BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4156

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP16729.1|  unnamed protein product                                361   1e-119   Coffea canephora [robusta coffee]
ref|XP_011098945.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         360   1e-117   Sesamum indicum [beniseed]
ref|XP_009604230.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    360   2e-117   Nicotiana tomentosiformis
ref|XP_009771789.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    355   1e-115   Nicotiana sylvestris
ref|XP_012067329.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    347   1e-112   Jatropha curcas
ref|XP_008368441.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    340   7e-112   
gb|EYU31866.1|  hypothetical protein MIMGU_mgv1a003473mg                343   5e-111   Erythranthe guttata [common monkey flower]
ref|XP_008341250.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    340   5e-110   
gb|EPS70592.1|  transport inhibitor response protein                    340   8e-110   Genlisea aurea
gb|AIT18061.1|  auxin signaling F-box protein 2                         340   1e-109   Prunus salicina [Japanese plum]
ref|XP_007217221.1|  hypothetical protein PRUPE_ppa003465mg             339   1e-109   Prunus persica
ref|XP_002300140.1|  transport inhibitor response family protein        338   2e-109   Populus trichocarpa [western balsam poplar]
gb|AIT18060.1|  auxin signaling F-box protein 2                         338   4e-109   Prunus salicina [Japanese plum]
ref|XP_007031984.1|  Auxin signaling F-box 2                            337   9e-109   Theobroma cacao [chocolate]
ref|XP_011009720.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    337   1e-108   Populus euphratica
ref|XP_009344196.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    336   2e-108   Pyrus x bretschneideri [bai li]
gb|KHM99229.1|  Protein AUXIN SIGNALING F-BOX 3                         336   2e-108   Glycine soja [wild soybean]
ref|XP_003548933.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    336   3e-108   
ref|XP_006373115.1|  transport inhibitor response family protein        335   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_008231044.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    335   5e-108   Prunus mume [ume]
ref|XP_008379063.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         335   5e-108   
ref|XP_009378024.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         334   1e-107   Pyrus x bretschneideri [bai li]
gb|AGH62009.1|  auxin signaling F-box 3                                 323   2e-107   Arachis hypogaea [goober]
ref|XP_011045792.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    332   6e-107   Populus euphratica
ref|XP_007161649.1|  hypothetical protein PHAVU_001G087000g             332   1e-106   Phaseolus vulgaris [French bean]
gb|KHG11169.1|  auxin signaling f-box 2 -like protein                   332   1e-106   Gossypium arboreum [tree cotton]
gb|EYU34827.1|  hypothetical protein MIMGU_mgv1a003674mg                332   1e-106   Erythranthe guttata [common monkey flower]
ref|XP_003553972.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    331   2e-106   
ref|XP_003624463.1|  Protein AUXIN SIGNALING F-BOX                      330   6e-106   Medicago truncatula
ref|XP_010096050.1|  Protein AUXIN SIGNALING F-BOX 2                    330   8e-106   Morus notabilis
ref|XP_004493010.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    327   6e-105   Cicer arietinum [garbanzo]
gb|AFK34677.1|  unknown                                                 318   7e-105   Lotus japonicus
gb|ADL70248.1|  auxin signaling F-box 3                                 316   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ABG56238.1|  auxin-responsive factor TIR1-like protein               326   2e-104   Populus tomentosa [Chinese white poplar]
gb|ADB92057.2|  auxin signaling F-box 3                                 315   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KJB40642.1|  hypothetical protein B456_007G072400                    324   4e-104   Gossypium raimondii
gb|ADL70254.1|  auxin signaling F-box 3                                 315   4e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70247.1|  auxin signaling F-box 3                                 315   5e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ADB92059.2|  auxin signaling F-box 3                                 315   5e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ADB92058.1|  auxin signaling F-box 3                                 315   5e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70244.1|  auxin signaling F-box 3                                 314   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KJB40643.1|  hypothetical protein B456_007G072400                    324   1e-103   Gossypium raimondii
ref|XP_010066425.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    323   3e-103   Eucalyptus grandis [rose gum]
ref|XP_003518127.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    322   6e-103   Glycine max [soybeans]
ref|XP_002512866.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    321   2e-102   Ricinus communis
ref|XP_010249158.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    319   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010682986.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    319   1e-101   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN13379.1|  Protein AUXIN SIGNALING F-BOX 2                         319   1e-101   Glycine soja [wild soybean]
emb|CBI21294.3|  unnamed protein product                                317   1e-101   Vitis vinifera
ref|XP_003548026.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    318   2e-101   Glycine max [soybeans]
ref|XP_010660695.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         318   3e-101   
ref|XP_006446967.1|  hypothetical protein CICLE_v10014749mg             316   2e-100   Citrus clementina [clementine]
gb|KDO47371.1|  hypothetical protein CISIN_1g008325mg                   315   3e-100   Citrus sinensis [apfelsine]
ref|NP_563915.1|  auxin signaling F-box 3 protein                       315   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791063.1|  PREDICTED: transport inhibitor response 1-li...    315   5e-100   Phoenix dactylifera
gb|ADL70252.1|  auxin signaling F-box 3                                 305   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892715.1|  auxin signaling F-box 3                            314   7e-100   Arabidopsis lyrata subsp. lyrata
gb|ACL51018.1|  transport inhibitor response protein                    313   2e-99    Citrus trifoliata [hardy orange]
ref|XP_004304555.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         311   1e-98    Fragaria vesca subsp. vesca
emb|CDY34211.1|  BnaA02g28290D                                          310   4e-98    Brassica napus [oilseed rape]
ref|XP_009129474.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         310   5e-98    Brassica rapa
ref|XP_002875343.1|  auxin signaling F-box 2                            309   1e-97    
ref|XP_010476261.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3         309   1e-97    Camelina sativa [gold-of-pleasure]
emb|CDY28523.1|  BnaC02g36370D                                          308   2e-97    Brassica napus [oilseed rape]
ref|XP_006306355.1|  hypothetical protein CARUB_v10012250mg             308   2e-97    Capsella rubella
ref|XP_010554129.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    308   3e-97    Tarenaya hassleriana [spider flower]
ref|XP_010494680.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    307   3e-97    
ref|XP_009386581.1|  PREDICTED: transport inhibitor response 1-li...    307   5e-97    
gb|KHG11704.1|  auxin signaling f-box 2 -like protein                   307   6e-97    Gossypium arboreum [tree cotton]
ref|XP_009110620.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3         307   8e-97    Brassica rapa
ref|XP_010458719.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    305   2e-96    Camelina sativa [gold-of-pleasure]
gb|KJB11712.1|  hypothetical protein B456_001G273700                    304   6e-96    Gossypium raimondii
gb|ABQ50554.1|  hypothetical protein                                    304   1e-95    Brassica rapa
ref|XP_006417190.1|  hypothetical protein EUTSA_v10007195mg             302   5e-95    Eutrema salsugineum [saltwater cress]
ref|XP_009118055.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    301   1e-94    Brassica rapa
emb|CDX71968.1|  BnaC08g29060D                                          301   2e-94    
ref|XP_008805287.1|  PREDICTED: transport inhibitor response 1-li...    297   4e-93    Phoenix dactylifera
ref|XP_010929637.1|  PREDICTED: transport inhibitor response 1-li...    296   7e-93    Elaeis guineensis
emb|CDY26594.1|  BnaA09g46830D                                          295   3e-92    Brassica napus [oilseed rape]
ref|XP_010528142.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         293   9e-92    Tarenaya hassleriana [spider flower]
gb|ADB92054.2|  auxin signaling F-box 2                                 285   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92052.2|  auxin signaling F-box 2                                 285   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909072.1|  PREDICTED: transport inhibitor response 1-li...    292   2e-91    Elaeis guineensis
ref|XP_010514346.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    292   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_009404746.1|  PREDICTED: transport inhibitor response 1-li...    291   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010502624.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         291   5e-91    Camelina sativa [gold-of-pleasure]
ref|XP_006395519.1|  hypothetical protein EUTSA_v10003903mg             291   5e-91    Eutrema salsugineum [saltwater cress]
ref|XP_006290819.1|  hypothetical protein CARUB_v10016928mg             291   5e-91    Capsella rubella
ref|NP_566800.1|  auxin signaling F-box 2                               291   6e-91    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92055.2|  auxin signaling F-box 2                                 283   8e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425404.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    291   8e-91    Camelina sativa [gold-of-pleasure]
gb|EAY93933.1|  hypothetical protein OsI_15707                          291   9e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001052659.1|  Os04g0395600                                       291   1e-90    
gb|ADL70241.1|  auxin signaling F-box 2                                 282   2e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDY31282.1|  BnaC08g15770D                                          290   2e-90    Brassica napus [oilseed rape]
ref|XP_009415862.1|  PREDICTED: transport inhibitor response 1-li...    290   2e-90    
ref|XP_008450007.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    290   4e-90    Cucumis melo [Oriental melon]
ref|XP_006652225.1|  PREDICTED: transport inhibitor response 1-li...    289   4e-90    Oryza brachyantha
ref|XP_004975445.1|  PREDICTED: transport inhibitor response 1-li...    288   6e-90    Setaria italica
ref|XP_003577541.1|  PREDICTED: transport inhibitor response 1-li...    286   9e-89    Brachypodium distachyon [annual false brome]
gb|ADL70236.1|  auxin signaling F-box 2                                 276   4e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70235.1|  auxin signaling F-box 2                                 275   5e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70239.1|  auxin signaling F-box 2                                 275   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009421041.1|  PREDICTED: transport inhibitor response 1-li...    283   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267557.1|  protein AUXIN SIGNALING F-BOX 2-like               282   3e-87    Cucumis sativus [cucumbers]
gb|ADB92053.1|  auxin signaling F-box 2                                 273   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002447719.1|  hypothetical protein SORBIDRAFT_06g014420          281   5e-87    
ref|XP_002450803.1|  hypothetical protein SORBIDRAFT_05g018860          280   9e-87    Sorghum bicolor [broomcorn]
ref|XP_009405455.1|  PREDICTED: transport inhibitor response 1-li...    280   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16034.1|  BnaC08g40890D                                          280   2e-86    Brassica napus [oilseed rape]
gb|ADL70231.1|  auxin signaling F-box 2                                 271   2e-86    Arabidopsis thaliana [mouse-ear cress]
gb|ABQ50561.1|  hypothetical protein                                    281   8e-86    Brassica rapa
gb|EAY81084.1|  hypothetical protein OsI_36265                          274   1e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_004979343.1|  PREDICTED: transport inhibitor response 1-li...    277   1e-85    Setaria italica
ref|XP_008669494.1|  PREDICTED: transport inhibitor response 1-li...    277   1e-85    Zea mays [maize]
gb|EAZ18511.1|  hypothetical protein OsJ_34040                          273   3e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579653.1|  PREDICTED: transport inhibitor response 1-li...    275   8e-85    Brachypodium distachyon [annual false brome]
ref|XP_009403780.1|  PREDICTED: transport inhibitor response 1-li...    275   1e-84    
gb|EMT24313.1|  hypothetical protein F775_12364                         273   3e-84    
ref|NP_001067971.2|  Os11g0515500                                       273   7e-84    
ref|NP_001136608.1|  hypothetical protein                               269   2e-82    Zea mays [maize]
gb|KHN28237.1|  Protein TRANSPORT INHIBITOR RESPONSE 1                  261   5e-82    Glycine soja [wild soybean]
gb|KDP28084.1|  hypothetical protein JCGZ_13855                         264   3e-80    Jatropha curcas
ref|XP_006662955.1|  PREDICTED: transport inhibitor response 1-li...    263   3e-80    Oryza brachyantha
ref|XP_012082666.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    263   4e-80    Jatropha curcas
gb|ACJ85650.1|  unknown                                                 252   9e-80    Medicago truncatula
dbj|BAJ97220.1|  predicted protein                                      257   2e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFM95208.1|  transport inhibitor response 1                          250   2e-79    Cynara cardunculus var. scolymus [artichoke]
ref|XP_010038170.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    261   3e-79    Eucalyptus grandis [rose gum]
ref|XP_008386617.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    260   5e-79    
ref|XP_010523990.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    260   5e-79    Tarenaya hassleriana [spider flower]
ref|XP_008368919.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    260   7e-79    Malus domestica [apple tree]
ref|XP_006844497.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         259   8e-79    Amborella trichopoda
gb|ACB30702.1|  AFB3                                                    244   5e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082496.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    257   7e-78    Sesamum indicum [beniseed]
ref|XP_007163058.1|  hypothetical protein PHAVU_001G202600g             258   8e-78    Phaseolus vulgaris [French bean]
ref|XP_004495993.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    257   1e-77    Cicer arietinum [garbanzo]
gb|AIT18058.1|  transport inhibitor response 1-like protein             257   1e-77    Prunus salicina [Japanese plum]
emb|CDX76680.1|  BnaC08g32660D                                          257   1e-77    
gb|ACB30724.1|  AFB3                                                    243   2e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CBI32265.3|  unnamed protein product                                253   2e-77    Vitis vinifera
gb|AIG99441.1|  transport inhibitor response 1                          256   3e-77    Morus alba var. multicaulis
ref|XP_010112739.1|  Protein TRANSPORT INHIBITOR RESPONSE 1             255   4e-77    
ref|NP_001054666.2|  Os05g0150500                                       245   4e-77    
gb|EYU46730.1|  hypothetical protein MIMGU_mgv1a003374mg                255   5e-77    Erythranthe guttata [common monkey flower]
ref|XP_008234995.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    254   8e-77    Prunus mume [ume]
ref|XP_009587773.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    254   9e-77    Nicotiana tomentosiformis
ref|NP_001148131.1|  transport inhibitor response 1 protein             254   9e-77    Zea mays [maize]
ref|XP_008799278.1|  PREDICTED: transport inhibitor response 1-li...    254   9e-77    
