDTNIQGNKNTNPVNNLVTGGHHVFQPKIQHQQDNHN  523

Query  678  -----IQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNVS-S  523
                 IQ  QG   ++QG +I GN+F+ESNI+S   +F+  G QF++ K LNSPF  S +
Sbjct  524  VFQPKIQHQQGNHFRSQGNVIDGNVFKESNINSNHQLFSQEGGQFDRFKPLNSPFETSQN  583

Query  522  IETLPFMFGPPFNLPPSDYSEGL--LGVPPLPK--KDILSWY  409
              +   MF  P +L   +Y E L  LG+  LPK  +D+  W+
Sbjct  584  NSSFNLMFSSPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF  625



>dbj|BAB64344.1| EIN3-like protein [Cucumis melo]
Length=693

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 82/138 (59%), Gaps = 8/138 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFL  652
            F LS LGVPEDGQ++ ++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + 
Sbjct  472  FRLSTLGVPEDGQKLTSELMSIYDTNIQGNKNNLNTVNSATTENQNLPQLKIQPQQDDYF  531

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN-----VSSIETLPFMFGP  493
            +NQG+ + GN F  SN+SS+  MFT  + QF++ K +NSPF       ++      MF  
Sbjct  532  RNQGLMMEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNSPFENNHHHHNNNNNFHLMFSS  591

Query  492  PFNLPPSDYSEGLLGVPP  439
            PF+L   DY E +  V P
Sbjct  592  PFDLSTFDYKEEVPSVQP  609



>gb|KHG09663.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=634

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 86/146 (59%), Gaps = 9/146 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ+MI++LMS YD N+Q NK ++P  +   + Q L Q   Q  Q  F +
Sbjct  492  FDLSGLGVPEDGQKMISNLMSIYDNNVQANKNASPIKNPVTEGQNLLQPKTQQQQDEFFR  551

Query  648  NQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS---SIETLPFMFGPPFNL  481
             QG+   + F ESNI +   +   G+ QF+Q K  NSPF  +   +      MFG PF+L
Sbjct  552  GQGL---SFFNESNIPANNQILPQGEAQFDQLKTSNSPFETTYNNNNNGFKLMFGSPFDL  608

Query  480  PPSDYSEGLL--GVPPLPKKDILSWY  409
               DY++ L   G+  +PK+D+  W+
Sbjct  609  SSFDYNDDLQADGMDAMPKQDVSIWF  634



>gb|AFK45610.1| unknown [Lotus japonicus]
Length=238

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 89/157 (57%), Gaps = 16/157 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQP-------LQQTNIQ  673
            S +L+GLGVPEDGQ+MI DLMS YDTN+QG+K  +  N   A E P        QQ  IQ
Sbjct  81   SIDLTGLGVPEDGQKMIGDLMSVYDTNVQGSKNLSSSNRVVAAENPNVPQPSIQQQQGIQ  140

Query  672  CHQGGFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNV---SSIETLP  508
              QG F +   +I  GN F+E+NIS+   MF   + QF++ KALNSPF     SS     
Sbjct  141  QQQGSFFRGHSVIMEGNFFEEANISTNHHMFAREENQFDRFKALNSPFEAPHQSSNNNFH  200

Query  507  FMFGPPFNLPPSDYSEGL---LGVPPLPKK-DILSWY  409
             MFG P +L   D+ E +   +G+    K+ DI  WY
Sbjct  201  LMFGSPCDLASFDFKEDMQQGVGMEAHQKQPDISIWY  237



>ref|XP_006470438.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470439.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
Length=621

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 86/154 (56%), Gaps = 18/154 (12%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCH  667
            SF++SGLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     H
Sbjct  473  SFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQ-----H  527

Query  666  QGGFLQNQG-IIPGNIFQESNI-SSTRPMFTSGD-QFEQPKALNSPFN---VSSIETLPF  505
            Q  +   QG ++ GN+F+ SN+  +   MFT  + QF++ K +NSPF      +      
Sbjct  528  QQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGNNNNFSL  587

Query  504  MFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  409
            MF  PF+L   DY E     GV  +PK D   W+
Sbjct  588  MFESPFDLGSFDYKEDFQAAGVDTMPKHDTSVWF  621



>ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
 gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
Length=617

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 90/151 (60%), Gaps = 14/151 (9%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            +F+LSG  VPEDGQ+MI++LMS YDTN+QGNK  N  N+   +   L Q  I   Q  + 
Sbjct  470  AFDLSG--VPEDGQKMISELMSIYDTNVQGNK--NSGNNQVTEGHNLFQPKIHHQQDNYF  525

Query  651  QNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFN-----VSSIETLPFMFGP  493
            ++Q  ++  NIF++SNI +   MF+  G QF++ KALNSPF       ++  +   MFG 
Sbjct  526  RSQSNVMDANIFEDSNIHNNHQMFSQDGSQFDRFKALNSPFESSNQHNNNNSSFNLMFGS  585

Query  492  PFNLPPSDYSEGL--LGVPPLPK-KDILSWY  409
            PF+L   DY E L  L +  LPK +D   W+
Sbjct  586  PFDLSSFDYKEDLQGLAMESLPKQQDAAIWF  616



>gb|KDO66378.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66379.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66380.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=621

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 86/154 (56%), Gaps = 18/154 (12%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCH  667
            SF++SGLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     H
Sbjct  473  SFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQ-----H  527

Query  666  QGGFLQNQG-IIPGNIFQESNI-SSTRPMFTSGD-QFEQPKALNSPFN---VSSIETLPF  505
            Q  +   QG ++ GN+F+ SN+  +   MFT  + QF++ K +NSPF      S      
Sbjct  528  QQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGSNNNFSL  587

Query  504  MFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  409
            MF  PF+L   DY E     GV  +PK D   W+
Sbjct  588  MFESPFDLGSFDYKEDFQAAGVDTMPKHDSSVWF  621



>gb|KHN33829.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=621

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 7/147 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+GLGVPEDGQ+MI+DLMS YDTN Q NK  +  N   A+   L Q  I+  Q  F +
Sbjct  474  IDLTGLGVPEDGQKMISDLMSIYDTNFQSNKNLSSSNHVAAENPSLPQPGIRQQQDNFFR  533

Query  648  NQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNS-PFNVSSIETLPFMFGPPFNLP  478
            +QGI + GN ++E+N+ +   MF   + QF++ KALN+ PF  +       MFG P +L 
Sbjct  534  SQGITMEGNFYEEANMPNNHHMFAREESQFDRFKALNAPPFESNHNNNFHLMFGSPCDLA  593

Query  477  PSDYSEGLL---GVPPLPKK-DILSWY  409
              D+ E +    G+  L K+ DI  WY
Sbjct  594  SFDFKEDMQGGGGMDALQKQADISIWY  620



>ref|XP_012066274.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066275.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066276.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 gb|KDP42896.1| hypothetical protein JCGZ_23838 [Jatropha curcas]
Length=619

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 88/156 (56%), Gaps = 17/156 (11%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNK--ISNPRNSGPAKEQPLQQTNIQCHQ--  664
            +F+LSG  VPEDGQ+MI++LMS YDTNIQGNK   +        +   L Q  I  H   
Sbjct  465  TFDLSG--VPEDGQKMISELMSIYDTNIQGNKNTNAGNNGVNVNESHSLFQPKIHHHHQP  522

Query  663  GGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPF------NVSSIETLP  508
              + + Q  +I GNIF+ESNI +   MF+   +QFE+ KALNSPF        ++     
Sbjct  523  DNYFRGQANVIEGNIFEESNIHNNHQMFSQDSNQFERFKALNSPFESNHHPTAAATNNSS  582

Query  507  FMFGPPFNLPPSDYSEGLLGV--PPLPK-KDILSWY  409
            F FG PF+L   DY E L G+    LPK +D+  W+
Sbjct  583  FKFGSPFDLASFDYKEDLQGLVMDALPKQQDVSIWF  618



>ref|XP_003543159.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=621

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 7/147 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+GLGVPEDGQ+MI+DLMS YDTN Q NK  +  N   A+   L Q  I+  Q  F +
Sbjct  474  IDLTGLGVPEDGQKMISDLMSIYDTNFQSNKNLSSSNHVAAENPSLPQPGIRQQQDNFFR  533

Query  648  NQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNS-PFNVSSIETLPFMFGPPFNLP  478
            +QGI + GN ++E+N+ +   MF   + QF++ KALN+ PF  +       MFG P +L 
Sbjct  534  SQGITMEGNFYEEANMPNNHHMFAREESQFDRFKALNAPPFESNHNNNFHLMFGSPCDLA  593

Query  477  PSDYSEGLL---GVPPLPKK-DILSWY  409
              D+ E +    G+  L K+ DI  WY
Sbjct  594  SFDFKEDMQGGGGMDALQKQADISIWY  620



>ref|XP_006446380.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446381.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59620.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59621.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=596

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 83/154 (54%), Gaps = 18/154 (12%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCH  667
            SF++SGLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     H
Sbjct  448  SFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPSNNAVVTEGQNTLQPRAQ-----H  502

Query  666  QGGFLQNQG-IIPGNIFQESNISSTRPMF--TSGDQFEQPKALNSPFN---VSSIETLPF  505
            Q  +   QG ++ GN+F+ SN+     +      +QF++ K +NSPF      S      
Sbjct  503  QQEYYHGQGAVMDGNLFEGSNMHDNNHLMFPREENQFDRFKIMNSPFENNSSGSNNNFSL  562

Query  504  MFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  409
            MF  PF+L   DY E     GV  +PK D   W+
Sbjct  563  MFESPFDLGSFDYKEDFQAAGVDTMPKHDSSVWF  596



>ref|XP_011043514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Populus euphratica]
Length=632

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 95/161 (59%), Gaps = 23/161 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNS----GPAKEQP---LQQTN---  679
            F+LSG  VPEDGQ+MI++LMS YDTNIQ NK +NP N+    G    QP    QQ N   
Sbjct  474  FDLSG--VPEDGQKMISELMSIYDTNIQSNKNTNPVNNLVTGGHHVFQPKIQRQQDNHNV  531

Query  678  ----IQCHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNVS-SI  520
                IQ  QG   ++QG +I GN+F+E NI+S   +F+  G QF++ K LNSPF  S + 
Sbjct  532  FQPKIQHQQGNHFRSQGNVIGGNVFKEYNINSNHQLFSQEGGQFDRFKPLNSPFETSQNN  591

Query  519  ETLPFMFGPPFNLPPSDYSEGL--LGVPPLPK--KDILSWY  409
             +   MF  P +L   +Y E L  LG+  LPK  +D+  W+
Sbjct  592  SSFNLMFSSPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF  632



>ref|XP_006446382.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446383.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59622.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59623.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=621

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 83/154 (54%), Gaps = 18/154 (12%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCH  667
            SF++SGLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     H
Sbjct  473  SFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPSNNAVVTEGQNTLQPRAQ-----H  527

Query  666  QGGFLQNQG-IIPGNIFQESNISSTRPMF--TSGDQFEQPKALNSPFN---VSSIETLPF  505
            Q  +   QG ++ GN+F+ SN+     +      +QF++ K +NSPF      S      
Sbjct  528  QQEYYHGQGAVMDGNLFEGSNMHDNNHLMFPREENQFDRFKIMNSPFENNSSGSNNNFSL  587