ref|XP_007201723.1|  hypothetical protein PRUPE_ppa003344mg             254   1e-76    Prunus persica
gb|ACG48935.1|  transport inhibitor response 1 protein                  253   2e-76    Zea mays [maize]
ref|XP_004309692.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    253   3e-76    Fragaria vesca subsp. vesca
ref|XP_002269127.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    252   5e-76    Vitis vinifera
gb|KEH43259.1|  transport inhibitor response-like protein               252   7e-76    Medicago truncatula
gb|KHN43550.1|  Protein TRANSPORT INHIBITOR RESPONSE 1                  252   8e-76    Glycine soja [wild soybean]
ref|XP_010241246.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    252   1e-75    Nelumbo nucifera [Indian lotus]
gb|ADL70207.1|  transport inhibitor response 1                          241   1e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CAN82353.1|  hypothetical protein VITISV_036655                     252   1e-75    Vitis vinifera
gb|AHA44833.1|  AFB6                                                    251   1e-75    Larix kaempferi [karamatsu]
gb|KJB23183.1|  hypothetical protein B456_004G085900                    252   1e-75    Gossypium raimondii
gb|ADB92044.2|  transport inhibitor response 1                          241   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92043.2|  transport inhibitor response 1                          241   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92045.2|  transport inhibitor response 1                          241   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70208.1|  transport inhibitor response 1                          241   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92042.1|  transport inhibitor response 1                          241   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359432.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    251   2e-75    Solanum tuberosum [potatoes]
gb|ADL70210.1|  transport inhibitor response 1                          241   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536281.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    251   2e-75    Glycine max [soybeans]
ref|XP_003518950.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    251   3e-75    
emb|CBI34249.3|  unnamed protein product                                248   3e-75    Vitis vinifera
ref|XP_004960270.1|  PREDICTED: transport inhibitor response 1-li...    250   5e-75    Setaria italica
gb|ADE76203.1|  unknown                                                 249   5e-75    Picea sitchensis
gb|AFS44506.1|  auxin receptor 1                                        249   1e-74    Fragaria x ananassa
gb|EYU27894.1|  hypothetical protein MIMGU_mgv1a003388mg                249   1e-74    Erythranthe guttata [common monkey flower]
gb|AAV32196.1|  putative transport inhibitor response TIR1              245   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006347140.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    248   2e-74    Solanum tuberosum [potatoes]
ref|XP_006654054.1|  PREDICTED: transport inhibitor response 1-li...    245   3e-74    Oryza brachyantha
ref|XP_003568922.1|  PREDICTED: transport inhibitor response 1-li...    248   4e-74    Brachypodium distachyon [annual false brome]
ref|XP_010522662.1|  PREDICTED: GRR1-like protein 1                     247   4e-74    Tarenaya hassleriana [spider flower]
ref|NP_001267546.1|  protein TRANSPORT INHIBITOR RESPONSE 1-like        248   5e-74    Cucumis sativus [cucumbers]
ref|XP_008451438.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    247   5e-74    Cucumis melo [Oriental melon]
gb|EYU43421.1|  hypothetical protein MIMGU_mgv1a003323mg                247   6e-74    Erythranthe guttata [common monkey flower]
emb|CAN73714.1|  hypothetical protein VITISV_038840                     247   6e-74    Vitis vinifera
ref|XP_002272850.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    247   6e-74    Vitis vinifera
emb|CDO99639.1|  unnamed protein product                                247   7e-74    Coffea canephora [robusta coffee]
ref|XP_008800392.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    247   8e-74    
ref|XP_010905566.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    247   8e-74    
dbj|BAD94031.1|  transport inhibitor response 1                         236   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009603009.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    246   2e-73    Nicotiana tomentosiformis
ref|XP_009122075.1|  PREDICTED: GRR1-like protein 1                     246   2e-73    
ref|XP_009763253.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    246   2e-73    Nicotiana sylvestris
ref|XP_008656496.1|  PREDICTED: transport inhibitor response 1-li...    245   4e-73    Zea mays [maize]
ref|XP_010268854.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3-like    245   4e-73    Nelumbo nucifera [Indian lotus]
ref|XP_010545045.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    241   4e-73    
emb|CDY21947.1|  BnaC09g00530D                                          246   5e-73    Brassica napus [oilseed rape]
sp|Q0DKP3.2|TIR1A_ORYSJ  RecName: Full=Transport inhibitor respon...    245   5e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052384.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    245   5e-73    Eucalyptus grandis [rose gum]
ref|XP_009375118.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   5e-73    Pyrus x bretschneideri [bai li]
emb|CDY22108.1|  BnaA09g01370D                                          246   5e-73    Brassica napus [oilseed rape]
gb|KDO75707.1|  hypothetical protein CISIN_1g007916mg                   244   5e-73    Citrus sinensis [apfelsine]
ref|XP_006467903.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   5e-73    Citrus sinensis [apfelsine]
ref|XP_009587288.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   6e-73    Nicotiana tomentosiformis
ref|XP_006290791.1|  hypothetical protein CARUB_v10016894mg             241   7e-73    
ref|XP_002440601.1|  hypothetical protein SORBIDRAFT_09g003870          244   8e-73    Sorghum bicolor [broomcorn]
ref|XP_010277925.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   9e-73    Nelumbo nucifera [Indian lotus]
emb|CBI23303.3|  unnamed protein product                                243   9e-73    Vitis vinifera
ref|XP_009788922.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   1e-72    Nicotiana sylvestris
gb|KJB41985.1|  hypothetical protein B456_007G131300                    244   1e-72    Gossypium raimondii
ref|XP_002271412.2|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   1e-72    Vitis vinifera
ref|XP_010904761.1|  PREDICTED: transport inhibitor response 1-li...    243   1e-72    
ref|XP_011033611.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    244   1e-72    Populus euphratica
ref|XP_006449208.1|  hypothetical protein CICLE_v10014716mg             243   1e-72    Citrus clementina [clementine]
gb|ACV87282.1|  TIR1/AFB auxin receptor protein PintaAFB6               243   2e-72    Pinus taeda
emb|CAN66468.1|  hypothetical protein VITISV_016565                     244   2e-72    Vitis vinifera
ref|XP_006449206.1|  hypothetical protein CICLE_v10014739mg             243   3e-72    Citrus clementina [clementine]
dbj|BAJ87145.1|  predicted protein                                      243   3e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05356.1|  predicted protein                                      243   3e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012091485.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    243   4e-72    Jatropha curcas
ref|XP_012091486.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    242   4e-72    Jatropha curcas
ref|XP_010087910.1|  hypothetical protein L484_002775                   242   4e-72    Morus notabilis
ref|XP_010245369.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    242   5e-72    Nelumbo nucifera [Indian lotus]
gb|KHG14995.1|  transport inhibitor response 1 -like protein            242   5e-72    Gossypium arboreum [tree cotton]
ref|XP_002305651.1|  hypothetical protein POPTR_0004s03400g             242   5e-72    
ref|XP_007025805.1|  F-box/RNI-like superfamily protein                 242   5e-72    
ref|XP_011079740.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    242   5e-72    Sesamum indicum [beniseed]
ref|XP_004134961.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2         242   6e-72    Cucumis sativus [cucumbers]
ref|XP_002524686.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    242   8e-72    Ricinus communis
ref|XP_011096196.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    241   8e-72    Sesamum indicum [beniseed]
ref|XP_002520681.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    241   9e-72    Ricinus communis
ref|NP_567135.1|  protein TRANSPORT INHIBITOR RESPONSE 1                241   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224957.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    241   1e-71    Prunus mume [ume]
gb|KJB22544.1|  hypothetical protein B456_004G053500                    241   1e-71    Gossypium raimondii
gb|EMS47226.1|  hypothetical protein TRIUR3_32567                       240   2e-71    Triticum urartu
ref|XP_008439908.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    241   2e-71    Cucumis melo [Oriental melon]
dbj|BAK06180.1|  predicted protein                                      243   2e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG00218.1|  transport inhibitor response 1 -like protein            241   2e-71    Gossypium arboreum [tree cotton]
ref|XP_009116967.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    241   2e-71    Brassica rapa
ref|XP_010468900.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    240   2e-71    
emb|CDY11468.1|  BnaA09g40340D                                          241   2e-71    Brassica napus [oilseed rape]
ref|XP_007025803.1|  F-box/RNI-like superfamily protein isoform 1       240   2e-71    
ref|XP_010545044.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    240   2e-71    Tarenaya hassleriana [spider flower]
ref|XP_006467904.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    240   2e-71    
ref|XP_010686279.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    240   3e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008364135.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    239   3e-71    
ref|XP_006290792.1|  hypothetical protein CARUB_v10016894mg             240   3e-71    Capsella rubella
ref|XP_007211398.1|  hypothetical protein PRUPE_ppa003317mg             240   4e-71    Prunus persica
emb|CDP03546.1|  unnamed protein product                                237   4e-71    Coffea canephora [robusta coffee]
gb|ACV87279.1|  TIR1/AFB auxin receptor protein PintaTIR1               239   4e-71    Pinus taeda
ref|XP_010674940.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    240   5e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002316664.1|  hypothetical protein POPTR_0011s04200g             239   5e-71    
ref|XP_010512696.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    239   5e-71    Camelina sativa [gold-of-pleasure]
gb|ACT53268.1|  transport inhibitor response 1                          239   7e-71    Nicotiana tabacum [American tobacco]
gb|KHG02422.1|  transport inhibitor response 1 -like protein            239   7e-71    Gossypium arboreum [tree cotton]
ref|XP_006396547.1|  hypothetical protein EUTSA_v10028532mg             239   7e-71    Eutrema salsugineum [saltwater cress]
ref|XP_010413212.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    239   8e-71    Camelina sativa [gold-of-pleasure]
ref|XP_004232795.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    239   8e-71    Solanum lycopersicum
gb|ADL70227.1|  auxin signaling F-box 1                                 230   9e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KJB24339.1|  hypothetical protein B456_004G140500                    239   9e-71    Gossypium raimondii
ref|XP_004504964.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    239   9e-71    Cicer arietinum [garbanzo]
gb|ADB92048.1|  auxin signaling F-box 1                                 230   9e-71    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70217.1|  auxin signaling F-box 1                                 230   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70228.1|  auxin signaling F-box 1                                 230   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70221.1|  auxin signaling F-box 1                                 230   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|ADL70229.1|  auxin signaling F-box 1                                 230   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92047.2|  auxin signaling F-box 1                                 230   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|ADB92049.2|  auxin signaling F-box 1                                 230   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402320.1|  hypothetical protein EUTSA_v10005852mg             238   1e-70    Eutrema salsugineum [saltwater cress]
gb|EPS73154.1|  f-box family protein                                    238   1e-70    Genlisea aurea
ref|XP_011001141.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    238   1e-70    Populus euphratica
gb|KJB69424.1|  hypothetical protein B456_011G023100                    238   2e-70    Gossypium raimondii
ref|XP_006362984.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    236   2e-70    Solanum tuberosum [potatoes]
ref|XP_011086127.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    238   2e-70    Sesamum indicum [beniseed]
ref|XP_007050790.1|  F-box/RNI-like superfamily protein isoform 1       238   3e-70    
dbj|BAJ99384.1|  predicted protein                                      225   3e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009138698.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    238   3e-70    
emb|CDY53774.1|  BnaC03g73110D                                          238   3e-70    Brassica napus [oilseed rape]
ref|XP_011043308.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    237   3e-70    Populus euphratica
ref|XP_008383826.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    237   3e-70    
gb|ADE75894.1|  unknown                                                 225   4e-70    Picea sitchensis
ref|XP_007144561.1|  hypothetical protein PHAVU_007G166200g             237   5e-70    
ref|XP_002878489.1|  hypothetical protein ARALYDRAFT_907876             238   5e-70    
gb|EYU40528.1|  hypothetical protein MIMGU_mgv1a003462mg                236   6e-70    
ref|XP_010052385.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    236   6e-70    
ref|XP_009134369.1|  PREDICTED: GRR1-like protein 1                     236   9e-70    
gb|KEH21100.1|  transport inhibitor response 1 protein                  236   1e-69    
ref|XP_006362983.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    236   1e-69    
ref|XP_002262856.2|  PREDICTED: protein AUXIN SIGNALING F-BOX 2-like    235   2e-69    
gb|KFK30917.1|  hypothetical protein AALP_AA6G042500                    235   2e-69    
gb|ACX31301.2|  transport inhibitor response 1                          235   3e-69    
ref|NP_001234673.1|  TIR1-like protein                                  234   3e-69    
ref|XP_011006220.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    234   3e-69    
emb|CDX90899.1|  BnaA03g25790D                                          234   4e-69    
ref|XP_009104406.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    233   4e-69    
ref|XP_010941793.1|  PREDICTED: transport inhibitor response 1-li...    234   4e-69    
gb|AFP19451.1|  transport inhibitor response 1                          234   4e-69    
emb|CDY53998.1|  BnaC06g43000D                                          234   5e-69    
gb|KHN00102.1|  Protein TRANSPORT INHIBITOR RESPONSE 1                  233   6e-69    
ref|XP_009104405.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    234   7e-69    
ref|XP_006841829.1|  PREDICTED: protein AUXIN SIGNALING F-BOX 3         233   9e-69    
ref|XP_006352806.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    233   1e-68    
ref|XP_009393238.1|  PREDICTED: transport inhibitor response 1-li...    233   1e-68    
ref|XP_003532560.2|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    233   1e-68    
ref|XP_010455977.1|  PREDICTED: GRR1-like protein 1                     233   1e-68    
ref|XP_010430752.1|  PREDICTED: GRR1-like protein 1                     233   1e-68    
emb|CDX67912.1|  BnaA07g19520D                                          234   1e-68    
ref|XP_006287352.1|  hypothetical protein CARUB_v10000550mg             233   2e-68    
ref|XP_009393237.1|  PREDICTED: transport inhibitor response 1-li...    233   2e-68    
ref|XP_002872791.1|  hypothetical protein ARALYDRAFT_490244             233   2e-68    
gb|KHG02050.1|  transport inhibitor response 1 -like protein            233   2e-68    
gb|ABG46343.1|  transport inhibitor response 1                          233   2e-68    
ref|XP_008224955.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    231   9e-68    
ref|XP_007213588.1|  hypothetical protein PRUPE_ppa003070mg             231   1e-67    
ref|XP_002321035.1|  TRANSPORT INHIBITOR RESPONSE 1 family protein      231   1e-67    
gb|ACB30678.1|  AFB2                                                    218   1e-67    
ref|XP_003608251.1|  Protein AUXIN SIGNALING F-BOX                      230   2e-67    
gb|AES90448.2|  transport inhibitor response 1 protein                  230   2e-67    
gb|ACB30685.1|  AFB2                                                    217   3e-67    
gb|AAK01147.1|AF291816_1  GRR1-like protein 1                           229   3e-67    
ref|NP_567255.1|  GRR1-like protein 1                                   229   3e-67    
ref|XP_006444233.1|  hypothetical protein CICLE_v10019437mg             229   3e-67    
ref|XP_007159244.1|  hypothetical protein PHAVU_002G221400g             229   3e-67    
ref|XP_006479877.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    229   3e-67    
ref|XP_009784635.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    229   5e-67    
ref|XP_009402531.1|  PREDICTED: transport inhibitor response 1-li...    229   6e-67    
ref|XP_003528427.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    228   9e-67    
ref|XP_008804585.1|  PREDICTED: transport inhibitor response 1-li...    228   1e-66    
ref|XP_001760786.1|  TIRA1 TIR1-like auxin receptor                     227   2e-66    
gb|AAK76473.1|  putative F-box protein GRR1 protein 1, AtFBL18          227   2e-66    
ref|XP_006389669.1|  TRANSPORT INHIBITOR RESPONSE 1 family protein      226   6e-66    
ref|XP_010916693.1|  PREDICTED: transport inhibitor response 1-li...    226   6e-66    
ref|XP_001755006.1|  TIRA2 TIR1-like auxin receptor protein             225   1e-65    
gb|ACV87280.1|  TIR1/AFB auxin receptor protein PintaAFB4A              224   1e-65    
gb|ACV87281.1|  TIR1/AFB auxin receptor protein PintaAFB4A              225   1e-65    
gb|EPS65956.1|  hypothetical protein M569_08818                         224   2e-65    
gb|AHW83201.1|  auxin F-box protein 2                                   224   4e-65    
gb|AHA44842.1|  TIR1                                                    223   6e-65    
ref|XP_010272955.1|  PREDICTED: transport inhibitor response 1-li...    224   7e-65    
ref|XP_008795194.1|  PREDICTED: F-box protein FBX14-like                223   7e-65    
gb|AHW83200.1|  auxin F-box protein 1                                   221   3e-64    
ref|XP_010266465.1|  PREDICTED: transport inhibitor response 1-li...    222   4e-64    
gb|KDP41450.1|  hypothetical protein JCGZ_15857                         221   6e-64    
ref|XP_012067953.1|  PREDICTED: transport inhibitor response 1-li...    222   7e-64    
ref|XP_009399685.1|  PREDICTED: transport inhibitor response 1-li...    219   4e-63    
ref|XP_010942647.1|  PREDICTED: transport inhibitor response 1-li...    219   5e-63    
gb|ADL70223.1|  auxin signaling F-box 1                                 208   1e-62    
gb|KHN26118.1|  Transport inhibitor response 1-like protein             215   1e-62    
gb|ADL70220.1|  auxin signaling F-box 1                                 208   1e-62    
ref|XP_008782182.1|  PREDICTED: transport inhibitor response 1-li...    217   2e-62    
ref|XP_006841245.1|  PREDICTED: transport inhibitor response 1-li...    216   3e-62    
ref|XP_006338135.1|  PREDICTED: transport inhibitor response 1-li...    216   4e-62    
gb|ADL70218.1|  auxin signaling F-box 1                                 206   1e-61    
gb|AEQ94093.1|  putative transport inhibitor response 1                 211   2e-61    
ref|XP_007141239.1|  hypothetical protein PHAVU_008G179000g             215   2e-61    
ref|XP_002981422.1|  hypothetical protein SELMODRAFT_178850             214   2e-61    
ref|XP_002969952.1|  hypothetical protein SELMODRAFT_170974             214   2e-61    
ref|XP_002514006.1|  TRANSPORT INHIBITOR RESPONSE 1 protein, puta...    214   3e-61    
ref|XP_003519193.1|  PREDICTED: transport inhibitor response 1-li...    214   3e-61    
gb|AFW73533.1|  hypothetical protein ZEAMMB73_849714                    207   3e-61    
gb|KHG29069.1|  hypothetical protein F383_04554                         214   4e-61    
ref|XP_009409171.1|  PREDICTED: F-box protein FBX14-like                214   6e-61    
ref|XP_011016326.1|  PREDICTED: transport inhibitor response 1-li...    214   6e-61    
gb|AAX55705.1|  transport inhibitor response 1                          201   6e-61    
ref|XP_003570593.1|  PREDICTED: transport inhibitor response 1-li...    214   6e-61    
ref|XP_011010387.1|  PREDICTED: transport inhibitor response 1-li...    214   7e-61    
ref|NP_001234722.1|  LeTIR                                              213   7e-61    
ref|XP_008806378.1|  PREDICTED: F-box protein FBX14-like                213   8e-61    
ref|NP_001049210.1|  Os03g0187500                                       204   8e-61    
ref|XP_004490408.1|  PREDICTED: transport inhibitor response 1-li...    213   8e-61    
ref|XP_002306554.1|  F-box family protein                               213   9e-61    
ref|XP_010939729.1|  PREDICTED: transport inhibitor response 1-li...    212   2e-60    
gb|AAK16647.1|AF139835_1  F-box containing protein TIR1                 212   3e-60    
gb|KJB64196.1|  hypothetical protein B456_010G036400                    211   3e-60    
gb|KHN09006.1|  Transport inhibitor response 1-like protein             209   3e-60    
ref|NP_001145982.1|  uncharacterized protein LOC100279510               208   4e-60    
ref|XP_007025804.1|  F-box/RNI-like superfamily protein isoform 2       211   4e-60    
gb|KFK26632.1|  hypothetical protein AALP_AA8G273700                    211   5e-60    
ref|XP_010098665.1|  hypothetical protein L484_026040                   210   8e-60    
ref|XP_009597676.1|  PREDICTED: transport inhibitor response 1-li...    210   9e-60    
ref|XP_010530111.1|  PREDICTED: transport inhibitor response 1-li...    210   1e-59    
emb|CDY21439.1|  BnaC03g27580D                                          209   1e-59    
ref|XP_006433877.1|  hypothetical protein CICLE_v10000564mg             210   2e-59    
ref|XP_006472518.1|  PREDICTED: transport inhibitor response 1-li...    210   2e-59    
ref|XP_010482301.1|  PREDICTED: transport inhibitor response 1-li...    210   2e-59    
ref|XP_010926346.1|  PREDICTED: transport inhibitor response 1-li...    209   2e-59    
ref|XP_010441379.1|  PREDICTED: transport inhibitor response 1-li...    210   2e-59    
ref|XP_003570592.1|  PREDICTED: transport inhibitor response 1-li...    209   2e-59    
ref|XP_003526541.1|  PREDICTED: transport inhibitor response 1-li...    209   2e-59    
gb|EMT33691.1|  hypothetical protein F775_27725                         201   2e-59    
ref|XP_008812967.1|  PREDICTED: transport inhibitor response 1-li...    209   2e-59    
ref|XP_006651114.1|  PREDICTED: transport inhibitor response 1-li...    206   2e-59    
ref|XP_006280173.1|  hypothetical protein CARUB_v10026074mg             209   3e-59    
gb|EMS50853.1|  hypothetical protein TRIUR3_18749                       206   3e-59    
emb|CBI19230.3|  unnamed protein product                                207   4e-59    
gb|KJB58951.1|  hypothetical protein B456_009G232000                    208   4e-59    
ref|XP_007018161.1|  Auxin F-box protein 5 isoform 2                    207   4e-59    
emb|CDP11468.1|  unnamed protein product                                209   5e-59    
emb|CDX83172.1|  BnaA03g23340D                                          208   5e-59    
ref|XP_009763830.1|  PREDICTED: transport inhibitor response 1-li...    208   6e-59    
gb|EMT26241.1|  hypothetical protein F775_11202                         204   7e-59    
ref|XP_001775745.1|  TIRB2 TIR1-like auxin receptor protein             207   7e-59    
gb|EAY88836.1|  hypothetical protein OsI_10308                          203   8e-59    
ref|XP_002283927.2|  PREDICTED: transport inhibitor response 1-li...    207   9e-59    
gb|AEN82286.1|  AT3G62980-like protein                                  195   9e-59    
ref|XP_002302328.1|  hypothetical protein POPTR_0002s10310g             208   9e-59    
ref|XP_009391335.1|  PREDICTED: transport inhibitor response 1-li...    207   1e-58    
ref|NP_001167946.1|  uncharacterized protein LOC100381660               196   1e-58    
ref|XP_004299699.1|  PREDICTED: transport inhibitor response 1-li...    207   2e-58    
ref|XP_009134037.1|  PREDICTED: transport inhibitor response 1-li...    207   2e-58    
ref|XP_004953988.1|  PREDICTED: F-box protein FBX14-like                207   2e-58    
ref|XP_011016884.1|  PREDICTED: transport inhibitor response 1-li...    207   2e-58    
gb|KHG12530.1|  hypothetical protein F383_18959                         207   2e-58    
ref|XP_004985419.1|  PREDICTED: transport inhibitor response 1-li...    206   2e-58    
ref|XP_002452866.1|  hypothetical protein SORBIDRAFT_04g033850          207   2e-58    
ref|XP_009373673.1|  PREDICTED: transport inhibitor response 1-li...    206   3e-58    
ref|XP_007018160.1|  Auxin F-box protein 5 isoform 1                    207   3e-58    
gb|AFW73532.1|  hypothetical protein ZEAMMB73_849714                    207   3e-58    
ref|XP_003602960.1|  F-box family protein                               205   4e-58    
ref|XP_003615232.1|  F-box family protein                               206   5e-58    
dbj|BAD19397.1|  F-box containing protein TIR1-like                     200   6e-58    
ref|XP_006647937.1|  PREDICTED: transport inhibitor response 1-li...    205   6e-58    
gb|KHN08256.1|  Transport inhibitor response 1-like protein             204   1e-57    
emb|CAB45074.1|  transport inhibitor response-like protein              204   1e-57    
ref|NP_567702.2|  auxin signaling F-BOX 4                               204   1e-57    
ref|NP_568718.1|  auxin F-box protein 5                                 204   2e-57    
ref|XP_003523780.1|  PREDICTED: transport inhibitor response 1-li...    204   2e-57    
gb|EAZ25866.1|  hypothetical protein OsJ_09705                          203   2e-57    
ref|XP_006285271.1|  hypothetical protein CARUB_v10006645mg             204   2e-57    
ref|XP_003558633.1|  PREDICTED: transport inhibitor response 1-li...    203   2e-57    
ref|XP_002865768.1|  auxin F-box protein 5                              203   3e-57    
gb|EMS64215.1|  hypothetical protein TRIUR3_23956                       201   3e-57    
ref|XP_008338910.1|  PREDICTED: transport inhibitor response 1-li...    203   4e-57    
gb|AAN64135.1|  Putative F-box containing protein TIR1                  202   5e-57    
dbj|BAK00859.1|  predicted protein                                      203   5e-57    
ref|XP_010439045.1|  PREDICTED: F-box protein FBX14                     203   5e-57    
ref|XP_010433773.1|  PREDICTED: F-box protein FBX14-like                203   6e-57    
gb|ADG38658.1|  AT3G62980-like protein                                  191   6e-57    
dbj|BAK07267.1|  predicted protein                                      202   8e-57    
gb|ADG38664.1|  AT3G62980-like protein                                  190   9e-57    
ref|XP_002465737.1|  hypothetical protein SORBIDRAFT_01g044720          201   1e-56    
ref|XP_001771423.1|  TIR1-like auxin receptor                           201   1e-56    
ref|XP_010448570.1|  PREDICTED: F-box protein FBX14-like                202   2e-56    
ref|XP_006656778.1|  PREDICTED: transport inhibitor response 1-li...    200   2e-56    
ref|XP_008219380.1|  PREDICTED: transport inhibitor response 1-li...    201   3e-56    
gb|EMS61945.1|  hypothetical protein TRIUR3_34918                       197   4e-56    
ref|XP_008677495.1|  PREDICTED: uncharacterized protein LOC100381...    201   4e-56    
ref|XP_003544234.1|  PREDICTED: transport inhibitor response 1-li...    201   5e-56    
ref|XP_008466180.1|  PREDICTED: transport inhibitor response 1-li...    200   7e-56    
gb|EEC74038.1|  hypothetical protein OsI_09014                          199   8e-56    
gb|EMT11181.1|  hypothetical protein F775_20551                         201   9e-56    
ref|XP_004136263.2|  PREDICTED: transport inhibitor response 1-li...    199   9e-56    
emb|CDY03450.1|  BnaC01g16320D                                          199   1e-55    
emb|CDY34286.1|  BnaA01g13890D                                          199   2e-55    
ref|XP_009138011.1|  PREDICTED: F-box protein FBX14                     199   2e-55    
ref|XP_010675461.1|  PREDICTED: transport inhibitor response 1-li...    198   2e-55    
ref|NP_001048183.1|  Os02g0759700                                       199   2e-55    
ref|XP_008651820.1|  PREDICTED: F-box protein FBX14-like                198   2e-55    
ref|XP_008466181.1|  PREDICTED: transport inhibitor response 1-li...    197   5e-55    
ref|XP_008658847.1|  PREDICTED: uncharacterized protein LOC100383...    197   5e-55    
gb|KGN60246.1|  hypothetical protein Csa_3G890020                       198   7e-55    
ref|XP_006663433.1|  PREDICTED: uncharacterized protein LOC102708848    202   7e-55    
gb|ACB30654.1|  AFB1                                                    185   8e-55    
ref|XP_002982385.1|  hypothetical protein SELMODRAFT_445149             197   9e-55    
gb|AIT18062.1|  auxin signaling F-box protein 5                         197   1e-54    
ref|XP_002966544.1|  hypothetical protein SELMODRAFT_439561             196   1e-54    
gb|AIT18064.1|  auxin signaling F-box protein 5                         196   2e-54    
ref|NP_001067865.1|  Os11g0462900                                       199   6e-54    
gb|EAZ18296.1|  hypothetical protein OsJ_33834                          198   7e-54    
ref|XP_002867664.1|  hypothetical protein ARALYDRAFT_492408             194   8e-54    
gb|KDO81095.1|  hypothetical protein CISIN_1g035790mg                   182   4e-53    
ref|NP_001169310.1|  uncharacterized protein LOC100383174               191   9e-53    
ref|XP_011652571.1|  PREDICTED: transport inhibitor response 1-li...    191   1e-52    
gb|AAC32254.1|  unknown                                                 179   2e-52    
ref|XP_006413438.1|  hypothetical protein EUTSA_v10024672mg             186   7e-51    
ref|XP_006413440.1|  hypothetical protein EUTSA_v10024671mg             186   7e-51    
tpg|DAA38082.1|  TPA: hypothetical protein ZEAMMB73_041546              184   7e-51    
gb|ACB31753.1|  TIR1                                                    173   2e-50    
ref|XP_010445996.1|  PREDICTED: transport inhibitor response 1-li...    182   2e-49    
gb|EMS56796.1|  hypothetical protein TRIUR3_17029                       180   3e-48    
ref|XP_010525658.1|  PREDICTED: transport inhibitor response 1-li...    178   5e-48    
gb|AGH62001.1|  auxin signaling F-box 3                                 164   3e-47    
emb|CDY68868.1|  BnaCnng60850D                                          174   1e-46    
gb|AEX12471.1|  hypothetical protein 2_10398_01                         163   1e-46    
emb|CDX89163.1|  BnaA04g00230D                                          167   3e-44    
ref|XP_007225690.1|  hypothetical protein PRUPE_ppa003137mg             162   3e-42    
ref|XP_009378961.1|  PREDICTED: protein TRANSPORT INHIBITOR RESPO...    106   2e-23    
ref|XP_001756729.1|  predicted protein                                  106   2e-22    
ref|XP_001754224.1|  TLP1A TIR1-like auxin receptor protein             101   1e-20    
ref|XP_002960717.1|  hypothetical protein SELMODRAFT_163526             100   1e-20    
ref|XP_002983954.1|  hypothetical protein SELMODRAFT_445769             100   2e-20    
gb|ABR17804.1|  unknown                                               99.0    7e-20    
gb|AIT39744.1|  coronatine-insensitive protein 1                      99.0    7e-20    
gb|AEW07913.1|  hypothetical protein 0_14255_01                       91.3    1e-19    
gb|AFK41422.1|  unknown                                               90.9    1e-19    
ref|XP_010266476.1|  PREDICTED: transport inhibitor response 1-li...  97.4    2e-19    
ref|XP_010256650.1|  PREDICTED: coronatine-insensitive protein 1-...  95.1    1e-18    
ref|XP_002988257.1|  hypothetical protein SELMODRAFT_11318            94.7    1e-18    
ref|XP_006848115.1|  PREDICTED: coronatine-insensitive protein 1      95.1    1e-18    
ref|XP_010690074.1|  PREDICTED: coronatine-insensitive protein 1      94.7    2e-18    
gb|EPS60135.1|  hypothetical protein M569_14670                       94.4    2e-18    
ref|XP_002991390.1|  hypothetical protein SELMODRAFT_186055           94.4    3e-18    