Query  504  MFGPPFNLPPSDYSEGL--LGVPPLPKKDILSWY  409
            MF  PF+L   DY E     GV  +PK D   W+
Sbjct  588  MFESPFDLGSFDYKEDFQAAGVDTMPKHDSSVWF  621



>ref|XP_003555660.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN46383.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=624

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+GLGVPEDG++MI DLMS YDTN+Q NK  +  N   A+   L Q  IQ     F +
Sbjct  474  IDLTGLGVPEDGKKMITDLMSIYDTNVQSNKNLSSSNHVSAENPNLPQPGIQQQHDNFFR  533

Query  648  NQGI-IPGNIFQESNIS-STRPMFTSGD-QFEQPKALNS-PFNVS-SIETLPFMFGPPFN  484
            +QGI + GN F+E+N+S +   MF   + QF++ KALN+ PF  + +      MFG P +
Sbjct  534  SQGISMEGNFFEEANMSNNNHHMFAREEGQFDRFKALNAPPFETNHNNNNFHLMFGSPCD  593

Query  483  LPPSDYSE----GLLGVPPLPKK-DILSWY  409
            L   D+ E    G++G+  L K+ DI  WY
Sbjct  594  LASFDFKEDMQGGVVGMDALQKQPDISIWY  623



>gb|KJB83827.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
 gb|KJB83828.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
Length=594

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 87/145 (60%), Gaps = 8/145 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGLGVPEDGQ+MI+DLMS YD N+Q NK  +P  +   + Q L Q   Q  Q  F +
Sbjct  453  FDLSGLGVPEDGQKMISDLMSIYDNNVQANKNVSPIKNPVTEGQNLLQLKTQQQQDEFFR  512

Query  648  NQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS--SIETLPFMFGPPFNLP  478
             QG+   + F ESNI +   +   G+ QF++ K  NSPF  +  +  +   MFG PF+L 
Sbjct  513  GQGL---SFFNESNIPANNQILPQGEAQFDRLKTSNSPFETTYNNNNSFKLMFGSPFDLS  569

Query  477  PSDYSEGL--LGVPPLPKKDILSWY  409
              DY++ L  +GV  +PK+D+  W+
Sbjct  570  SFDYNDDLQAVGVDTMPKQDVSIWF  594



>gb|AHC70433.1| ethylene insensitive 3 protein [Cucurbita pepo subsp. pepo]
Length=618

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 85/152 (56%), Gaps = 20/152 (13%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFL  652
            F+LS LGVPED Q+MI +LMS YDTNIQGN+ + N  NS   + Q L Q  IQ  Q  + 
Sbjct  474  FDLSTLGVPEDDQKMIRELMSIYDTNIQGNQSNVNTGNSAITENQNLPQLKIQPQQDEYF  533

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGDQFEQPKALNSP------FNVSSIETLPFMFGP  493
            +NQGI + GN F+ SN+SS+        QF Q K +NSP       + ++      MFG 
Sbjct  534  RNQGIMMDGNFFEGSNVSSS--------QFNQFKPMNSPFENNHHEHNNNNNNFHMMFGS  585

Query  492  PFNLPPSDYSEGLLGVPPL----PKKDILSWY  409
            PF+L   D+ E L G   +     ++DI  WY
Sbjct  586  PFDLSTFDFKEELPGAAAIDTLSKQQDIPLWY  617



>ref|XP_002310961.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 ref|XP_006379422.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEE88328.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 gb|ERP57219.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 82/144 (57%), Gaps = 15/144 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN+SGLG+PEDG++ I+DLMSFYDTN+Q +K  NP ++        QQ   Q       
Sbjct  471  SFNVSGLGLPEDGKKSISDLMSFYDTNLQRDKNMNPGSAN-------QQQKFQFQLDDSF  523

Query  651  QNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNL  481
              QG I G NI + +++      F S + QF+  KA +S F+ +  + +  F FG PF +
Sbjct  524  YGQGAIMGNNITEVTSMPVNSSAFPSTEMQFDHCKAFDSAFDANVNDNVADFRFGSPFTM  583

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
            PP DYS     + P+PK+D   WY
Sbjct  584  PPVDYS-----MDPMPKQDAGMWY  602



>gb|KDO66375.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66376.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66377.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=582

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 18/149 (12%)
 Frame = -1

Query  816  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCHQGGFL  652
            GLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     HQ  + 
Sbjct  439  GLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQ-----HQQEYY  493

Query  651  QNQG-IIPGNIFQESNI-SSTRPMFTSGD-QFEQPKALNSPFN---VSSIETLPFMFGPP  490
              QG ++ GN+F+ SN+  +   MFT  + QF++ K +NSPF      S      MF  P
Sbjct  494  HGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGSNNNFSLMFESP  553

Query  489  FNLPPSDYSEGL--LGVPPLPKKDILSWY  409
            F+L   DY E     GV  +PK D   W+
Sbjct  554  FDLGSFDYKEDFQAAGVDTMPKHDSSVWF  582



>ref|XP_010247605.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=618

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 85/147 (58%), Gaps = 7/147 (5%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ-QTNIQCHQGGF  655
            +F+LSGLG+PEDGQ+ I++LMSFYD+N+Q NK SNP N      Q  + Q  +Q  +  +
Sbjct  472  TFSLSGLGLPEDGQKTISELMSFYDSNLQRNKCSNPGNVAAMDGQNSEPQPKVQLEENFY  531

Query  654  LQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP--FMFGPPFN  484
             Q    + GN+F+E+N+     MF   + QF+Q K  + P   ++ + +P  F FG PFN
Sbjct  532  GQGSA-VGGNMFEENNMPMNHQMFPREEIQFDQYKVFDPPAYETNHDDIPSDFRFGSPFN  590

Query  483  LPPSDYSEGL--LGVPPLPKKDILSWY  409
            +P  D+ E L    V  + K +   WY
Sbjct  591  MPSVDFGEVLPRGTVETMSKTESSIWY  617



>gb|AFI61908.1| ethylene insensitive 3-like 2 protein [Paeonia suffruticosa]
Length=607

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQC-HQGGF  655
            SF+L  L VPE+GQ+ I++LMSFYD N  GN   NP N    ++  LQ   I C  Q  F
Sbjct  465  SFDLPTLRVPEEGQKSIDELMSFYDLNFHGNGNINPGNMAMTQDLNLQHPKIHCQQQDRF  524

Query  654  LQNQGI-IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-NVSSIETLPFMFGPPFNL  481
            LQ +G+ I G++F +SNI +   +F  G QF+  K    P  N     T   +FG P +L
Sbjct  525  LQGRGVTIDGDLFADSNIPNNHQIFPRGGQFDGCKVSIPPLINHHDDNTYNMIFGSPVHL  584

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
               DY+   L +  L K+D  +WY
Sbjct  585  ASVDYAG--LAMESLSKQDGSTWY  606



>ref|XP_003543154.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN33830.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=618

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 6/146 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+GL V ++GQ+MI DLM+ YDTN++GNK ++  N   A+   L Q  +Q  Q  F++
Sbjct  472  IDLTGLEVSDNGQKMITDLMTNYDTNVRGNKKTSSCNHLAAENFDLPQHAMQQQQDNFIR  531

Query  648  NQGIIP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLP  478
             QGI   GNIF E+N+ +   MF   + QF++ KALN+PF  + +      MFG   +L 
Sbjct  532  GQGITAEGNIFDEANMPNNHHMFAREEGQFDRFKALNAPFETNHNNNNFHSMFGSLCDLA  591

Query  477  PSDYSEGL--LGVPPLPKK-DILSWY  409
              D+ E +  +G+  L K+ DI  WY
Sbjct  592  SFDFKEDMQGVGMDTLQKQPDISIWY  617



>emb|CAB95830.1| hypothetical protein [Cicer arietinum]
Length=354

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 83/148 (56%), Gaps = 17/148 (11%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQ+MI +LMS YDTN+ GNK ++  N    + Q L Q  IQ  Q  F 
Sbjct  216  SFDLTGLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVAVENQNLSQPCIQQQQDNFF  275

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLP  478
             +QG+    + + +N       FT  + QF++ K +NSPF  + +   +  MFG P +L 
Sbjct  276  SSQGM----VMEAANF------FTRDESQFDRFKPINSPFETNHNNNNIHLMFGSPCDLA  325

Query  477  PSDYSEGL----LGVPPLPKK-DILSWY  409
              D+ E +    +G+    K+ D+  WY
Sbjct  326  SFDFKEDIQLQGVGIDTFHKQPDMSIWY  353



>gb|KDO53815.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53816.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53817.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53818.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53819.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=614

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 83/150 (55%), Gaps = 24/150 (16%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNK--------ISNPRNSGPAKEQPLQQTNIQ  673
            +N+SGLG+P+DGQ+MI+DLMSFYDTN+Q NK        ++  RN  P      +Q   Q
Sbjct  478  YNVSGLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGCLNVTEDRNQQP------EQQKFQ  531

Query  672  CHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMF  499
                    NQG+    + +  N+    P+F+S +  F+Q KA +SPF+ +  + +  F F
Sbjct  532  LQLDDSFYNQGV---GVMKGGNMPVNNPVFSSTEVHFDQCKAFDSPFDNNPGDNIAEFRF  588

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
              PFN+   DY      + P+PK+D+  WY
Sbjct  589  NSPFNIASVDYP-----MDPIPKQDVSMWY  613



>ref|XP_010106127.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07787.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=617

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 83/145 (57%), Gaps = 12/145 (8%)
 Frame = -1

Query  822  LSGLGVPEDGQRMINDLMSFYDTNI-QGNKISNPRNSGPAKEQPLQQTN--IQCHQGGFL  652
            ++GLG+PEDGQ+MI+DL+SFYD N+ Q  K  NP N    +    QQ N   Q   G + 
Sbjct  477  IAGLGLPEDGQKMISDLLSFYDINMPQRRKSLNPGNFTATEHHDPQQQNYQFQMDDGFYS  536

Query  651  QNQGIIPGNIFQ--ESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFN  484
            Q  G++ GN     ++NI S   +F S D QF+Q KA +S  + +  + +    FG PFN
Sbjct  537  QGSGVMGGNTNAPLQTNIPSHHAVFPSSDVQFDQCKAFDSSLDNNPTDNISDIRFGSPFN  596

Query  483  LPPSDYSEGLLGVPPLPKKDILSWY  409
            L P++Y+     V  LPK+D+  WY
Sbjct  597  LAPAEYT-----VDSLPKQDVSLWY  616



>ref|XP_006432540.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006432541.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006471295.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471296.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471297.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471298.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X4 [Citrus 
sinensis]
 gb|ESR45780.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 gb|ESR45781.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
Length=614

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 83/150 (55%), Gaps = 24/150 (16%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNK--------ISNPRNSGPAKEQPLQQTNIQ  673
            +N+SGLG+P+DGQ+MI+DLMSFYDTN+Q NK        ++  RN  P      +Q   Q
Sbjct  478  YNVSGLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGCLNVTEDRNQQP------EQQKFQ  531

Query  672  CHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMF  499
                    NQG+    + +  N+    P+F+S +  F+Q KA +SPF+ +  + +  F F
Sbjct  532  LQLDDSFYNQGV---GVMKGGNMPVNNPVFSSTEVHFDQCKAFDSPFDNNPGDNIAEFRF  588

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
              PFN+   DY      + P+PK+D+  WY
Sbjct  589  NSPFNIASVDYP-----MDPIPKQDVSMWY  613



>ref|XP_006432536.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432537.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432538.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432539.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006471293.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 gb|ESR45776.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45777.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45778.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45779.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
Length=617

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 83/145 (57%), Gaps = 10/145 (7%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ--QTNIQCHQGGF  655
            FN+SGL +P+DGQ+MI DLMSFYDTN Q NK  N  N     +Q  Q  Q   Q      
Sbjct  477  FNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGNLNAIGDQNQQQEQRKFQLQMDDS  536

Query  654  LQNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFN  484
              +QG + G N+  +SN+     +F+S + +F+Q KA +SP++ +  +++  F F  PFN
Sbjct  537  FYSQGAVMGRNMPGQSNMPMNNSVFSSAEIRFDQCKAFDSPYDANPSDSIADFRFNSPFN  596

Query  483  LPPSDYSEGLLGVPPLPKKDILSWY  409
            +   DY+     +  +PK+D+  WY
Sbjct  597  MASVDYA-----MDSIPKQDVSLWY  616



>ref|XP_004491182.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004491183.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=611

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 83/148 (56%), Gaps = 17/148 (11%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQ+MI +LMS YDTN+ GNK ++  N    + Q L Q  IQ  Q  F 
Sbjct  473  SFDLTGLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVAVENQNLSQPCIQQQQDNFF  532

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLP  478
             +QG+    + + +N       FT  + QF++ K +NSPF  + +   +  MFG P +L 
Sbjct  533  SSQGM----VMEAANF------FTRDESQFDRFKPINSPFETNHNNNNIHLMFGSPCDLA  582

Query  477  PSDYSEGL----LGVPPLPKK-DILSWY  409
              D+ E +    +G+    K+ D+  WY
Sbjct  583  SFDFKEDIQLQGVGIDTFHKQPDMSIWY  610



>ref|NP_001275851.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
 gb|ADI40102.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
Length=614

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 24/150 (16%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNK--------ISNPRNSGPAKEQPLQQTNIQ  673
            +N+SGLG+P+DGQ+MI+DLMSFYDTN+Q NK        ++  RN  P      +Q   Q
Sbjct  478  YNVSGLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGCLNVTEDRNQQP------EQQKFQ  531

Query  672  CHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMF  499
                    NQG+    + +  N+    P+F+S +  F+Q KA +SPF+ +  + +  F F
Sbjct  532  LQLDDSFYNQGV---GVMKGGNMPVNNPVFSSTEVHFDQCKAFDSPFDNNPGDNIAEFRF  588

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
              PFN+   +Y      + P+PK+D+  WY
Sbjct  589  NSPFNVASVNYP-----MDPIPKQDVSMWY  613



>ref|XP_002315400.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEF01571.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 15/144 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN+SGL + EDGQ+ I+DLMSFYDTN+Q +K  NP ++        QQ   Q       
Sbjct  471  SFNVSGLRLSEDGQKTISDLMSFYDTNLQRDKNINPGSAN-------QQQKFQFQLDDSF  523

Query  651  QNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNL  481
              QG + G NI + +++    P+F+S + QF+  KA +S F+ +  + +  F FG PF  
Sbjct  524  YGQGAMVGNNITEATSMPVNNPVFSSTENQFDHCKAFDSAFDTNVNDNITDFRFGSPFPS  583

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
            PP DYS  L+      K+D+  WY
Sbjct  584  PPVDYSMDLIQ-----KQDVGMWY  602



>ref|XP_010106128.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07788.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=607

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 21/150 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNI-QGNKISNP------RNSGPAKEQPLQQTNIQC  670
            FN++GL +PEDGQ+MI+DLMSFYD N  Q +K  NP       N  PA+    Q+   Q 
Sbjct  468  FNVTGLDLPEDGQKMISDLMSFYDNNAQQRSKDLNPGTLNAMENHNPAQ----QKYQFQI  523

Query  669  HQGGFLQNQGIIP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPF-NVSSIETLPFMF  499
                F   QG++  GNI +++NISS   +F S + QF+Q KA +SPF N  +   +   F
Sbjct  524  DDSYF--GQGVVMGGNIPEQANISSQNAVFPSTEVQFDQCKAFDSPFDNNPNDNIVDLRF  581

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
              PFN+ P ++      V  LPK+D+  WY
Sbjct  582  SSPFNMAPVEFP-----VDSLPKQDVSLWY  606



>gb|AAL76271.1|AF467783_1 transcription factor EIL2 [Vigna radiata]
Length=622

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 83/148 (56%), Gaps = 8/148 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH-QGGFL  652
             +L+GL V EDG++ I+DLM+ YDTN+QGNK  +  N    +     Q  +Q H Q  F+
Sbjct  474  IDLTGLEVSEDGKKRISDLMTNYDTNVQGNKNMSSCNRVAGEVLNFPQHGMQQHQQDNFI  533

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFN  484
            + +GI + GN+F E+ +S+    F   + QF++ KALNSPF  +      F  MFG   +
Sbjct  534  RGRGITMEGNVFDEATMSNNHHTFARDECQFDRFKALNSPFETNHNNNNNFHSMFGSFCD  593

Query  483  LPPSDYSEGL--LGVPPLPKK-DILSWY  409
            L   D+ E +  +G+  L K+ D   WY
Sbjct  594  LASFDFKEDMQGVGMDALQKQTDFSVWY  621



>ref|XP_010067064.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067065.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067066.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 gb|KCW65129.1| hypothetical protein EUGRSUZ_G02632 [Eucalyptus grandis]
Length=617

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 78/144 (54%), Gaps = 7/144 (5%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN+ G+G+PEDGQ+ I++LMSFYD N+Q N  S  +   P+ EQ L   N+Q   G  L
Sbjct  477  SFNIRGIGLPEDGQKTISNLMSFYDVNLQQNSTSAGKLGAPSNEQQL--LNVQHSMGDSL  534

Query  651  QNQG-IIPGNIFQESNISSTRPMFTS-GDQFEQPKALNSPFNVSSIE-TLPFMFGPPFNL  481
               G  + G   +E N+     +F S G Q +Q KA +SPF     + T+   FG PF++
Sbjct  535  FAHGAFMGGKTHEEINLPLNHSVFQSMGSQHDQSKAFDSPFEFCLNDGTVDSRFGSPFSV  594

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
              +      + +  LPK+D   WY
Sbjct  595  TAAAADCNRMDL--LPKQDGFVWY  616



>ref|XP_008368189.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=659

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLG+ EDGQ+MI++LMSFYD+NIQ NK  NP N     +   QQ N Q      L 
Sbjct  521  FDSSGLGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLNDVDDCNQQQANFQFPMNDNLX  580

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L
Sbjct  581  GQGLDIGRNMNMSEQSPMPMLHPDFSSPEVQFDQLMAFDSPFGNNSNEDVDIRFGSPLHL  640

Query  480  PPSDY  466
             P  Y
Sbjct  641  SPVGY  645



>ref|XP_007146084.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
 gb|ESW18078.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
Length=624

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 9/149 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNK--ISNPRNSGPAKEQPLQQTNIQCHQGGF  655
             +L+GL V EDG++ I+DLMS YDTN+QGN   IS+  N   A+   L Q  +Q     F
Sbjct  475  IDLTGLEVSEDGKKRISDLMSNYDTNVQGNSKNISSSCNRVAAEVLNLTQHGMQQQHDNF  534

Query  654  LQNQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIET-LPFMFGPPFN  484
            ++++G  + GN+F E+ +S+    F   + QF++ KALN+PF  +   +    MFG   +
Sbjct  535  IRSRGNTMEGNVFDEATMSNNHHTFARDECQFDRFKALNTPFETNHNNSNFHSMFGSFCD  594

Query  483  LPPSDYSE---GLLGVPPLPKK-DILSWY  409
            L   D+ E   G++G+  + K+ D   WY
Sbjct  595  LASFDFKEDMQGVIGMDVVQKQPDFSVWY  623



>ref|XP_003545483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=610

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 81/146 (55%), Gaps = 14/146 (10%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N   A+   L Q ++Q  Q  F 
Sbjct  473  SFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSTNCVTAENHNLSQASLQ-RQDSFF  531

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVS-SIETLPFMFGPPFNLP  478
              QG ++ GN+F               D+F+    +N+PF+ + +   +  MF  P +L 
Sbjct  532  PGQGMVLEGNLFAREE--------GQFDRFKATMNMNTPFDTNHNNNNIHLMFNSPCDLS  583

Query  477  PSDYSEGL--LGVPPLPKKDILS-WY  409
              D+ E +  +G+  L K+  +S WY
Sbjct  584  SFDFKEDIQGVGMDSLQKQQEVSIWY  609



>gb|ADE41153.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=659

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLG+ EDGQ+MI++LMSFYD+NIQ NK  NP N     +   QQ N Q      L 
Sbjct  521  FDSSGLGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLNDVDDCNQQQANFQFPMNDNLY  580

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L
Sbjct  581  GQGLDIGRNMNMSEQSPMPMLHPDFSSPEVQFDQLMAFDSPFGNNSNEDVDIRFGSPLHL  640

Query  480  PPSDY  466
             P  Y
Sbjct  641  SPVGY  645



>gb|AGI41323.1| EIN3-like protein [Malus domestica]
Length=659

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLG+ EDGQ+MI++LMSFYD+NIQ NK  NP N     +   QQ N Q      L 
Sbjct  521  FDSSGLGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLNDVDDCNQQQANFQFPMNDNLY  580

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L
Sbjct  581  GQGLDIGRNMNMSEQSPMPMLHPDFSSPEVQFDQLMAFDSPFGNNSNEDVDIRFGSPLHL  640

Query  480  PPSDY  466
             P  Y
Sbjct  641  SPVGY  645



>ref|XP_007146083.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
 gb|ESW18077.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
Length=619

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNK-ISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
             +L+GL V EDGQ+MI+DLM+ Y+TN+QGNK IS+      A+   L+Q  +Q     F+
Sbjct  472  IDLTGLEVSEDGQKMISDLMTNYETNVQGNKNISSCNRIMAAENSCLRQHGMQQPHDNFI  531

Query  651  QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFN  484
            + QGI + GNIF E N+S+   +F   + Q E+ KA+N+PF  +      F  MFG   +
Sbjct  532  RGQGITMEGNIFDEPNMSNNHHIFAREEGQIERFKAMNAPFETNHNNNNNFNSMFGSFCD  591

Query  483  LPPSDYSEGLLGV  445
            L   D+ E + G 
Sbjct  592  LASFDFKEDMQGA  604



>ref|XP_009341360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=659

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 71/125 (57%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLG+ EDGQ+MI++LMSFYD NIQ NK  NP N     ++  QQ N Q      L 
Sbjct  521  FDSSGLGIAEDGQKMISELMSFYDGNIQQNKNCNPGNLNDVDDRNQQQANFQFPMNDNLY  580

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG   G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L
Sbjct  581  GQGPDIGHNMNMSEQSPMPMLHPDFSSPEIQFDQLMAFDSPFGNNSNEDVDIRFGSPLHL  640

Query  480  PPSDY  466
             P  Y
Sbjct  641  APVGY  645



>gb|ADE41155.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=625

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLGV EDGQ+MI+DLMSFYD+NIQ NK  NP N     ++  QQ N Q      L 
Sbjct  485  FDASGLGVAEDGQKMISDLMSFYDSNIQQNKNCNPGNLNVIDDRNQQQANYQFPMNDNLF  544