>emb|CDP16729.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLCTLNPTVPDAVT  PLDEGFGAIVQSCKGLKRLSV 
Sbjct  267  CQQMTNAALITVAKNCPNFIRFRLCTLNPTVPDAVTQLPLDEGFGAIVQSCKGLKRLSVS  326

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG+SDKGMLYVLNGCKKLKKL IRDSPFG+ ALLA
Sbjct  327  GLLTDQVFLYIGMYAEQLEMLSIAFAGESDKGMLYVLNGCKKLKKLEIRDSPFGDVALLA  386

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTL ACK LA KMPRLNVEIINE+EQ E S DD QKVEKMYLY
Sbjct  387  DMGKYETMRSLWMSSCEVTLEACKKLATKMPRLNVEIINENEQMEASTDDKQKVEKMYLY  446

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPR+DAP FVWTL
Sbjct  447  RTLVGPRRDAPAFVWTL  463



>ref|XP_011098945.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Sesamum indicum]
Length=579

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLCTL+PT+PDAVT QPLDEGFGAIVQSCKGLKRLSV 
Sbjct  383  CQQMTNAALITVAKNCPNFIRFRLCTLDPTIPDAVTNQPLDEGFGAIVQSCKGLKRLSVS  442

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKLKKL IRDSPFGN ALLA
Sbjct  443  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLKKLEIRDSPFGNVALLA  502

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT GACK LA+KMPRLNVEIINE EQ E S DD  +VEKMYLY
Sbjct  503  DVGKYETMRSLWMSSCEVTFGACKTLAEKMPRLNVEIINEGEQIEASPDDRHRVEKMYLY  562

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPR+DAP FVWTL
Sbjct  563  RTLVGPRRDAPDFVWTL  579



>ref|XP_009604230.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Nicotiana tomentosiformis]
Length=579

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSV 
Sbjct  383  CQQMTNAALITVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVS  442

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKK+KKL IRDSPFGN ALLA
Sbjct  443  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKMKKLEIRDSPFGNVALLA  502

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS +VTLGACK +A+KMPRLNVEII+ES+Q +T  DD QKVEKMYLY
Sbjct  503  DVGKYETMRSLWMSSCQVTLGACKAVAQKMPRLNVEIISESDQTDTCSDDRQKVEKMYLY  562

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP FV TL
Sbjct  563  RTLVGPRKDAPDFVRTL  579



>ref|XP_009771789.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Nicotiana sylvestris]
Length=579

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSV 
Sbjct  383  CQQMTNAALITVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVS  442

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKK+KKL IRDSPFGN ALLA
Sbjct  443  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKMKKLEIRDSPFGNVALLA  502

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS +VTLGACK +A+KMPRLNVEII+E++Q +T  DD QKVEK+YLY
Sbjct  503  DVGKYETMRSLWMSSCQVTLGACKAVAQKMPRLNVEIISENDQIDTCSDDRQKVEKIYLY  562

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKD+P FV TL
Sbjct  563  RTLVGPRKDSPDFVRTL  579



>ref|XP_012067329.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Jatropha curcas]
 gb|KDP41834.1| hypothetical protein JCGZ_26852 [Jatropha curcas]
Length=571

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNF RFRLC L+PT PDAVTMQPLDEGFGAIV SCKGL+RLS+ 
Sbjct  375  CQQMTNAALITVAKNCPNFTRFRLCILDPTKPDAVTMQPLDEGFGAIVHSCKGLRRLSLT  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGM YVLNGCK+L+KL IRDSPFGNAALL 
Sbjct  435  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMQYVLNGCKRLRKLEIRDSPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAKKMPRLNVEI+NE+EQAE   DD QKV+KMYLY
Sbjct  495  DVGKYETMRSLWMSSCEVTLGGCKTLAKKMPRLNVEIMNENEQAEFGVDDSQKVDKMYLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G RKDAP FVWTL
Sbjct  555  RTLVGQRKDAPEFVWTL  571



>ref|XP_008368441.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like, partial [Malus 
domestica]
Length=430

 Score =   340 bits (873),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTM+PLDEGFGAIVQ+CK ++RLS+ 
Sbjct  234  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMRPLDEGFGAIVQACKNIRRLSLX  293

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SD GMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  294  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDNGMLYVLNGCKKLRKLEIRDSPFGNEALLK  353