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
              G+  G   N+ + S +    P F+S + QF+Q  A  SPF  +S E +   F  PF+L
Sbjct  545  GHGVDIGRNMNMSEPSPMLMLHPGFSSPEVQFDQLMAFESPFGNNSSEDVDIRFDSPFHL  604

Query  480  PPSDY  466
                Y
Sbjct  605  AHVGY  609



>gb|KHN38437.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=469

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 81/153 (53%), Gaps = 24/153 (16%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N    +   L Q ++Q  Q  + 
Sbjct  328  SFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSSNCVAVENHNLSQASLQ-QQESYF  386

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKA-----LNSPF--NVSSIETLPFMFG  496
              QG ++ GN F                QF++ KA      ++PF  N S+   +  MF 
Sbjct  387  PGQGMVLEGNFFAREE-----------GQFDRFKATMNMNTHTPFDTNHSNNNNIHLMFN  435

Query  495  PPFNLPPSDYSE---GLLGVPPLPKKDILS-WY  409
             P +L   D+ E   G +G+ PL K+  +S WY
Sbjct  436  SPCDLSSFDFKEDIQGGVGMDPLHKQQEVSIWY  468



>ref|XP_008231880.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=622

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 77/157 (49%), Gaps = 21/157 (13%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN SG G+ +DGQ+MI++LMSFYD+NI  NK SNP N    +    QQ   +       
Sbjct  470  SFNASGFGLADDGQKMISELMSFYDSNIHPNKNSNPGNLNVVEGHNQQQAGFRFAMNDNF  529

Query  651  QNQGIIPGNIFQE---------SNISSTRPM------FTSGD-QFEQPKALNSPFNVSSI  520
              QG+  G    E          NIS T PM      F S + QF+Q    +SPF  +  
Sbjct  530  FGQGVDMGRNMSEPNSMPVDMGCNISETTPMPMHRQAFPSAEVQFDQCTIFDSPFGDNPN  589

Query  519  ETLPFMFGPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
            +T+   F  P +L P+DY+     V   PK+D   W+
Sbjct  590  DTVDLRFDSPLHLAPADYN-----VLDPPKQDASFWF  621



>gb|EYU46131.1| hypothetical protein MIMGU_mgv1a003270mg [Erythranthe guttata]
Length=595

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 72/145 (50%), Gaps = 31/145 (21%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+L+GLGVPEDGQRMINDLM  YD N   NK S      P+KE             G+++
Sbjct  477  FDLTGLGVPEDGQRMINDLMLCYDDNALTNKGS----IAPSKE-------------GYIR  519

Query  648  NQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS-IETLPFMFGPPFNLPP  475
            NQG ++  NIF++ N           DQ      +NS  N +   E    MF  PFN+  
Sbjct  520  NQGMVLENNIFEDIN---------RFDQCNNRVVMNSTLNPNHPTENFQLMFNSPFNISN  570

Query  474  SDYSEGLLGVPP---LPKKDILSWY  409
             DY+E   GV     + K+D+  WY
Sbjct  571  VDYTESYAGVSRDNNMQKQDLGIWY  595



>ref|XP_003519487.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=614

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 81/153 (53%), Gaps = 24/153 (16%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N    +   L Q ++Q  Q  + 
Sbjct  473  SFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSSNCVAVENHNLSQASLQ-QQESYF  531

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKA-----LNSPF--NVSSIETLPFMFG  496
              QG ++ GN F                QF++ KA      ++PF  N S+   +  MF 
Sbjct  532  PGQGMVLEGNFFAREE-----------GQFDRFKATMNMNTHTPFDTNHSNNNNIHLMFN  580

Query  495  PPFNLPPSDYSE---GLLGVPPLPKKDILS-WY  409
             P +L   D+ E   G +G+ PL K+  +S WY
Sbjct  581  SPCDLSSFDFKEDIQGGVGMDPLHKQQEVSIWY  613



>ref|XP_008357657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=625

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLGV EDGQ+MI++LMSFYD+NIQ NK  NP N     ++  QQ N Q      L 
Sbjct  485  FDASGLGVAEDGQKMISELMSFYDSNIQQNKNCNPGNLNVIDDRNQQQANYQFPMNDNLF  544

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
              G+  G   N+ + S +    P F+S + QF+Q  A  SPF  +S E +   F  PF+L
Sbjct  545  GHGVDIGRNMNMSEPSPMLMLHPGFSSPEVQFDQLMAFESPFGNNSSEDVDIRFDSPFHL  604

Query  480  PPSDY  466
                Y
Sbjct  605  AHVGY  609



>gb|AGI41325.1| EIN3-like protein [Malus domestica]
Length=625

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 76/144 (53%), Gaps = 8/144 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLGV EDGQ+MI++LMSFYD+NIQ NK  NP N     ++  QQ N Q      L 
Sbjct  485  FDASGLGVAEDGQKMISELMSFYDSNIQQNKNCNPGNLNVIDDRNQQQANYQFPMNDNLF  544

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
              G+  G   N+ + S +    P F+S + QF+Q  A  SPF  +S E +   F  PF+L
Sbjct  545  GHGVDIGRNMNMSEPSPMLMLHPGFSSPEVQFDQLMAFESPFGNNSSEDVDIRFDSPFHL  604

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
                Y+     + P   +D   W+
Sbjct  605  AHVGYN----AMDPPVNQDASPWF  624



>ref|XP_010243659.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=615

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 81/147 (55%), Gaps = 8/147 (5%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFNLSGLG+ EDGQ+ I +LMSFYD+N+Q NK  NP       +    Q  IQ  +  + 
Sbjct  470  SFNLSGLGLTEDGQKTIGELMSFYDSNLQRNKGPNPGGVVLGGQNSALQPKIQLEENIYG  529

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNS-PFNVSSIE-TLPFMFGPPFNL  481
            +    I GN+F+E+N+     MF   + QF+Q K  ++ P+  ++ + T  F FG  FN+
Sbjct  530  EGAS-IGGNMFEENNMPMNHQMFHREEIQFDQCKVFDAPPYETNNGDLTSDFRFG-SFNI  587

Query  480  PPSDYSEGL---LGVPPLPKKDILSWY  409
            P  D+ E L       PL K++   WY
Sbjct  588  PSVDFGEDLPRGTVETPLSKQENSIWY  614



>gb|KHN26027.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=614

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 76/145 (52%), Gaps = 8/145 (6%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N   A+   L Q ++Q  Q  F 
Sbjct  473  SFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSTNCVTAENHNLSQASLQ-RQDSFF  531

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
              QG ++ GN+F        R   T           ++  N ++I     MF  P +L  
Sbjct  532  PGQGMVLEGNLFAREEGQFDRFKATMNMNMNMNTPFDTNHNNNNIH---LMFNSPCDLSS  588

Query  474  SDYSEGL--LGVPPLPKKDILS-WY  409
             D+ E +  +G+  L K+  +S WY
Sbjct  589  FDFKEDIQGVGMDSLQKQQEVSIWY  613



>gb|KGN46075.1| hypothetical protein Csa_6G051520 [Cucumis sativus]
Length=431

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 20/149 (13%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSG----PAKEQPLQQT-NIQCHQ  664
            F +SGLG+PEDGQ+MI+DL+SFYD+N+Q +K   P NSG    P      QQ    Q   
Sbjct  293  FRVSGLGLPEDGQKMISDLLSFYDSNLQQDK---PLNSGNLDMPDDHNQQQQLPKFQLQV  349

Query  663  GGFLQNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFG  496
               L +Q  + GN   I Q ++ SS +  F      E   A ++PF +   + +  F FG
Sbjct  350  DDNLYSQAAMVGNTMPIQQHADFSSNKHPFD-----EYKAAFDTPFGMYPNDNISDFRFG  404

Query  495  PPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
             PFNL   DY+        LPK+D   WY
Sbjct  405  SPFNLASIDYA---AADTQLPKQDTPLWY  430



>ref|XP_004140927.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis sativus]
 ref|XP_011656591.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis sativus]
Length=615

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 20/149 (13%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSG----PAKEQPLQQT-NIQCHQ  664
            F +SGLG+PEDGQ+MI+DL+SFYD+N+Q +K   P NSG    P      QQ    Q   
Sbjct  477  FRVSGLGLPEDGQKMISDLLSFYDSNLQQDK---PLNSGNLDMPDDHNQQQQLPKFQLQV  533

Query  663  GGFLQNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFG  496
               L +Q  + GN   I Q ++ SS +  F      E   A ++PF +   + +  F FG
Sbjct  534  DDNLYSQAAMVGNTMPIQQHADFSSNKHPFD-----EYKAAFDTPFGMYPNDNISDFRFG  588

Query  495  PPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
             PFNL   DY+        LPK+D   WY
Sbjct  589  SPFNLASIDYAAADTQ---LPKQDTPLWY  614



>gb|AHC70432.1| ethylene insensitive 3-like protein [Cucurbita pepo subsp. pepo]
Length=599

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 75/154 (49%), Gaps = 44/154 (29%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNK---ISNPRNSGPAKEQPLQQTNIQCHQGG  658
            F+L  LGVPEDGQ+ I++LMS Y+TNIQGNK   I+   N                    
Sbjct  475  FDLLSLGVPEDGQKHISELMSIYNTNIQGNKNNVITITEN--------------------  514

Query  657  FLQNQGI-IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFN-----VSSIETLPFMFG  496
              QNQGI I  N F+ S++SS+  MFT        + +NS F       ++      MFG
Sbjct  515  --QNQGIMIDANFFEGSSLSSSHQMFT--------RPMNSSFENNHQNNNNNNNFHLMFG  564

Query  495  PPFNLPPSDYSE----GLLGVPPLPK-KDILSWY  409
             PF+L   DY E    G   +  LPK +DI  WY
Sbjct  565  SPFDLSTFDYKEEVHGGAAAIDTLPKHQDIPLWY  598



>ref|XP_008456656.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 ref|XP_008456657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
Length=615

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 14/146 (10%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT--NIQCHQGGF  655
            F +SGLG+PEDGQ+MI+DL+SFYD+N+Q +K  N  N     +   QQ     Q      
Sbjct  477  FRVSGLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLDMQDDHNQQQQLPKFQLQVDDN  536

Query  654  LQNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFGPPF  487
            L  Q  + GN   I Q  + SS +  F      E   A +SPF +   + +  F FG PF
Sbjct  537  LYCQATMVGNTMPIQQHPDFSSNKHPFD-----EYKAAFDSPFGMYPNDNISDFRFGSPF  591

Query  486  NLPPSDYSEGLLGVPPLPKKDILSWY  409
            NL   DY+        LPK+D   WY
Sbjct  592  NLASIDYAAADTQ---LPKQDTPLWY  614



>ref|NP_001284429.1| ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 dbj|BAB64345.1| EIN3-like protein [Cucumis melo]
Length=615

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 14/146 (10%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT--NIQCHQGGF  655
            F +SGLG+PEDGQ+MI+DL+SFYD+N+Q +K  N  N     +   QQ     Q      
Sbjct  477  FRVSGLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLDMQDDHNQQQQLPKFQLQVDDN  536

Query  654  LQNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFGPPF  487
            L  Q  + GN   I Q  + SS +  F      E   A +SPF +   + +  F FG PF
Sbjct  537  LYCQATMVGNTMPIQQHPDFSSNKHPFD-----EYKAAFDSPFGMYPNDNISDFRFGSPF  591

Query  486  NLPPSDYSEGLLGVPPLPKKDILSWY  409
            NL   DY+        LPK+D   WY
Sbjct  592  NLASIDYAAADTQ---LPKQDTPLWY  614



>gb|AIS20827.1| EIL [Pyrus x bretschneideri]
Length=600

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 79/144 (55%), Gaps = 11/144 (8%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SG+   +DGQ+MI++LMSFYD+N+Q N+  NP N    + +  QQ+  Q        
Sbjct  463  FNASGV---DDGQKMISELMSFYDSNVQQNQNCNPGNLHIVENRNQQQSKYQFPMNDNFF  519

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N+ + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L
Sbjct  520  GQGVDTGCNINMSEPAPMPMLHPGFASPEVQFDQCIAFDSPFGNNPIENVNMRFDSPLHL  579

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
             P+DY+  ++  P  PK+D   W+
Sbjct  580  APADYN--VMDTP--PKQDAPPWF  599



>ref|XP_009355060.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009355061.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=606

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 79/144 (55%), Gaps = 11/144 (8%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SG+   +DGQ+MI++LMSFYD+N+Q N+  NP N    + +  QQ+  Q        
Sbjct  469  FNASGV---DDGQKMISELMSFYDSNVQQNQNCNPGNLHIVENRNQQQSKYQFPMNDNFF  525

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N+ + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L
Sbjct  526  GQGVDTGCNINMSEPAPMPMLHPGFASPEVQFDQCIAFDSPFGNNPIENVNMRFDSPLHL  585

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
             P+DY+  ++  P  PK+D   W+
Sbjct  586  APADYN--VMDTP--PKQDAPPWF  605



>ref|XP_009759370.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=608

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 73/141 (52%), Gaps = 7/141 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
              +SGLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            
Sbjct  473  MTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILANQNMQQNQTVELPMDDNF  532

Query  648  NQGIIPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPS  472
            N G +     QE++++      ++  Q++Q K   ++PF  +  +   + FG PFN+  S
Sbjct  533  NLGHMEAEA-QETSMTMNSAYTSTEFQYDQCKLPFDAPFTGNLNDITDYRFGSPFNMGGS  591

Query  471  DYSEGLLGVPPLPKKDILSWY  409
            DYS     +  L K+DI +WY
Sbjct  592  DYS-----MDQLTKQDISTWY  607



>gb|AAP04001.1| EIL5 [Nicotiana tabacum]
Length=608

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 73/141 (52%), Gaps = 7/141 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
              +SGLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            
Sbjct  473  MTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILANQNMQQNQTVELPMDDNF  532

Query  648  NQGIIPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPS  472
            N G +     QE++++      ++  Q++Q K   ++PF  +  +   + FG PFN+  S
Sbjct  533  NLGHMEAEA-QETSMTMNSAYTSTEFQYDQCKLPFDAPFTGNLNDITDYRFGSPFNMGGS  591

Query  471  DYSEGLLGVPPLPKKDILSWY  409
            DYS     +  L K+DI +WY
Sbjct  592  DYS-----MDQLTKQDISTWY  607



>gb|EYU35998.1| hypothetical protein MIMGU_mgv1a003505mg [Erythranthe guttata]
Length=581

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 63/142 (44%), Gaps = 44/142 (31%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SF+L+GLGVPEDGQRMINDLMSFYD+N+                                
Sbjct  483  SFDLTGLGVPEDGQRMINDLMSFYDSNV--------------------------------  510

Query  651  QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPP  475
              QGI+       +N +        G  F+  K A ++PFN    E  P MF  PF++P 
Sbjct  511  --QGIVFEENNNNNNSNMHNSGSIFGGPFDHRKAAADAPFNAGPAENFPLMFSSPFDMPS  568

Query  474  SDYSEGLLGVPPLPKKDILSWY  409
             D          LPK+D+  W+
Sbjct  569  MDN---------LPKQDVSIWF  581



>ref|XP_007141570.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
 gb|ESW13564.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
Length=611

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 79/149 (53%), Gaps = 19/149 (13%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQ----  664
            SF++SGLGVPEDGQ+MINDLM+ YDTN+ GN   +  N  PA+     QT +Q HQ    
Sbjct  473  SFSVSGLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNNFVPAENHNFSQTILQQHQQDSR  532

Query  663  GGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS-IETLPFMFGPP  490
              F   QG++  GN F                QFE+ K +N   N+++  +T   MF P 
Sbjct  533  DSFFAGQGMVTEGNFFAREE-----------GQFERFKTMNMNMNMNAPFDTNHMMFNPQ  581

Query  489  FNLPPSDYSEGL-LGVPPLPKKDILS-WY  409
             +L   D  +   +G+ P+ K+  +S W+
Sbjct  582  CDLSSFDLKDIQGVGMDPVHKQQEVSIWF  610



>ref|XP_008346133.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
 ref|XP_008346139.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=606

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SG+   +DGQ+MI++LMSFYD+N+Q NK  NP N      +  QQ+  Q        
Sbjct  469  FNASGV---DDGQKMISELMSFYDSNVQQNKNCNPGNLHIVDNRNQQQSKYQLPMNDNFF  525

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N  + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L
Sbjct  526  GQGVDTGCNINXSEPAPMPMLHPGFASQEVQFDQCIAFDSPFGNNPIENVDMRFDSPLHL  585

Query  480  PPSDY  466
             P+DY
Sbjct  586  APADY  590



>gb|AGV54673.1| ethylene insensitive protein 3 [Phaseolus vulgaris]
Length=609

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 78/149 (52%), Gaps = 20/149 (13%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNS-GPAKEQPLQQTNIQCHQ---  664
            SF++SGLGVPEDGQ+MINDLM+ YDTN+ GN   +  ++  PA+     QT +Q HQ   
Sbjct  472  SFSVSGLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNSNFVPAENHNFSQTILQQHQQDS  531

Query  663  -GGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPP  490
               F   QG++  GN F                QFE+ K +N   N +  +T   MF P 
Sbjct  532  RDSFFAGQGMVTEGNFFAREE-----------GQFERFKTMNMNMN-APFDTNHMMFNPQ  579

Query  489  FNLPPSDYSEGL-LGVPPLPKKDILS-WY  409
             +L   D  +   +G+ P+ K+  +S W+
Sbjct  580  CDLSSFDLKDIQGVGMDPVHKQQEVSIWF  608



>ref|XP_009595535.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=609

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 72/141 (51%), Gaps = 7/141 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
              +SGLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            
Sbjct  474  MTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILTNQNMQQNQTVELPMDDNF  533

Query  648  NQGIIPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPS  472
            N G +     QE++++       +  Q++Q K   ++PF  +  +   + FG PFN+  S
Sbjct  534  NLGHLEAEA-QETSMTMNSAYPLTDFQYDQRKLPFDTPFAGNLNDITDYRFGSPFNMGGS  592

Query  471  DYSEGLLGVPPLPKKDILSWY  409
            DYS     +  L K+DI +WY
Sbjct  593  DYS-----IDQLTKQDISTWY  608



>gb|AGV54306.1| transcription factor EIL1 [Phaseolus vulgaris]
Length=610

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 78/150 (52%), Gaps = 21/150 (14%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNS-GPAKEQPLQQTNIQCHQ---  664
            SF++SGLGVPEDGQ+MINDLM+ YDTN+ GN   +  ++  PA+     QT +Q HQ   
Sbjct  472  SFSVSGLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNSNFVPAENHNFSQTILQQHQQDS  531

Query  663  --GGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGP  493
                F   QG++  GN F                QFE+ K +N   N +  +T   MF P
Sbjct  532  RDSNFFAGQGMVTEGNFFAREE-----------GQFERFKTMNMNMN-APFDTNHMMFNP  579

Query  492  PFNLPPSDYSE-GLLGVPPLPKKDILS-WY  409
              +L   D  +   +G+ P+ K+  +S W+
Sbjct  580  QCDLSSFDLKDIQGVGMDPVHKQQEVSIWF  609



>gb|ADE41154.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=611

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (53%), Gaps = 10/144 (7%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SGLG+ ++GQ+  ++LMSFYD+NIQ NK  NP N      +  QQ+  Q        
Sbjct  473  FNASGLGLVDNGQK--SELMSFYDSNIQQNKNCNPANLHIVDNRNQQQSKYQFPMNDNFF  530

Query  648  NQGIIPGNIFQESNIS---STRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G     S ++      P F S + QF+Q  A +SPF  ++ E +   F  P +L
Sbjct  531  GQGMDVGRNINMSELAPMPMLHPGFASPEVQFDQCLAFDSPFGNNTNENVDIRFESPLHL  590

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
             P+DY+  ++  P  PK+D   W+
Sbjct  591  APADYN--VMDQP--PKQDASLWF  610



>ref|XP_008231879.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=601

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN SGLG+ EDGQ+MI+ LMSFYD+N+Q NK SNP N    ++   QQ   Q       
Sbjct  467  SFNASGLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLNVVEDHNQQQVKFQFPMEDNF  526

Query  651  QNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPF  535
              QG++ G N+ + +++    P+F   + QF+  K  +SP+
Sbjct  527  YGQGLVIGRNMSEPTSLPMLHPVFPPTEIQFDPCKLFDSPY  567



>gb|ACM89299.1| EIN3-like protein EIL1 [Eriobotrya japonica]
Length=558

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 68/125 (54%), Gaps = 7/125 (6%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SG+   +DGQ+MI++LMSFYD+N+Q NK  NP N      +  QQ+  Q        
Sbjct  421  FNASGV---DDGQKMISELMSFYDSNVQQNKNYNPGNLHIVDNRNQQQSKYQFPMNDNFF  477

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   N+ + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L
Sbjct  478  GQGVDTGCNINMSEPAPMPMLHPGFASPEVQFDQCIAFDSPFGNNPIENVDMRFDSPLHL  537

Query  480  PPSDY  466
             P+DY
Sbjct  538  APADY  542



>gb|ACD87815.1| putative ethylene insensitive transcription factor [Vicia faba]
Length=638

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 83/161 (52%), Gaps = 30/161 (19%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQG---  661
            SF+L+GLGV ED Q+MI+DLMS YDTNI GNK ++  N      Q L Q NIQ  Q    
Sbjct  487  SFDLTGLGVSEDSQKMISDLMSVYDTNIIGNKNASSTNCATVGNQNLSQHNIQQQQQHTI  546

Query  660  ------GFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSS---IETL  511
                   F  +QG+    + + +N       FT  + QF++ KA+ +PF  +       L
Sbjct  547  QQQQQENFFSSQGM----VMEAANF------FTREESQFDRFKAVTTPFETNHPNNNNNL  596

Query  510  PFMFGPPFNLPPSDYSE------GLLGVPPLPKK-DILSWY  409
             FM G P +L   D+ E      G++G+  L K+ D  +WY
Sbjct  597  HFMIGSPCDLASFDFREDIQQLQGVVGMENLHKQPDGPTWY  637



>ref|XP_007220648.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
 gb|EMJ21847.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
Length=570

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN SGLG+ EDGQ+MI+ LMSFYD+N+Q NK SNP N    ++   QQ   Q       
Sbjct  436  SFNASGLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLNVVEDHNQQQVKFQFPMEDNF  495