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAK+MPRLNVEIINES+Q E+  DD Q+VEKMYLY
Sbjct  354  DVGKYETMRSLWMSSCEVTLGGCKALAKEMPRLNVEIINESDQMESGVDDEQRVEKMYLY  413

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R+D P FVWTL
Sbjct  414  RTLVGKRRDTPEFVWTL  430



>gb|EYU31866.1| hypothetical protein MIMGU_mgv1a003473mg [Erythranthe guttata]
Length=583

 Score =   343 bits (880),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 175/200 (88%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLCTLNP +PDAVT  PLDEGFGAIVQSCKGLKRLSV 
Sbjct  384  CQQMTNAALITVAKNCPNFIRFRLCTLNPVIPDAVTNLPLDEGFGAIVQSCKGLKRLSVS  443

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKLKKL IRDSPFGNAALL+
Sbjct  444  GRLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLKKLEIRDSPFGNAALLS  503

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE---QAETSHDDGQKVEKM  227
            D GKYETMRSLWMSS EVT GACK LA+KMP LNVEIINE E   +A +S D   +VEKM
Sbjct  504  DMGKYETMRSLWMSSCEVTYGACKTLAEKMPTLNVEIINEGEDQVEASSSPDARHRVEKM  563

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRTL GPR+DAP FVWTL
Sbjct  564  YLYRTLVGPRRDAPDFVWTL  583



>ref|XP_008341250.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Malus domestica]
Length=572

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTM+PLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMRPLDEGFGAIVQACKNIRRLSLX  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SD GMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDNGMLYVLNGCKKLRKLEIRDSPFGNEALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAK+MPRLNVEIINES+Q E+  DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAKEMPRLNVEIINESDQMESGVDDEQRVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R+D P FVWTL
Sbjct  556  RTLVGKRRDTPEFVWTL  572



>gb|EPS70592.1| transport inhibitor response protein [Genlisea aurea]
Length=576

 Score =   340 bits (872),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 174/200 (87%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI V+KNCPNFIRFRLCTLNPT+PDAVT QPLDEGFGAIVQSC+GLKRLSV 
Sbjct  377  CSQMTNAALITVSKNCPNFIRFRLCTLNPTIPDAVTNQPLDEGFGAIVQSCRGLKRLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMY EQLEMLSIAFAG SDKGMLYVLNGCKKLKKL IRDSPFGN ALLA
Sbjct  437  GLLTDQVFLYIGMYGEQLEMLSIAFAGDSDKGMLYVLNGCKKLKKLEIRDSPFGNMALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSH---DDGQKVEKM  227
            D GKYE+MRSLWMSS EVTLG C++LA KMPRLNVEIINE    + +H   +D  +VEKM
Sbjct  497  DVGKYESMRSLWMSSCEVTLGGCRLLADKMPRLNVEIINEGGPDQNNHSGSNDQNRVEKM  556

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYR+L GPR DAP FVWTL
Sbjct  557  YLYRSLVGPRSDAPDFVWTL  576



>gb|AIT18061.1| auxin signaling F-box protein 2 [Prunus salicina]
Length=572

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTMQPLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTRPDAVTMQPLDEGFGAIVQACKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GLLTDKVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNMALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LA+KMPRLNVEIINE++Q E   DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAEKMPRLNVEIINENDQMELGLDDEQRVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPR D P FVWTL
Sbjct  556  RTLVGPRNDKPEFVWTL  572



>ref|XP_007217221.1| hypothetical protein PRUPE_ppa003465mg [Prunus persica]
 gb|AFB74453.1| transport inhibitor response protein [Prunus persica]
 gb|EMJ18420.1| hypothetical protein PRUPE_ppa003465mg [Prunus persica]
Length=572

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTMQPLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTRPDAVTMQPLDEGFGAIVQACKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GLLTDKVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNMALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LA+KMPRLNVEIINE++Q E   DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAEKMPRLNVEIINENDQMELGLDDEQQVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPR D P FVWTL
Sbjct  556  RTLVGPRNDTPEFVWTL  572



>ref|XP_002300140.1| transport inhibitor response family protein [Populus trichocarpa]
 gb|EEE84945.1| transport inhibitor response family protein [Populus trichocarpa]
Length=571

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNF RFRLC L+PT PDA T QPLDEGFGAIV SCKGL+RLS+ 
Sbjct  375  CQQMTNAALITVAKNCPNFTRFRLCILDPTKPDADTNQPLDEGFGAIVHSCKGLRRLSMS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGM Y+LNGCKKL+KL IRD PFGNAALL 
Sbjct  435  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMQYLLNGCKKLRKLEIRDCPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS ++TLG CK LAKKMPRLNVEIINES+Q + + DDGQKVEKM+LY
Sbjct  495  DVGKYETMRSLWMSSCDITLGGCKSLAKKMPRLNVEIINESDQMDITADDGQKVEKMFLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP FVWTL
Sbjct  555  RTLAGRRKDAPEFVWTL  571



>gb|AIT18060.1| auxin signaling F-box protein 2 [Prunus salicina]
Length=572

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTMQPLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTRPDAVTMQPLDEGFGAIVQACKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQL+MLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GLLTDKVFLYIGMYAEQLQMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNMALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LA+KMPRLNVEIINE++Q E   DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAEKMPRLNVEIINENDQMELGLDDEQRVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPR D P FVWTL
Sbjct  556  RTLVGPRNDKPEFVWTL  572



>ref|XP_007031984.1| Auxin signaling F-box 2 [Theobroma cacao]
 gb|EOY02910.1| Auxin signaling F-box 2 [Theobroma cacao]
Length=572

 Score =   337 bits (865),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+P  PDAVT QPLDEGFGAIVQSCKGLKRLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPIKPDAVTNQPLDEGFGAIVQSCKGLKRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGNAALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LA+KMP L+VEIIN+++Q E S DD QKVEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKTLAEKMPSLSVEIINDTDQMEFSLDDRQKVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R+DAP FVW L
Sbjct  556  RTLVGHREDAPEFVWIL  572



>ref|XP_011009720.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Populus euphratica]
Length=571

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNF RFRLC L+PT PDAVT QPLDEGFGAIV SCKGL+RLS+ 
Sbjct  375  CQQMTNAALITVAKNCPNFTRFRLCILDPTKPDAVTNQPLDEGFGAIVHSCKGLRRLSMA  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGM Y+LNGCKKL+KL IRD PFGNAALL 
Sbjct  435  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMQYLLNGCKKLRKLEIRDCPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAKKMPRLNVEIINE++Q + S DD QKVEKM+LY
Sbjct  495  DVGKYETMRSLWMSSCEVTLGGCKSLAKKMPRLNVEIINENDQMDVSADDRQKVEKMFLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG R+DAP FVWTL
Sbjct  555  RTLAGRREDAPEFVWTL  571



>ref|XP_009344196.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Pyrus x bretschneideri]
Length=572

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTM+PLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMRPLDEGFGAIVQACKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG SD GMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  436  GLLTDRVFLYIGMYAEQLEMLSIAFAGDSDNGMLYVLNGCKKLRKLEIRDSPFGNEALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAK+MP LNVEIINES+Q E   DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAKRMPTLNVEIINESDQVEIGGDDEQRVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R+D P FVWTL
Sbjct  556  RTLVGKRRDTPEFVWTL  572



>gb|KHM99229.1| Protein AUXIN SIGNALING F-BOX 3 [Glycine soja]
Length=572

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSC+ L+RLS+ 
Sbjct  376  CHQMTNAALITVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCRRLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAE+LEMLSIAFAG+SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GQLTDQVFLYIGMYAEKLEMLSIAFAGESDKGMLYVLNGCKKLRKLEIRDCPFGNVALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK+LAKKMPRLNVEI NE+EQ + S +DGQKVEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTVGACKLLAKKMPRLNVEIFNENEQEDCSLEDGQKVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP +VWTL
Sbjct  556  RTLAGKRKDAPEYVWTL  572



>ref|XP_003548933.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
Length=572

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSC+ L+RLS+ 
Sbjct  376  CHQMTNAALITVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCRRLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAE+LEMLSIAFAG+SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GQLTDQVFLYIGMYAEKLEMLSIAFAGESDKGMLYVLNGCKKLRKLEIRDCPFGNVALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK+LAKKMPRLNVEI NE+EQ + S +DGQKVEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTVGACKLLAKKMPRLNVEIFNENEQEDCSLEDGQKVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP +VWTL
Sbjct  556  RTLAGKRKDAPEYVWTL  572



>ref|XP_006373115.1| transport inhibitor response family protein [Populus trichocarpa]
 gb|ERP50912.1| transport inhibitor response family protein [Populus trichocarpa]
Length=571

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM N ALI VAKNCPNF RFRLC L+PT PDAVT QPLDEGFGAIV SCKGL+RLS+ 
Sbjct  375  CQQMTNVALITVAKNCPNFTRFRLCILDPTKPDAVTNQPLDEGFGAIVHSCKGLRRLSMT  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGM Y+LNGCKKL+KL IRD PFGNAALL 
Sbjct  435  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMQYLLNGCKKLRKLEIRDCPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAKKMPRLNVEIINE++Q + S DD QKVEKM+LY
Sbjct  495  DVGKYETMRSLWMSSCEVTLGGCKSLAKKMPRLNVEIINENDQMDASADDRQKVEKMFLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG R+DAP FVWTL
Sbjct  555  RTLAGRREDAPEFVWTL  571



>ref|XP_008231044.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Prunus mume]
Length=572

 Score =   335 bits (860),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTMQPLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTRPDAVTMQPLDEGFGAIVQACKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQL+MLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GLLTDKVFLYIGMYAEQLQMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNMALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LA+KMP LNVEIINE++Q E   DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAEKMPGLNVEIINENDQMELGLDDEQRVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPR D P FVWTL
Sbjct  556  RTLVGPRNDTPEFVWTL  572



>ref|XP_008379063.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Malus domestica]
Length=570

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 173/197 (88%), Gaps = 2/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PDAVTMQPLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDAVTMQPLDEGFGAIVQACKKIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDSPFGNKALLR  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYE MRSLWMSS EVTLG CK LAKKMPRLNVEIINE++Q +   DD Q+VEKMYLY
Sbjct  496  DVGKYEAMRSLWMSSCEVTLGGCKALAKKMPRLNVEIINENDQMDL--DDEQRVEKMYLY  553

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R+D P FVWTL
Sbjct  554  RTLVGKRRDTPEFVWTL  570



>ref|XP_009378024.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Pyrus x bretschneideri]
Length=572

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC  +PT PDAVTM+PLDEGFGAIVQ+CK ++RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCIFDPTKPDAVTMRPLDEGFGAIVQACKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG SD GMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  436  GLLTDRVFLYIGMYAEQLEMLSIAFAGDSDNGMLYVLNGCKKLRKLEIRDSPFGNEALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAK+MP LNVEIINES+Q E   DD Q+VEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKALAKQMPTLNVEIINESDQVEIGVDDEQRVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R+D P FVWTL
Sbjct  556  RTLVGKRRDTPEFVWTL  572



>gb|AGH62009.1| auxin signaling F-box 3, partial [Arachis hypogaea]
 gb|AGH62010.1| auxin signaling F-box 3, partial [Arachis hypogaea]
Length=265

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRL  L+ T PD  T QPLDEGFGAIVQSC+ L+RLS+ 
Sbjct  69   CHQMTNAALITVAKNCPNFIRFRLAILDATKPDPDTNQPLDEGFGAIVQSCRRLRRLSLS  128

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTD+VFLYIGMYAEQLEMLSIAFAG+SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  129  GQLTDKVFLYIGMYAEQLEMLSIAFAGESDKGMLYVLNGCKKLRKLEIRDCPFGNTALLT  188

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK+LA KMPRLNVEI NE+E A+   DD QKVEKMYLY
Sbjct  189  DVGKYETMRSLWMSSCEVTVGACKVLAMKMPRLNVEIFNENEPADCEPDDVQKVEKMYLY  248

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP +VWTL
Sbjct  249  RTLAGKRKDAPEYVWTL  265



>ref|XP_011045792.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Populus euphratica]
Length=571

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNF RFRLC L+PT PD  T QPLDEGFGAIV SCKGL+RLS+ 
Sbjct  375  CQQMTNAALITVAKNCPNFTRFRLCILDPTKPDTDTNQPLDEGFGAIVHSCKGLRRLSMS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGM Y+LNGCKKL+KL IRD PFGNAALL 
Sbjct  435  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMQYLLNGCKKLRKLEIRDCPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS +VTLG CK LAKKMPRLNVEIINES+Q + + DD QKVEKM+LY
Sbjct  495  DVGKYETMRSLWMSSCDVTLGGCKSLAKKMPRLNVEIINESDQMDITADDRQKVEKMFLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP FVWTL
Sbjct  555  RTLAGRRKDAPEFVWTL  571