Query  651  QNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPF  535
              QG++ G N+ + +++     +F S + QF+  K  +SP+
Sbjct  496  YGQGLVIGRNMSEPTSLPMLHSVFPSTEIQFDPCKLFDSPY  536



>gb|ABK35086.1| EIL2 [Prunus persica]
Length=601

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            SFN SGLG+ EDGQ+MI+ LMSFYD+N+Q NK SNP N    ++   QQ   Q       
Sbjct  467  SFNASGLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLNVVEDHNQQQVKFQFPMEDNF  526

Query  651  QNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPF  535
              QG++ G N+ + +++     +F S + QF+  K  +SP+
Sbjct  527  YGQGLVIGRNMSEPTSLPMLHSVFPSTEIQFDPCKLFDSPY  567



>gb|AGI41324.1| EIN3-like protein [Malus domestica]
Length=611

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SGLG+ ++GQ+  ++LMSFYD+NI  NK  NP N      +  QQ+  Q        
Sbjct  473  FNASGLGLVDNGQK--SELMSFYDSNIHQNKNCNPANLHIVDNRNQQQSKYQFPMNDNFF  530

Query  648  NQGIIPGNIFQESNISSTRPM------FTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
             QG+   ++ +  N+S   PM      F S + QF+Q  A +SPF  ++ E +   F  P
Sbjct  531  GQGM---DVGRNINMSELAPMPMLHPGFASPEVQFDQCLAFDSPFGNNTNENVDIRFESP  587

Query  489  FNLPPSDYSEGLLGVPPLPKKDILSWY  409
             +L P+DY+  ++  P  PK+D   W+
Sbjct  588  LHLAPADYN--VMDQP--PKQDASLWF  610



>gb|ADZ97022.2| EIL6, partial [Nicotiana tabacum]
Length=607

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 71/140 (51%), Gaps = 7/140 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
              +SGLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            
Sbjct  474  MTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILTNQNMQQNQTVELPMDDNF  533

Query  648  NQGIIPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPS  472
            N G +     QE++++       +  Q++Q K   ++PF  +  +   + FG PFN+  S
Sbjct  534  NLGHLEAEA-QETSMTMNSAYPLTDFQYDQRKLPFDTPFAGNLNDITDYRFGSPFNMGGS  592

Query  471  DYSEGLLGVPPLPKKDILSW  412
            DYS     +  L K+DI +W
Sbjct  593  DYS-----IDQLTKQDISTW  607



>emb|CBI29154.3| unnamed protein product [Vitis vinifera]
Length=148

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN  718
            +FN+SGLG+PEDGQ+MI+DLMSFYDTN+Q NK  NP N
Sbjct  104  AFNVSGLGLPEDGQKMISDLMSFYDTNLQRNKSLNPGN  141



>ref|XP_008364747.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=611

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SGLG+ ++GQ+  ++LMSFYD+NI  NK  NP N      +  QQ+  Q        
Sbjct  473  FNASGLGLVDNGQK--SELMSFYDSNIXQNKNCNPANLHIVDNRNQQQSKYQFPMNDNFF  530

Query  648  NQGIIPGNIFQESNISSTRPM------FTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
             QG+   ++ +  N+S   PM      F S + QF+Q  A +SPF  ++ E +   F  P
Sbjct  531  GQGM---DVGRNINMSELAPMPMLHPGFASPEVQFDQCLAFDSPFGNNTNENVDIRFESP  587

Query  489  FNLPPSDYSEGLLGVPPLPKKDILSWY  409
             +L P+DY+  ++  P  PK+D   W+
Sbjct  588  LHLAPADYN--VMDQP--PKQDASLWF  610



>ref|XP_010544313.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=615

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 78/148 (53%), Gaps = 12/148 (8%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTN-IQCHQGGFL  652
            F+LSG GVPEDGQ+MI +LMS YD N QGN+ ++   +     QP  + + +Q H   F 
Sbjct  472  FDLSGFGVPEDGQKMITELMSMYDRNFQGNQATSMVENQSLNLQPKARNDELQQH---FN  528

Query  651  QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMF-GPPFNLP  478
             ++G  I GN  ++  I +      +G QF  P++ +S  N S+      +F   PF+L 
Sbjct  529  HSEGSSIEGNFLEDLPIKNMFSQGNNGIQFPNPQS-DSAHNNSNNGGFQIVFDSTPFDLA  587

Query  477  PSDYSE-----GLLGVPPLPKKDILSWY  409
              DY +     G+ G P   ++D+  W+
Sbjct  588  SFDYRDDLQAVGMDGTPEQQQQDVSIWF  615



>ref|XP_009355361.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=627

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+ SGLG+ EDG++MI++LMSFYD+NIQ N   NP N     ++  QQ N Q        
Sbjct  487  FDASGLGIAEDGKKMISELMSFYDSNIQQNNNCNPGNLNVIDDRNQQQANYQFPVNDTFF  546

Query  648  NQGIIPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNL  481
             QG+  G   NI + S +    P F+S + QF+Q  A  SP   +  E +   F  PF+L
Sbjct  547  GQGVDIGRNMNISEPSPMLMLHPGFSSPEVQFDQLMAFESPVGNNYSEDVDIRFDSPFHL  606

Query  480  PPSDY  466
             P  Y
Sbjct  607  APVGY  611



>gb|AAL76272.1|AF467784_1 transcription factor EIL1 [Vigna radiata]
Length=609

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 67/132 (51%), Gaps = 24/132 (18%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNI-----QCH  667
            SF +SGLGVPEDGQ+MINDLM+ YDTNI GN   +  N   A+ Q   QT +        
Sbjct  473  SFAVSGLGVPEDGQKMINDLMTIYDTNIIGNNNLSSNNFVAAENQNFSQTMLQQQQQDSR  532

Query  666  QGGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKA--LNSPFNVSSIETLPFMFG  496
            +  +   QG++  GN F                QFE+ KA  +N+PF+ + +     +F 
Sbjct  533  RDNYFTGQGMMTEGNFFAREE-----------GQFERFKAMNMNAPFDTNHM-----LFS  576

Query  495  PPFNLPPSDYSE  460
            P  +L   D+ +
Sbjct  577  PQCDLSSFDFKD  588



>gb|ACJ85584.1| unknown [Medicago truncatula]
 gb|AFK35026.1| unknown [Medicago truncatula]
Length=615

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 77/150 (51%), Gaps = 21/150 (14%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ-QTNIQCHQGGF  655
            SF+L+G GV EDGQ+MI+DLMS YDT++ GN  ++  N    + Q L      Q  Q  F
Sbjct  475  SFDLTGFGVSEDGQKMISDLMSGYDTHVIGNNNASSTNCVVIENQNLSQPIIQQQQQDNF  534

Query  654  LQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFN  484
              NQG++      E+N       FT  + QF++ KA+NSPF  +         M+G   +
Sbjct  535  FLNQGMV-----MEANF------FTREENQFDRFKAMNSPFEANLNNNNNMHPMYGSSCD  583

Query  483  LPPSDYSEGL-----LGVPPLPKK-DILSW  412
            L   D+ E L     +G+  L K+ D+  W
Sbjct  584  LASFDFKEDLQLQGGVGMDALYKQPDVSIW  613



>gb|AAK67355.1|AF387795_1 transcription factor [Cucumis melo]
Length=621

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 20/143 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQP---LQQTNIQCHQG  661
            F+LS    PEDGQ++I++L+  YDTNIQGNK + N  NS   + Q    ++++N+  ++ 
Sbjct  476  FHLS----PEDGQKLISELI--YDTNIQGNKNNLNTGNSATTENQKSPSIKRSNL--NKM  527

Query  660  GFLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN------VSSIETLPF  505
               ++QG++  GN F  SN+SS+  MFT  + Q ++ K +NSPF        ++      
Sbjct  528  IDFRDQGLMMEGNFFDGSNVSSSHQMFTRDEGQSDRFKPMNSPFENNHHHHNNNNNNFHL  587

Query  504  MFGPPFNLPPSDYSEGLLGVPPL  436
            MF  PF+L   DY E + GV  +
Sbjct  588  MFSSPFDLSTFDYKEEVPGVAAI  610



>ref|XP_003617086.1| Ethylene insensitive 3-like protein [Medicago truncatula]
 gb|AET00045.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=615

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 77/150 (51%), Gaps = 21/150 (14%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ-QTNIQCHQGGF  655
            SF+L+G GV EDGQ+MI+DLMS YDT++ GN  ++  N    + Q L      Q  Q  F
Sbjct  475  SFDLTGFGVSEDGQKMISDLMSGYDTHVIGNNNASSTNCVVIENQNLSQPIIQQQQQDNF  534

Query  654  LQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFN  484
              NQG++      E+N       FT  + QF++ KA+NSPF  +         M+G   +
Sbjct  535  FLNQGMV-----MEANF------FTREENQFDRFKAMNSPFEANLNNNNNMHPMYGSSCD  583

Query  483  LPPSDYSEGL-----LGVPPLPKK-DILSW  412
            L   D+ E L     +G+  L K+ D+  W
Sbjct  584  LASFDFKEDLQLQGGVGMDALYKQPDVSIW  613



>emb|CDP16004.1| unnamed protein product [Coffea canephora]
Length=608

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 75/146 (51%), Gaps = 10/146 (7%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH-QGGF  655
              ++S LG+PEDGQ+MI+ LMS YD ++Q     +      A++Q LQQ  IQ H    F
Sbjct  467  CLSISKLGIPEDGQKMISGLMSMYDDSVQEKTCFDFGIDTAAEDQNLQQQIIQLHGDQSF  526

Query  654  LQNQGIIPGNIFQESNISSTRPMFTSG----DQFEQPKALNSPFNVSSIETLPFMFGPPF  487
             +    + G+I +E++++ +   F S     D        +S FN +    L F FGP F
Sbjct  527  FRPGVTMGGSISKETSLTLSHSAFPSTEFLYDNGNCKSTDDSGFNGNLNSNLDFSFGPEF  586

Query  486  NLPPSDYSEGLLGVPPLPKKDILSWY  409
            N+   DYS  L      PK+DI +WY
Sbjct  587  NMESVDYSMDL-----FPKEDITTWY  607



>ref|XP_004306440.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Fragaria vesca 
subsp. vesca]
Length=604

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 74/151 (49%), Gaps = 21/151 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN+SGLG+ +DGQ+MI++LMS YD N +  + SNP N    ++   QQ N Q   G    
Sbjct  463  FNVSGLGLADDGQKMISELMSSYDGNTR--QTSNPGNFSVVQDPNHQQVNYQFEVGDNFY  520

Query  648  NQGIIPGNIFQESNISSTRPMFTSGD-------QFEQPKALNSPFNVSS---IETLPFMF  499
            +QG+    +   SN+    PM            QF+Q K  +S F  +S   I  L F  
Sbjct  521  SQGM----VMDRSNVPEPAPMPMHQQVLPSPEVQFDQCKVFDSSFGNNSNDAIADLRFGT  576

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILS-WY  409
            G  F+L   DY+ G      L K+D  S WY
Sbjct  577  GSQFSLAHLDYTAG----NSLLKQDASSIWY  603



>dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota]
Length=619

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 74/129 (57%), Gaps = 9/129 (7%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPR----NSGPAKEQPLQQTNIQCHQG  661
            FN S +G+P+DG++MI++LMSFYD NI  N+  N      N     +  +QQ   Q    
Sbjct  470  FNASVVGLPDDGEKMISELMSFYDNNIHQNQNQNLNMNSGNLNILGDHNMQQQKFQLDDN  529

Query  660  GFLQNQGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIET-LPFMFGPP  490
             F   QGI+ G NI Q ++I   +P++ S D QF Q KA +S F+ +S    L F +G P
Sbjct  530  FF--GQGIVMGDNISQGTSIPLNQPVYPSTDFQFGQCKAYDSVFDANSNGNPLDFQYGSP  587

Query  489  FNLPPSDYS  463
            FNL  +DY+
Sbjct  588  FNLGTADYT  596



>emb|CDY06379.1| BnaC05g31510D [Brassica napus]
Length=487

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 80/163 (49%), Gaps = 28/163 (17%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ
Sbjct  330  IDLTGIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVTESQLLQPTVQNHQ-EHLQ  384

Query  648  NQG-IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALNSPF----NVSSIETLP  508
             QG ++ G+ F++ NI       MF       SG +++     N+ F    N +S     
Sbjct  385  FQGNMVEGSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDTAHTNNNNFEAAHNNASSNRFQ  444

Query  507  FMF-GPPFNLPPSDYSEGLL---------GVPPLPKKDILSWY  409
             +F  PPF++   DY + +          G+    ++D+  W+
Sbjct  445  LVFDSPPFDMASFDYRDDMSMPGVVGTMDGMQQQKQQDVSIWF  487



>ref|XP_009339245.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339246.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339249.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339251.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=611

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 67/128 (52%), Gaps = 12/128 (9%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            FN SGLG+ ++GQ+  ++LMSFYD+NIQ NK  NP N      +  QQ+  Q        
Sbjct  473  FNASGLGLVDNGQK--SELMSFYDSNIQQNKNCNPANLHIVDNRNSQQSKYQFPMNDNFF  530

Query  648  NQGIIPGNIFQESNISSTRPM------FTSGD-QFEQPKALNSPFNVSSIETLPFMFGPP  490
             QG+   ++ +  N+S   PM      F S + QF+Q  A + PF  ++ E +   F  P
Sbjct  531  GQGV---DVGRNINMSELAPMPMLHPGFASPEVQFDQCMAFDPPFGNNTNENVDIRFESP  587

Query  489  FNLPPSDY  466
             +L P DY
Sbjct  588  LHLAPVDY  595



>ref|NP_001234546.1| EIL3 protein [Solanum lycopersicum]
 gb|AAK58859.1|AF328786_1 EIL3 [Solanum lycopersicum]
Length=601

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 72/139 (52%), Gaps = 14/139 (10%)
 Frame = -1

Query  816  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPL-QQTNIQCHQGGFLQNQG  640
            GLG+PED QR+I+DL++ YD N Q N       S     Q L QQ  ++      L   G
Sbjct  473  GLGLPEDDQRIISDLITSYDNNFQQNGSICSGISEILVNQSLPQQQTVE------LPMDG  526

Query  639  IIPGNIFQESNISSTRPMFTSGD-QFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPPSDY  466
             I     + S   ++ P++ S + Q++Q K + ++PF  +  +   + FG PFNL  SDY
Sbjct  527  NINLGHMETSAQETSMPVYRSTEFQYDQCKMSFDAPFGGNINDITDYRFGSPFNLGGSDY  586

Query  465  SEGLLGVPPLPKKDILSWY  409
            +     V  L K+DI +WY
Sbjct  587  A-----VEQLTKQDISTWY  600



>emb|CDY19606.1| BnaA05g20140D [Brassica napus]
Length=460

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 19/139 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ
Sbjct  304  IDLTGIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVMETQLLQPTVQNHQ-EHLQ  358

Query  648  NQG-IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALNSPFNVS----SIETLP  508
             QG ++ G+ F++ NI       MF       SG +++     N+ F  +    S     
Sbjct  359  FQGNMVEGSFFEDLNIPNRVNHQMFFQGNNNNSGFKYDAAHTNNNNFEAAHNNGSSNRFQ  418

Query  507  FMF-GPPFNLPPSDYSEGL  454
             +F  PPF++   DY + +
Sbjct  419  LVFDSPPFDMASFDYRDDM  437



>ref|XP_011091876.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Sesamum indicum]
Length=580

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 20/150 (13%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN----SGPAKEQP---LQQTNIQ  673
            S ++SGLG+PEDGQ++I++LMS Y+ N Q     +  N     G  ++QP   LQQ +  
Sbjct  441  SVSVSGLGIPEDGQKVISELMSSYNGNNQHGNTFHSENFHILEGQNQQQPAAYLQQNDDD  500

Query  672  CHQGGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQPK-ALNSPFNVSSIETLP-FMF  499
              QG    +QGI  G     S+   +   F    Q++Q K + NS F  +  + +  F F
Sbjct  501  SKQGA--SSQGIFQGTSVPLSSSVFSSSAF----QYDQCKSSCNSSFTSNVSDNISDFRF  554

Query  498  GPPFNLPPSDYSEGLLGVPPLPKKDILSWY  409
            G P N    DY      V PLPK ++  WY
Sbjct  555  GSPLNSTQLDY-----FVDPLPKHEVSLWY  579



>ref|XP_009145590.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Brassica 
rapa]
Length=614

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 71/140 (51%), Gaps = 20/140 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ
Sbjct  457  IDLTGIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVMETQLLQPTVQNHQ-EHLQ  511

Query  648  NQG-IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALN-----SPFNVSSIETL  511
             QG ++ G+ F++ NI       MF       SG +++     N     +  N SS    
Sbjct  512  FQGNMVEGSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDAAHTNNNNNFEAAHNNSSSNRF  571

Query  510  PFMF-GPPFNLPPSDYSEGL  454
              +F  PPF++   DY + +
Sbjct  572  QLVFDSPPFDMASFDYRDDM  591



>ref|XP_009145591.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Brassica 
rapa]
Length=613

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 71/139 (51%), Gaps = 19/139 (14%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ
Sbjct  457  IDLTGIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVMETQLLQPTVQNHQ-EHLQ  511

Query  648  NQG-IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALNSPFNVS----SIETLP  508
             QG ++ G+ F++ NI       MF       SG +++     N+ F  +    S     
Sbjct  512  FQGNMVEGSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDAAHTNNNNFEAAHNNGSSNRFQ  571

Query  507  FMF-GPPFNLPPSDYSEGL  454
             +F  PPF++   DY + +
Sbjct  572  LVFDSPPFDMASFDYRDDM  590



>ref|XP_010544311.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010544312.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=632

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 85/163 (52%), Gaps = 26/163 (16%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+GLGVPEDGQ+MI +LM  YD N+Q N+ S+   +     QP  Q + + +Q G  +
Sbjct  473  IDLTGLGVPEDGQKMITELMDMYDRNVQNNQASSMVENESMMLQPKAQNHQEQNQFGN-R  531

Query  648  NQGIIPGNIFQESNI-------SSTRPMFTSGDQFEQPKALNSPF---------NVSSIE  517
            +  ++ G+ F++ N        +S+  M+  G+   + K ++SPF         N SS  
Sbjct  532  DGNMVEGSFFEDLNFPNSCNNNNSSSQMYMQGNS--EFKFMSSPFAATQNSDDNNGSSNS  589

Query  516  TLPFMF-GPPFNLPPSD-----YSEGLLGVPP-LPKKDILSWY  409
             L F+F   PF+L   D      + G+ G+PP   ++D+  W+
Sbjct  590  PLEFVFDSTPFDLASFDDRNDMQAVGMEGMPPKRQERDVSIWF  632



>ref|XP_011032978.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=662

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNP  724
            SFN+SGLG+PEDG++ I+DLMSFYDTN+Q +K  NP
Sbjct  471  SFNVSGLGLPEDGKKSISDLMSFYDTNLQRDKNMNP  506



>ref|XP_011046481.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011046482.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNP  724
            SFN+SGLG+PEDG++ I+DLMSFYDTN+Q +K  NP
Sbjct  470  SFNVSGLGLPEDGKKSISDLMSFYDTNLQRDKNMNP  505



>ref|XP_010509323.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X4 [Camelina 
sativa]
Length=630

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    S   +  PL Q  IQ HQ     
Sbjct  466  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVMES---QSVPLLQPTIQNHQEHLQF  522

Query  648  NQGIIPGNIFQE  613
               ++ G+ F++
Sbjct  523  PGNMVEGSFFED  534



>ref|XP_010509301.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Camelina 
sativa]
 ref|XP_010509308.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Camelina 
sativa]
 ref|XP_010509316.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X3 [Camelina 
sativa]
Length=629

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    S   +  PL Q  IQ HQ     
Sbjct  465  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVMES---QSVPLLQPTIQNHQEHLQF  521

Query  648  NQGIIPGNIFQE  613
               ++ G+ F++
Sbjct  522  PGNMVEGSFFED  533



>ref|XP_010689360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=619

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 69/144 (48%), Gaps = 7/144 (5%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
            F+LSGL VPEDGQ+MI++LMS+YD+NI   K        PA    +Q++         L+
Sbjct  474  FDLSGLEVPEDGQKMISELMSYYDSNILATKTPYHEIISPADHNVMQRSMDYNQNDLILR  533

Query  648  NQGIIPGNIFQESNISSTRPM--FTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  475
               I   N+  + +I     M  +   ++F   + L    +V+ ++++        +LP 
Sbjct  534  PSSITELNLPDQYDIQVHHQMLNWQEENKFSGCEQLEHDLSVNGLDSI---LKVQLDLPY  590

Query  474  SDYSEGLLG--VPPLPKKDILSWY  409
            +D+ E L         K+D  +WY
Sbjct  591  TDFMEDLPSGTSTACLKQDPSTWY  614



>ref|XP_009417872.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417873.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=622

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 64/144 (44%), Gaps = 15/144 (10%)
 Frame = -1

Query  825  NLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQN  646
            N S LG+P DGQR I++LMS YD N+  NK  N R  G ++ +   Q   +     F Q 
Sbjct  488  NTSDLGIPSDGQRSIDELMSLYDKNLNANKSFNSRGIGMSEGRTPLQPRTRVEDNFFPQG  547

Query  645  QGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-----NVSSIETLPFMFGPPFNL  481
               I G + + SN+   +  F   +          PF     N S   +    +G  F++
Sbjct  548  TKAIGGMLEEVSNLVQQQQQFPVRENV-------MPFQQQFGNPSDEMSGDLCYGSAFSM  600

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
            P  DYS+ L     L K +  +W+
Sbjct  601  PSMDYSDAL---HRLQKAEAANWF  621



>gb|KDO53812.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=381

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQ  685
            FN+SGL +P+DGQ+MI DLMSFYDTN Q NK  N  N     +Q  QQ
Sbjct  316  FNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGNLNAIGDQNQQQ  363



>gb|KDO53813.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
 gb|KDO53814.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=388

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQ  685
            FN+SGL +P+DGQ+MI DLMSFYDTN Q NK  N  N     +Q  QQ
Sbjct  323  FNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGNLNAIGDQNQQQ  370



>gb|KDO53810.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
 gb|KDO53811.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=542