>ref|XP_007161649.1| hypothetical protein PHAVU_001G087000g [Phaseolus vulgaris]
 gb|ESW33643.1| hypothetical protein PHAVU_001G087000g [Phaseolus vulgaris]
Length=573

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSC+ L+RLS+ 
Sbjct  377  CHQMTNAALITVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCRRLRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAE+LEMLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFG+ ALL 
Sbjct  437  GQLTDQVFLYIGMYAEKLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGDMALLT  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK+LAKKMPRLNVEI NE+EQ + S +DGQ+VEKMYLY
Sbjct  497  DVGKYETMRSLWMSSCEVTVGACKLLAKKMPRLNVEIFNENEQEDCSLEDGQRVEKMYLY  556

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP +VWTL
Sbjct  557  RTLAGKRKDAPEYVWTL  573



>gb|KHG11169.1| auxin signaling f-box 2 -like protein [Gossypium arboreum]
Length=572

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+P  PD VT QPLDEGFGAIVQSCKGLKRLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPIKPDPVTNQPLDEGFGAIVQSCKGLKRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFA  SDKGMLYVLNGCKKL+KL IRD PFG+AALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAADSDKGMLYVLNGCKKLRKLEIRDCPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK +A+KMP LNVEII+ESEQ E + DD QKV+KMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKAVAEKMPSLNVEIIDESEQMEFNLDDKQKVDKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G RKDAP +VW L
Sbjct  556  RTLVGHRKDAPEYVWIL  572



>gb|EYU34827.1| hypothetical protein MIMGU_mgv1a003674mg [Erythranthe guttata]
Length=570

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 172/201 (86%), Gaps = 5/201 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLCTLNPT+PDA T  PLDEGFGAIVQSCKGLKRLSV 
Sbjct  371  CQQMTNAALITVAKNCPNFIRFRLCTLNPTIPDAATNLPLDEGFGAIVQSCKGLKRLSVS  430

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMY E LEMLSIAFAG SDKGMLYVLNGCKKLKKL IRDSPFG+ ALLA
Sbjct  431  GLLTDQVFLYIGMYGEHLEMLSIAFAGNSDKGMLYVLNGCKKLKKLEIRDSPFGDVALLA  490

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE----TSHDDGQKVEK  230
            D GKYETMRSLWMSS EVT G CK +A+KMPRLNVEIIN +E  E        DG+KVEK
Sbjct  491  DVGKYETMRSLWMSSCEVTFGGCKTVAQKMPRLNVEIIN-NEGGEPMDDDDDVDGKKVEK  549

Query  229  MYLYRTLAGPRKDAPGFVWTL  167
            MYLYRTL GPR+DAP FVWTL
Sbjct  550  MYLYRTLVGPRRDAPEFVWTL  570



>ref|XP_003553972.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
 gb|KHN28562.1| Protein AUXIN SIGNALING F-BOX 3 [Glycine soja]
Length=572

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSC+ L+RLS+ 
Sbjct  376  CHQMTNAALITVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCRRLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAE+LEMLSIAFAG  DKGMLYVLNGCKKL+KL IRD PFG+ ALL 
Sbjct  436  GKLTDQVFLYIGMYAEKLEMLSIAFAGDGDKGMLYVLNGCKKLRKLEIRDCPFGDMALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK+LAKKMPRLNVEI NE+EQ + S +DGQKVEKMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTVGACKLLAKKMPRLNVEIFNENEQEDCSLEDGQKVEKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP +VWTL
Sbjct  556  RTLAGKRKDAPEYVWTL  572



>ref|XP_003624463.1| Protein AUXIN SIGNALING F-BOX [Medicago truncatula]
 gb|AES80681.1| transport inhibitor response 1 protein [Medicago truncatula]
Length=571

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALIAVAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSCK L+RLS+ 
Sbjct  375  CHQMTNAALIAVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCKRLRRLSLS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAEQLEMLSIAFAG+SDKGMLYVLNGCKK++KL IRD PFG+ ALL 
Sbjct  435  GQLTDQVFLYIGMYAEQLEMLSIAFAGESDKGMLYVLNGCKKIRKLEIRDCPFGDTALLT  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+ ACK LAKKMPRLNVEI +ESEQA+   +DGQ+VEKMYLY
Sbjct  495  DIGKYETMRSLWMSSCEVTVEACKTLAKKMPRLNVEIFSESEQADCYVEDGQRVEKMYLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AG R+DAP +VWTL
Sbjct  555  RTVAGKREDAPDYVWTL  571



>ref|XP_010096050.1| Protein AUXIN SIGNALING F-BOX 2 [Morus notabilis]
 gb|EXB62856.1| Protein AUXIN SIGNALING F-BOX 2 [Morus notabilis]
Length=573

 Score =   330 bits (845),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PD VT QPLDEGFGAIVQ+CK L+RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDPVTSQPLDEGFGAIVQACKSLRRLSLT  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLS+AFAG SDKGMLYVL GCKKL+KL IRD PFG+ ALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSVAFAGDSDKGMLYVLRGCKKLRKLEIRDCPFGDVALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETS-HDDGQKVEKMYL  221
            D GKYETMRSLWMSS EVTLGACK +A+KMP LNVEIINE +Q E    DD QKVEKMYL
Sbjct  496  DVGKYETMRSLWMSSCEVTLGACKTVARKMPSLNVEIINEHDQTEFCLDDDEQKVEKMYL  555

Query  220  YRTLAGPRKDAPGFVWTL  167
            YRT  GPR DAP FVWTL
Sbjct  556  YRTTVGPRTDAPEFVWTL  573



>ref|XP_004493010.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cicer arietinum]
Length=571

 Score =   327 bits (839),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSCK L+RLS+ 
Sbjct  375  CHQMTNAALITVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCKRLRRLSLS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYA+QLEMLSIAFAG+SDKGMLYVLNGCKKL+KL +RD PFG++ALL 
Sbjct  435  GKLTDQVFLYIGMYADQLEMLSIAFAGESDKGMLYVLNGCKKLRKLEMRDCPFGDSALLT  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK LAKKMPRLNVEI NESEQ +   +D Q+VEKMYLY
Sbjct  495  DIGKYETMRSLWMSSCEVTVGACKTLAKKMPRLNVEIFNESEQEDCDMEDEQRVEKMYLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AG R DAP +VWTL
Sbjct  555  RTVAGKRNDAPEYVWTL  571



>gb|AFK34677.1| unknown [Lotus japonicus]
Length=293

 Score =   318 bits (814),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCPNFIRFRLC L+ T PD  TMQPLDEGFGAIVQSCK L+RLS+ 
Sbjct  97   CHQMTNAALITVAKNCPNFIRFRLCILDATKPDPDTMQPLDEGFGAIVQSCKRLRRLSLS  156

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
              LTDQVFLYIGMYAEQLEMLSIAFAG+SD+GM Y LNGCKKL+KL IRD PFGN ALLA
Sbjct  157  DQLTDQVFLYIGMYAEQLEMLSIAFAGESDQGMQYALNGCKKLRKLEIRDCPFGNMALLA  216

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVT+GACK LA+KMPRLNVEI NE+EQ E S +D Q VEKMYLY
Sbjct  217  DIGKYETMRSLWMSSCEVTVGACKELAEKMPRLNVEIFNENEQEECSLEDEQSVEKMYLY  276

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG R DAP +V TL
Sbjct  277  RTLAGKRNDAPEYVCTL  293



>gb|ADL70248.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
 gb|ADL70253.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=261

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  62   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  121

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  122  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  181

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  182  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  241

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  242  YLYRTVVGTRKDAPPYVRIL  261



>gb|ABG56238.1| auxin-responsive factor TIR1-like protein [Populus tomentosa]
Length=571

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNF RFRLC L+PT PD  T QPLDEGFGAIV  CKGL+RLS+ 
Sbjct  375  CQQMTNAALITVAKNCPNFTRFRLCILDPTKPDGDTNQPLDEGFGAIVHLCKGLRRLSMS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGM Y+L+GCKKL+KL IRD PFGNAALL 
Sbjct  435  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMQYLLSGCKKLRKLEIRDCPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG C+ LAKKMPRLNVEIINE++Q + S DD  KVEKM+LY
Sbjct  495  DVGKYETMRSLWMSSCEVTLGGCRSLAKKMPRLNVEIINENDQMDASADDTLKVEKMFLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG R+DAP FVWTL
Sbjct  555  RTLAGRREDAPEFVWTL  571



>gb|ADB92057.2| auxin signaling F-box 3 [Arabidopsis thaliana]
 gb|ADB92061.2| auxin signaling F-box 3 [Arabidopsis thaliana]
 gb|ADL70245.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
 gb|ADL70250.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
 gb|ADL70251.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=278

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  79   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  138

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  139  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  198

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  199  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  258

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  259  YLYRTVVGTRKDAPPYVRIL  278



>gb|KJB40642.1| hypothetical protein B456_007G072400 [Gossypium raimondii]
Length=533

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+P  PD VT QPLDEGFGAIVQSCKGLKRLS+ 
Sbjct  337  CQQMTNAALITVAKNCPNFIRFRLCILDPIKPDPVTNQPLDEGFGAIVQSCKGLKRLSLS  396

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFA  SDKGMLYVLNGCKKL+KL IRD PFG+AALL 
Sbjct  397  GLLTDQVFLYIGMYAEQLEMLSIAFAADSDKGMLYVLNGCKKLRKLEIRDCPFGDAALLE  456

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK +A+KMP LNVEII+E EQ E + DD QKV+KMYLY
Sbjct  457  DVGKYETMRSLWMSSCEVTLGGCKSVAEKMPSLNVEIIDECEQMEFNLDDKQKVDKMYLY  516

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G RKDAP +V  L
Sbjct  517  RTLVGHRKDAPEYVSIL  533



>gb|ADL70254.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=271

 Score =   315 bits (807),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  72   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  131

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  132  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  191

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  192  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  251

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  252  YLYRTVVGTRKDAPPYVRIL  271



>gb|ADL70247.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=281

 Score =   315 bits (808),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  82   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  141

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  142  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  201

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  202  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  261

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  262  YLYRTVVGTRKDAPPYVRIL  281



>gb|ADB92059.2| auxin signaling F-box 3 [Arabidopsis thaliana]
 gb|ADB92060.2| auxin signaling F-box 3 [Arabidopsis thaliana]
 gb|ADL70243.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
 gb|ADL70246.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
 gb|ADL70249.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
 gb|ADL70255.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=279

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  80   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  139

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  140  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  199

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  200  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  259

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  260  YLYRTVVGTRKDAPPYVRIL  279



>gb|ADB92058.1| auxin signaling F-box 3 [Arabidopsis thaliana]
Length=274

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  75   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  134

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  135  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  194

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  195  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  254

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  255  YLYRTVVGTRKDAPPYVRIL  274



>gb|ADL70244.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=277

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  78   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  137

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  138  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  197

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVT G CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  198  DVGRYETMRSLWMSSCEVTFGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  257

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  258  YLYRTVVGTRKDAPPYVRIL  277



>gb|KJB40643.1| hypothetical protein B456_007G072400 [Gossypium raimondii]
Length=572

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+P  PD VT QPLDEGFGAIVQSCKGLKRLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILDPIKPDPVTNQPLDEGFGAIVQSCKGLKRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFA  SDKGMLYVLNGCKKL+KL IRD PFG+AALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAADSDKGMLYVLNGCKKLRKLEIRDCPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK +A+KMP LNVEII+E EQ E + DD QKV+KMYLY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKSVAEKMPSLNVEIIDECEQMEFNLDDKQKVDKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G RKDAP +V  L
Sbjct  556  RTLVGHRKDAPEYVSIL  572



>ref|XP_010066425.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Eucalyptus grandis]
 gb|KCW64320.1| hypothetical protein EUGRSUZ_G01952 [Eucalyptus grandis]
Length=572