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQ  685
            FN+SGL +P+DGQ+MI DLMSFYDTN Q NK  N  N     +Q  QQ
Sbjct  477  FNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGNLNAIGDQNQQQ  524



>ref|XP_009135708.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
 ref|XP_009135709.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=581

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 15/132 (11%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+  N+ S    +       L Q  +Q HQ   LQ
Sbjct  435  IDLTGIGVPEDGQKMISELMSMYDRNVHSNQTSMVMENQSVS---LLQPTVQNHQ-EHLQ  490

Query  648  NQG-IIPGNIFQESNI-----SSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMF-GPP  490
             QG ++  + F++ NI     +S +  F    Q     +  +  N  S      +F  PP
Sbjct  491  FQGNVVESSFFEDLNIPNRANNSNQTFF----QGSNSNSFEAAVNNGSSNRFQLVFDSPP  546

Query  489  FNLPPSDYSEGL  454
            F++   DY + +
Sbjct  547  FDMASFDYRDDM  558



>gb|ACJ85709.1| unknown [Medicago truncatula]
 gb|AFK45814.1| unknown [Medicago truncatula]
Length=284

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 12/104 (12%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            S +++GLGV EDG++ I  LM+ YD+   GN ++   N    +   +QQ      Q  + 
Sbjct  132  SIDITGLGVSEDGEKSIGGLMTVYDS---GNHLAATENHILPQASSIQQLQ----QQNYF  184

Query  651  QNQG-IIPGNIFQESNISST--RPMFTSGD-QFEQP-KALNSPF  535
            + QG ++ GN+F+ +N+S+     MF   + QF+Q  KALNSPF
Sbjct  185  RGQGMVMEGNMFEATNMSNNNHHHMFARDEGQFDQRFKALNSPF  228



>ref|XP_010488063.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Camelina sativa]
Length=632

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    S   +   L Q  IQ HQ     
Sbjct  466  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVMES--QRSVSLLQPTIQNHQEHLQF  523

Query  648  NQGIIPGNIFQE  613
               ++ G+ F++
Sbjct  524  PGNMVEGSFFED  535



>ref|XP_009110178.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=605

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 10/76 (13%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISN-PRNSGPAKEQPLQQTNIQCHQGGFL  652
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    N      QP+ Q   Q +     
Sbjct  451  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVVENQNVTLLQPMVQNQFQGN-----  505

Query  651  QNQGIIPGNIFQESNI  604
                I+ G+ F+E NI
Sbjct  506  ----IVEGSFFEEFNI  517



>ref|XP_006406351.1| hypothetical protein EUTSA_v10020292mg [Eutrema salsugineum]
 gb|ESQ47804.1| hypothetical protein EUTSA_v10020292mg [Eutrema salsugineum]
Length=629

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    +   +   L Q  +Q HQ   LQ
Sbjct  465  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVMET---QNVSLLQPTVQNHQ-EHLQ  520

Query  648  NQG-IIPGNIFQE  613
             QG ++ G  F++
Sbjct  521  FQGNMVEGGFFED  533



>gb|EPS63662.1| hypothetical protein M569_11122 [Genlisea aurea]
Length=563

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 4/51 (8%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNI  676
            F+ SGLGVPEDGQRMIN+LMS YD     ++ SNP NS     Q L  +NI
Sbjct  453  FDFSGLGVPEDGQRMINELMSLYDAR---DRSSNPGNSKDLHSQ-LSSSNI  499



>dbj|BAJ33948.1| unnamed protein product [Thellungiella halophila]
Length=629

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    +   +   L Q  +Q HQ   LQ
Sbjct  465  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVMET---QNVSLLQPTVQNHQ-EHLQ  520

Query  648  NQG-IIPGNIFQE  613
             QG ++ G  F++
Sbjct  521  FQGNMVEGGFFED  533



>gb|ACX54782.1| ethylene insensitive-like protein 1 [Medicago truncatula]
 gb|KEH35106.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=629

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 12/105 (11%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            S +++GLGV EDG++ I  LM+ YD+   GN ++   N    +   +Q    Q  Q  + 
Sbjct  477  SIDITGLGVSEDGEKSIGGLMTVYDS---GNHLAATENHILPQASSIQ----QLQQQNYF  529

Query  651  QNQG-IIPGNIFQESNISST--RPMFTSGD-QFEQP-KALNSPFN  532
            + QG ++ GN+F+ +N+S+     MF   + QF+Q  KALNSPF 
Sbjct  530  RGQGMVMEGNMFEATNMSNNNHHHMFARDEGQFDQRFKALNSPFE  574



>ref|XP_011012998.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011012999.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013000.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013001.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNP  724
            SFN+SGL + EDGQ+ I+DLMSFYDTN+Q +K  NP
Sbjct  470  SFNVSGLRLSEDGQKTISDLMSFYDTNLQRDKNMNP  505



>ref|XP_003638449.1| Ethylene insensitive 3-like protein [Medicago truncatula]
Length=654

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 12/105 (11%)
 Frame = -1

Query  831  SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL  652
            S +++GLGV EDG++ I  LM+ YD+   GN ++   N    +   +QQ      Q  + 
Sbjct  477  SIDITGLGVSEDGEKSIGGLMTVYDS---GNHLAATENHILPQASSIQQLQ----QQNYF  529

Query  651  QNQG-IIPGNIFQESNISST--RPMFTSGD-QFEQP-KALNSPFN  532
            + QG ++ GN+F+ +N+S+     MF   + QF+Q  KALNSPF 
Sbjct  530  RGQGMVMEGNMFEATNMSNNNHHHMFARDEGQFDQRFKALNSPFE  574



>ref|XP_010466283.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Camelina sativa]
Length=629

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    S       L Q  IQ HQ     
Sbjct  466  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVMESQSVS---LLQPTIQNHQEHLQF  522

Query  648  NQGIIPGNIFQE  613
               ++ G+ F++
Sbjct  523  PGNMVEGSFFED  534



>ref|XP_006297205.1| hypothetical protein CARUB_v10013213mg [Capsella rubella]
 gb|EOA30103.1| hypothetical protein CARUB_v10013213mg [Capsella rubella]
Length=627

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 42/73 (58%), Gaps = 8/73 (11%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    S       L Q  IQ H     Q
Sbjct  464  IDLTGMGVPEDGQKMISELMSMYDRNVQSNQTSVVMESQSVS---LLQPTIQNH-----Q  515

Query  648  NQGIIPGNIFQES  610
             Q   PGN+ + S
Sbjct  516  EQLQFPGNMVEGS  528



>emb|CDY60391.1| BnaA01g36840D [Brassica napus]
Length=425

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 10/76 (13%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISN-PRNSGPAKEQPLQQTNIQCHQGGFL  652
             +L+G+GVPEDGQ+MI++LMS YD N+Q N+ S    N      QP+ Q   Q +     
Sbjct  271  IDLTGIGVPEDGQKMISELMSMYDRNVQSNQTSMVVENQNVTLLQPMVQNQFQGN-----  325

Query  651  QNQGIIPGNIFQESNI  604
                I+ G+ F++ NI
Sbjct  326  ----IVEGSFFEDFNI  337



>ref|XP_010521603.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Tarenaya 
hassleriana]
Length=665

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGN  739
            F+LSG+GVPEDGQ+MI +LMS YD N+Q N
Sbjct  491  FDLSGVGVPEDGQKMITELMSIYDRNVQSN  520



>dbj|BAF44110.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=622

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 63/144 (44%), Gaps = 15/144 (10%)
 Frame = -1

Query  825  NLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQN  646
            N S L +P DGQR I++LMS YD N+  NK  N R  G ++ +   Q   +     F Q 
Sbjct  488  NTSDLSIPSDGQRSIDELMSLYDKNLNANKSFNSRGIGMSEGRTPLQPRTRVEDNFFPQG  547

Query  645  QGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-----NVSSIETLPFMFGPPFNL  481
               I G + + SN+   +  F   +          PF     N S   +    +G  F++
Sbjct  548  TKAIGGMLEEVSNLVQQQQQFPVRENV-------MPFQQQFGNPSDEMSGDLCYGSAFSM  600

Query  480  PPSDYSEGLLGVPPLPKKDILSWY  409
            P  DYS+ L     L K +  +W+
Sbjct  601  PSMDYSDTLHR---LQKAEAANWF  621



>ref|XP_010521602.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Tarenaya 
hassleriana]
Length=692

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGN  739
            F+LSG+GVPEDGQ+MI +LMS YD N+Q N
Sbjct  518  FDLSGVGVPEDGQKMITELMSIYDRNVQSN  547



>ref|XP_010521598.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521599.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521601.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=608

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 76/156 (49%), Gaps = 20/156 (13%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             +L+G GV EDG+RMI++LM+ YD N+Q N+ S+   +     QP +  N Q  Q  F  
Sbjct  457  IDLTGFGVSEDGERMISELMAMYDRNVQSNQASSMVENQSMTRQP-KAPNHQEQQIHFNN  515

Query  648  NQG-IIPGNIFQESNI----------SSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFM  502
            + G +I G+ F++ NI          S    MFT G+       +    N S I+ +   
Sbjct  516  SDGNMIEGSFFEDLNIPNSNNNCSISSRNNQMFTQGNSGFNNNNITDNNNSSGIQLV--F  573

Query  501  FGPPFNLPPSDY-----SEGLLGVPPLPKKDILSWY  409
               PF+L   DY     + G+ G+ P  ++D  +W+
Sbjct  574  DSTPFDLTSFDYRGDMQAVGMEGMMP-KQQDASTWF  608



>ref|XP_006347695.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=604

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 20/142 (14%)
 Frame = -1

Query  816  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  637
            GLG+PED QR+I+DL++ YD N Q N       SG      + +  +  +       +  
Sbjct  476  GLGLPEDDQRIISDLITSYDNNFQQN---GSICSG------ISEILVNQNLQQQQTVELP  526

Query  636  IPGNI----FQESNISSTRPMFTSGD-QFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPP  475
            + GN      + S   ++ P + S + Q++Q K + ++PF  +  +   + FG PFNL  
Sbjct  527  MDGNFNLGHMETSAQETSMPAYRSTEFQYDQCKMSFDAPFGGNINDITDYRFGSPFNLGG  586

Query  474  SDYSEGLLGVPPLPKKDILSWY  409
            SDY+     +  L K+DI +WY
Sbjct  587  SDYA-----MEQLTKQDISTWY  603



>ref|XP_009404687.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=635

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 67/152 (44%), Gaps = 25/152 (16%)
 Frame = -1

Query  828  FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ  649
             ++S LG+P DGQ+ IN+LM FYD N+ GNK     +    +     Q+ IQ     F Q
Sbjct  496  VHVSDLGIPSDGQKSINELMGFYDNNVNGNKSLTLGSVSVLEGSNSLQSRIQMEDNFFRQ  555

Query  648  NQGIIPGNIFQESNISSTRP-------MFTSGDQFE-QPKALNSPFNVSSIETLPFMFGP  493
              G   G++F++      +P       M   G QF  QP  L+  F           F  
Sbjct  556  ETG-TGGSLFEQVGSLVQQPQFFLREDMMPFGQQFSNQPNELSGGFR----------FRS  604

Query  492  PFNLPPSDYSE----GLLGVPPLPKKDILSWY  409
              N+P  DYS+    G+ G   L K D  SW+
Sbjct  605  GLNIPAMDYSDVSQRGMGG--SLQKHDGSSWF  634



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520