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL  VA+NCPNFIRFRLC L PT PD+ T QPLDEGFGAIVQSCKG++RLS+ 
Sbjct  376  CQQMTNAALKIVAQNCPNFIRFRLCILEPTKPDSSTNQPLDEGFGAIVQSCKGVRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVF YIG +AEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRD PFGN ALL 
Sbjct  436  GLLTDQVFNYIGTFAEQLEMLSIAFAGDNDKGMLYVLNGCKKIRKLEIRDCPFGNIALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS ++TLG CK LAKKMPRLNVEIINE+ + E   DD QKVE+MYLY
Sbjct  496  DVGKYETMRSLWMSSCDITLGGCKTLAKKMPRLNVEIINENNEMEDCIDDEQKVERMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP  VWTL
Sbjct  556  RTLVGPRKDAPEHVWTL  572



>ref|XP_003518127.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
 gb|KHN00616.1| Protein AUXIN SIGNALING F-BOX 3 [Glycine soja]
Length=573

 Score =   322 bits (826),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PD  T+QPLDEGFGAIVQSCK L+RLS+ 
Sbjct  377  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDPDTVQPLDEGFGAIVQSCKQLRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIG+YAEQLEMLSIAFAG+SDK MLYVLNGCKKL+KL IRDSPFG++ALL 
Sbjct  437  GQLTDQVFLYIGVYAEQLEMLSIAFAGESDKAMLYVLNGCKKLRKLEIRDSPFGDSALLM  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS +VT+GACK LAKKMP LNVEI N +E+ +   DDGQKVEK YLY
Sbjct  497  DVGKYETMRSLWMSSCDVTIGACKALAKKMPGLNVEIFNGNEKVDRDVDDGQKVEKTYLY  556

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G RKDAP  VWTL
Sbjct  557  RTLVGRRKDAPEHVWTL  573



>ref|XP_002512866.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
 gb|EEF49369.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
Length=571

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNF RFRLC L+PT PDAVTMQPLDEGFGAIV SC+GL+RLS+ 
Sbjct  375  CQQMTNAALITVAKNCPNFTRFRLCILDPTKPDAVTMQPLDEGFGAIVHSCRGLRRLSLS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAE LEMLSIAFAG SDKGM YVLNGCKKL+KL IRDSPFGNAALL 
Sbjct  435  GLLTDQVFLYIGMYAEHLEMLSIAFAGNSDKGMQYVLNGCKKLRKLEIRDSPFGNAALLM  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LAKKMP LNVEI+NE+EQA+ S DD QKV+KMYLY
Sbjct  495  DVGKYETMRSLWMSSCEVTLGGCKTLAKKMPWLNVEIMNENEQADFSADDTQKVDKMYLY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G R DAP FVWTL
Sbjct  555  RTLVGHRNDAPDFVWTL  571



>ref|XP_010249158.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Nelumbo nucifera]
Length=573

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNF RFRLC L+PT PD VT+QPLDEGFGAIVQSCKGL+RLS+ 
Sbjct  376  CRQMTNAALINVAKNCPNFTRFRLCILDPTKPDHVTLQPLDEGFGAIVQSCKGLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAE+LEMLSIAFAG+SDKGMLYVLNGCK L+KL IRDSPFG+ ALL 
Sbjct  436  GLLTDQVFLYIGMYAERLEMLSIAFAGESDKGMLYVLNGCKNLRKLEIRDSPFGDIALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ-AETSHDDGQKVEKMYL  221
            + GKYETMRSLWMSS +VTLG CK LAKKMPRLNVEIINE +Q  E SHDDG+KVEKM++
Sbjct  496  NVGKYETMRSLWMSSCDVTLGGCKALAKKMPRLNVEIINEKDQMMENSHDDGEKVEKMFV  555

Query  220  YRTLAGPRKDAPGFVWTL  167
            YRTL GPR+DAP FVWTL
Sbjct  556  YRTLCGPRRDAPDFVWTL  573



>ref|XP_010682986.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NA LI VAKNCPNFIRFRLC L+P  PD VT +PLDEGFGAIVQSCK L+RLS+ 
Sbjct  377  CHQMTNAGLITVAKNCPNFIRFRLCILDPIKPDPVTGEPLDEGFGAIVQSCKRLRRLSIS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA+QLEMLS+AFAG SDK M+ VLNGC+K++KL IRD PFGN ALL 
Sbjct  437  GLLTDQVFLYIGMYAKQLEMLSVAFAGDSDKAMINVLNGCEKIRKLEIRDCPFGNLALLT  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDG-QKVEKMYL  221
            D GKYETMRSLWMSS EVT+GACK+LA+KMPRLNVEII+E+   ET  DD  QKV+KMYL
Sbjct  497  DIGKYETMRSLWMSSCEVTVGACKLLARKMPRLNVEIIDENGLGETYLDDERQKVDKMYL  556

Query  220  YRTLAGPRKDAPGFVWTL  167
            YRTLAGPRKDAP FVWTL
Sbjct  557  YRTLAGPRKDAPEFVWTL  574



>gb|KHN13379.1| Protein AUXIN SIGNALING F-BOX 2 [Glycine soja]
Length=584

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PD  TMQPL+EGFGAIVQSCK L+RLS+ 
Sbjct  388  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDPDTMQPLNEGFGAIVQSCKQLRRLSLS  447

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAEQLEMLS+AFAG+SDK MLYVLNGCKK+ KL IR SPFG++ALL 
Sbjct  448  GQLTDQVFLYIGMYAEQLEMLSVAFAGESDKAMLYVLNGCKKIHKLAIRGSPFGDSALLM  507

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETM+ LWM+S  VT+GACK LA+KMPRLNVEI NE+++ +   DDGQKVEKMYLY
Sbjct  508  DVGKYETMQFLWMTSCNVTVGACKALAEKMPRLNVEIFNENKKVDRDVDDGQKVEKMYLY  567

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP  VWTL
Sbjct  568  RTLAGRRKDAPELVWTL  584



>emb|CBI21294.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI +AKNCPNF RFRLC L+ T  D VTMQPLDEGFGAIVQSCKGL+RLS+ 
Sbjct  267  CQQMTNAALITIAKNCPNFTRFRLCILDATKADPVTMQPLDEGFGAIVQSCKGLRRLSLS  326

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  327  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNVALLT  386

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK+LA+KMPR+NVEIINE +Q E   DD QKV+KM+LY
Sbjct  387  DVGKYETMRSLWMSSCEVTLGGCKVLAEKMPRINVEIINEYDQMEFGFDDRQKVDKMFLY  446

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP FVWT 
Sbjct  447  RTLVGPRKDAPHFVWTF  463



>ref|XP_003548026.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Glycine max]
Length=573

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L+PT PD  TMQPL+EGFGAIVQSCK L+RLS+ 
Sbjct  377  CQQMTNAALITVAKNCPNFIRFRLCILDPTKPDPDTMQPLNEGFGAIVQSCKQLRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAEQLEMLS+AFAG+SDK MLYVLNGCKK+ KL IR SPFG++ALL 
Sbjct  437  GQLTDQVFLYIGMYAEQLEMLSVAFAGESDKAMLYVLNGCKKIHKLAIRGSPFGDSALLM  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETM+ LWM+S  VT+GACK LA+KMPRLNVEI NE+++ +   DDGQKVEKMYLY
Sbjct  497  DVGKYETMQFLWMTSCNVTVGACKALAEKMPRLNVEIFNENKKVDRDVDDGQKVEKMYLY  556

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAG RKDAP  VWTL
Sbjct  557  RTLAGRRKDAPELVWTL  573



>ref|XP_010660695.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Vitis vinifera]
Length=572

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI +AKNCPNF RFRLC L+ T  D VTMQPLDEGFGAIVQSCKGL+RLS+ 
Sbjct  376  CQQMTNAALITIAKNCPNFTRFRLCILDATKADPVTMQPLDEGFGAIVQSCKGLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRD PFGN ALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDCPFGNVALLT  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK+LA+KMPR+NVEIINE +Q E   DD QKV+KM+LY
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKVLAEKMPRINVEIINEYDQMEFGFDDRQKVDKMFLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP FVWTL
Sbjct  556  RTLVGPRKDAPHFVWTL  572



>ref|XP_006446967.1| hypothetical protein CICLE_v10014749mg [Citrus clementina]
 ref|XP_006468869.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Citrus sinensis]
 gb|ESR60207.1| hypothetical protein CICLE_v10014749mg [Citrus clementina]
Length=570

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKN  NF RFRLC L+   PD VTMQPLDEGFGAIVQSCK L+RLS+ 
Sbjct  374  CQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAIVQSCKRLRRLSLS  433

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  434  GLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLEIRDSPFGNTALLT  493

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG C+ LAKKMPRLNVEIINE +Q E S DD QKV KMYLY
Sbjct  494  DVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFSLDDRQKVGKMYLY  553

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP FVWTL
Sbjct  554  RTLVGPRKDAPDFVWTL  570



>gb|KDO47371.1| hypothetical protein CISIN_1g008325mg [Citrus sinensis]
Length=570

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKN  NF RFRLC L+   PD VTMQPLDEGFGAIVQSCK L+RLS+ 
Sbjct  374  CQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAIVQSCKRLRRLSLS  433

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  434  GLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLEIRDSPFGNTALLT  493

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG C+ LAKKMPRLNVEIINE +Q E S DD QKV KMYLY
Sbjct  494  DVGKYETMRSLWMSSCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFSLDDRQKVGKMYLY  553

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP FVWTL
Sbjct  554  RTLVGPRKDAPDFVWTL  570



>ref|NP_563915.1| auxin signaling F-box 3 protein [Arabidopsis thaliana]
 sp|Q9LPW7.1|AFB3_ARATH RecName: Full=Protein AUXIN SIGNALING F-BOX 3 [Arabidopsis thaliana]
 gb|AAF78487.1|AC012187_7 Strong similarity to transport inhibitor response 1 (TIR1) from 
Arabidopsis thaliana gb|AF005047 [Arabidopsis thaliana]
 gb|AAM20393.1| transport inhibitor response 1, putative [Arabidopsis thaliana]
 gb|AAN72129.1| transport inhibitor response 1, putative [Arabidopsis thaliana]
 dbj|BAE99304.1| putative transport inhibitor response 1 [Arabidopsis thaliana]
 gb|AEE28934.1| auxin signaling F-box 3 protein [Arabidopsis thaliana]
Length=577

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  438  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  498  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  557

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  558  YLYRTVVGTRKDAPPYVRIL  577



>ref|XP_008791063.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
Length=575

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 167/200 (84%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCP F RFRLC L+P  PD VT QPLDEGFGAIVQSCK L+RLS+ 
Sbjct  376  CHQMTNAALITVAKNCPQFTRFRLCILDPGKPDPVTNQPLDEGFGAIVQSCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAE+LEMLSIAFAG SDKGM+YVLNGCK L+KL IRDSPFG+AALL 
Sbjct  436  GHLTDQVFLYIGMYAERLEMLSIAFAGDSDKGMVYVLNGCKNLRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN---ESEQAETSHDDGQKVEKM  227
            D GKYETMRSLWMSS +VTLG CK LA KMPRLNVE+IN   ES++ E +  D  +VEKM
Sbjct  496  DVGKYETMRSLWMSSCDVTLGGCKTLAAKMPRLNVEVINEMDESDELEENPSDLHRVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+AGPR DAP FVWTL
Sbjct  556  YVYRTVAGPRNDAPDFVWTL  575



>gb|ADL70252.1| auxin signaling F-box 3, partial [Arabidopsis thaliana]
Length=269

 Score =   305 bits (780),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 162/190 (85%), Gaps = 3/190 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  80   CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVS  139

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  140  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  199

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  200  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKL  259

Query  226  YLYRTLAGPR  197
            YLYRT+ G R
Sbjct  260  YLYRTVVGTR  269



>ref|XP_002892715.1| auxin signaling F-box 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68974.1| auxin signaling F-box 3 [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 169/200 (85%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALIAVAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  438  GLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D G+YETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E     +   D+ +KV+K+
Sbjct  498  DVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNRMEQNEEDEREKVDKL  557

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  558  YLYRTMVGTRKDAPPYVRIL  577



>gb|ACL51018.1| transport inhibitor response protein [Citrus trifoliata]
Length=569

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKN  NF RFRLC L+   PD VTMQPLDEGFGAIVQSCK L+RLS+ 
Sbjct  373  CQQMTNAALITVAKNNSNFTRFRLCILDREKPDPVTMQPLDEGFGAIVQSCKHLRRLSLS  432

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRDSPFGN ALL 
Sbjct  433  GLLTDQVFLYIGMYAEQLEMLSIAFAGNSDKGMLYVLNGCKKLRKLEIRDSPFGNTALLT  492

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMS  EVTLG C+ LAKKMPRLNVEIINE +Q E S DD QKV KMYLY
Sbjct  493  DVGKYETMRSLWMSPCEVTLGGCQTLAKKMPRLNVEIINEDDQMEFSLDDRQKVGKMYLY  552

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL GPRKDAP FVWTL
Sbjct  553  RTLVGPRKDAPDFVWTL  569



>ref|XP_004304555.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Fragaria vesca subsp. 
vesca]
Length=572

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 170/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRL  L+P  PD VTMQPLDEGFGAIVQ+CK L+RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLALLDPMKPDPVTMQPLDEGFGAIVQACKKLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAEQLEMLSIAFAG SDKGMLYVLNGCKKL+KL IRDSPFG+ ALL 
Sbjct  436  GLLTDQVFLYIGMYAEQLEMLSIAFAGDSDKGMLYVLNGCKKLRKLEIRDSPFGDGALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLG CK LA  MP LNVEIINE+ Q E + +D QKVEKMY+Y
Sbjct  496  DVGKYETMRSLWMSSCEVTLGGCKTLAMNMPGLNVEIINENNQMEYADNDEQKVEKMYVY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAGPR+D P +VWTL
Sbjct  556  RTLAGPREDKPEYVWTL  572



>emb|CDY34211.1| BnaA02g28290D [Brassica napus]
Length=575

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIVQ+CK LKRLSV 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILEPHKPDHVTSQPLDEGFGAIVQACKNLKRLSVS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGM+A +LEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFG+AALLA
Sbjct  436  GLLTDQVFLYIGMFATELEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGDAALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK LA+K P LNVEIINE++     E  ++  QKV+K+
Sbjct  496  DVNKYETMRSLWMSSCEVTLGGCKRLARKAPWLNVEIINENDNNRMEENGYEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRVDAPPFVWIL  575



>ref|XP_009129474.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Brassica rapa]
Length=575

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 165/198 (83%), Gaps = 3/198 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIVQ+CK LKRLSV 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILEPHKPDHVTSQPLDEGFGAIVQACKNLKRLSVS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA +LEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFG+AALLA
Sbjct  436  GLLTDQVFLYIGMYATELEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGDAALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK LA+K P LNVEIINE++     E  ++  QKV+K+
Sbjct  496  DVNKYETMRSLWMSSCEVTLGGCKRLARKAPWLNVEIINENDNNRMEENGYEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVW  173
            YLYRT+ G R DAP FVW
Sbjct  556  YLYRTVVGTRVDAPPFVW  573



>ref|XP_002875343.1| auxin signaling F-box 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51602.1| auxin signaling F-box 2 [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 163/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS  
Sbjct  376  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSHS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+KM
Sbjct  496  DVSKYETMRSLWMSSCEVTLSGCKRLAQKAPWLNVEIINENDNNRMEENGHEGRQKVDKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRMDAPPFVWIL  575



>ref|XP_010476261.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3 [Camelina sativa]
Length=578

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  379  CKQMTNAALITVAKNCPNFIRFRLCILEPHKPDHITSQSLDEGFGAIVQACKGLRRLSVS  438

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLL DQVFLYIGMYAE+LEMLSIAFAG++DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  439  GLLNDQVFLYIGMYAEELEMLSIAFAGETDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  498

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK LA+  PRLNVEIINESE         D+  KV+K+
Sbjct  499  DVHKYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINESESNRMERNEEDERDKVDKL  558

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  559  YLYRTVVGTRKDAPPYVRIL  578



>emb|CDY28523.1| BnaC02g36370D [Brassica napus]
Length=575

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VA+NCPNFIRFRLC L P  PD VT QPLDEGFGAIVQ+CK LKRLSV 
Sbjct  376  CQQMTNAALITVARNCPNFIRFRLCILEPHKPDHVTSQPLDEGFGAIVQACKNLKRLSVS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGM+A QLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFG+AALLA
Sbjct  436  GRLTDQVFLYIGMFATQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGDAALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK LA+K P LNVEIINE++     E  ++  QKV+K+
Sbjct  496  DVNKYETMRSLWMSSCEVTLGGCKRLARKAPWLNVEIINENDNNRMEENGYEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRVDAPPFVWIL  575



>ref|XP_006306355.1| hypothetical protein CARUB_v10012250mg [Capsella rubella]
 gb|EOA39253.1| hypothetical protein CARUB_v10012250mg [Capsella rubella]
Length=577

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VA+NCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALITVARNCPNFIRFRLCILEPHKPDHITSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLL DQVFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  438  GLLNDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E         D+ +KV+K+
Sbjct  498  DVHKYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNRMERNEEDEREKVDKL  557

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  558  YLYRTVVGTRKDAPPYVRIL  577



>ref|XP_010554129.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Tarenaya hassleriana]
Length=587

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 166/202 (82%), Gaps = 5/202 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CKGL RLS+ 
Sbjct  386  CKQMTNAALKTVAKNCPNFIRFRLCILEPNKPDPVTSQPLDEGFGAIVKACKGLTRLSLS  445

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVF YIGMYAEQLEMLS+AFAG +DKGM+ VLNGCKKL+KL IRDSPFGN ALLA
Sbjct  446  GLLTDQVFHYIGMYAEQLEMLSVAFAGDTDKGMVSVLNGCKKLRKLEIRDSPFGNEALLA  505

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSH----DDG-QKVE  233
            D GKYETMRSLWMSS +VTLG CK LA K PRLNVEIINE+E     +    D+G Q VE
Sbjct  506  DVGKYETMRSLWMSSCQVTLGGCKRLANKAPRLNVEIINENENRVDPNGHEGDEGKQVVE  565

Query  232  KMYLYRTLAGPRKDAPGFVWTL  167
            KMYLYRT+ GPRKDAP +VW L
Sbjct  566  KMYLYRTVVGPRKDAPPYVWIL  587



>ref|XP_010494680.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Camelina sativa]
 ref|XP_010494688.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Camelina sativa]
 ref|XP_010494696.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Camelina sativa]
Length=578

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  379  CKQMTNAALITVAKNCPNFIRFRLCILEPHKPDHITSQSLDEGFGAIVQACKGLRRLSVS  438

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLL DQVFLYIGMYAE+LEMLSIAFAG++DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  439  GLLNDQVFLYIGMYAEELEMLSIAFAGETDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  498

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK LA+  PRLNVEIINE+E         D+  KV+K+
Sbjct  499  DVHKYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENESNRMERNEEDERDKVDKL  558

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  559  YLYRTVVGTRKDAPPYVRIL  578



>ref|XP_009386581.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009386582.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009386583.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N+AL  VAKNCP+F RFRLC L P  PD VT QPLDEGFGAIV+SCK L+RLSV 
Sbjct  376  CYQMTNSALTTVAKNCPHFTRFRLCILEPEKPDPVTNQPLDEGFGAIVRSCKNLRRLSVS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAE+LEMLSIAFAG SDKGM+YVLNGCK L+KL IRD PFG+AALL 
Sbjct  436  GLLTDQVFLYIGMYAERLEMLSIAFAGDSDKGMVYVLNGCKNLRKLEIRDCPFGDAALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE---QAETSHDDGQKVEKM  227
            D  KYETMRSLWMSS +VTLG CK LA KMPRLNVEIINE+    +++ +  D  KVEKM
Sbjct  496  DVAKYETMRSLWMSSCDVTLGGCKALAAKMPRLNVEIINENNGTCESKENLSDLHKVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y YRT+AGPR DAP FVWTL
Sbjct  556  YFYRTVAGPRNDAPDFVWTL  575



>gb|KHG11704.1| auxin signaling f-box 2 -like protein [Gossypium arboreum]
Length=579

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 165/202 (82%), Gaps = 5/202 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNC NFIRFRLC L+P   D VT QPLDEGFGAIV+S K LKRLS+ 
Sbjct  378  CHQMTNAALITVAKNCTNFIRFRLCILDPVKADPVTNQPLDEGFGAIVRSNKSLKRLSLS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA++LEMLSIAFAG S+KGMLYVLNGCKKL+KL IRD PFG+ ALL 
Sbjct  438  GLLTDQVFLYIGMYAKKLEMLSIAFAGDSNKGMLYVLNGCKKLRKLEIRDCPFGDVALLQ  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN-----ESEQAETSHDDGQKVE  233
            D GKYETMRSLWMSS EVTLGACK LAKKMP LNVEIIN     ESEQ E S DD   V+
Sbjct  498  DMGKYETMRSLWMSSCEVTLGACKTLAKKMPSLNVEIINESEKLESEQLELSFDDRLLVD  557

Query  232  KMYLYRTLAGPRKDAPGFVWTL  167
            KMYLYRTL G RKDAP +VW L
Sbjct  558  KMYLYRTLVGDRKDAPEYVWLL  579



>ref|XP_009110620.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3 [Brassica rapa]
Length=590

 Score =   307 bits (786),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  391  CKQMTNAALITVAKNCPNFIRFRLCILEPNKPDHITSQSLDEGFGAIVQACKGLRRLSVS  450

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  451  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  510

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA---ETSHDDGQKVEKM  227
            D GKYETMRSLWMSS EVTLG CK LA+  P LNVEIINE+E         D+ +KV+++
Sbjct  511  DVGKYETMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENGRMERNEEDEREKVDRL  570

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP  V  L
Sbjct  571  YLYRTVVGTRKDAPPCVTIL  590



>ref|XP_010458719.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Camelina sativa]
Length=578

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  379  CKQMTNAALITVAKNCPNFIRFRLCILEPHKPDHITSQSLDEGFGAIVQACKGLRRLSVS  438

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLL DQVFLYIGMYAE+LEMLSIAFAG++DKGMLYVLNGCKKL+KL IRDSPFGNAALL 
Sbjct  439  GLLNDQVFLYIGMYAEELEMLSIAFAGETDKGMLYVLNGCKKLRKLEIRDSPFGNAALLG  498

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE---TSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTLG CK +AK  PRLNVEIINE+E         D+  KV+K+
Sbjct  499  DVHKYETMRSLWMSSCEVTLGGCKRVAKNSPRLNVEIINENESNRMEGNEEDERDKVDKL  558

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP +V  L
Sbjct  559  YLYRTVVGTRKDAPPYVRIL  578



>gb|KJB11712.1| hypothetical protein B456_001G273700 [Gossypium raimondii]
Length=572

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNC NFIRFRLC L+P   D VT QPLDEGFGAIV+S K LKRLS+ 
Sbjct  376  CHQMTNAALITVAKNCTNFIRFRLCILDPVKADPVTNQPLDEGFGAIVRSNKSLKRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA++LEMLSIAFAG S+KGMLYVLNGCKKL+KL IRD PFG+ ALL 
Sbjct  436  GLLTDQVFLYIGMYAKKLEMLSIAFAGDSNKGMLYVLNGCKKLRKLEIRDCPFGDVALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            D GKYETMRSLWMSS EVTLGACK L+KKMP LNVEIINESEQ E S DD   V+KMYLY
Sbjct  496  DMGKYETMRSLWMSSCEVTLGACKTLSKKMPSLNVEIINESEQLEFSLDDRLLVDKMYLY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RTL G RKD P +V  L
Sbjct  556  RTLVGHRKDKPEYVLLL  572



>gb|ABQ50554.1| hypothetical protein [Brassica rapa]
 emb|CDY21068.1| BnaA08g24570D [Brassica napus]
Length=590

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P   D +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  391  CKQMTNAALITVAKNCPNFIRFRLCILEPNKSDHITSQSLDEGFGAIVQACKGLRRLSVS  450

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  451  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  510

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA---ETSHDDGQKVEKM  227
            D GKYETMRSLWMSS EVTLG CK LA+  P LNVEIINE+E         D+ +KV+++
Sbjct  511  DVGKYETMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENGRMERNEEDEREKVDRL  570

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP  V  L
Sbjct  571  YLYRTVVGTRKDAPPCVTIL  590



>ref|XP_006417190.1| hypothetical protein EUTSA_v10007195mg [Eutrema salsugineum]
 gb|ESQ35543.1| hypothetical protein EUTSA_v10007195mg [Eutrema salsugineum]
Length=577

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 165/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALITVAKNCPNFIRFRLCILEPNKPDHITSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +D+GMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  438  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDQGMLYVLNGCKKLRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS +VTLG CK LA+  P LNVEIINE+E     +   D+ +KV+++
Sbjct  498  DVEKYETMRSLWMSSCDVTLGGCKRLARDAPWLNVEIINENESNGMEQNEEDEREKVDRL  557

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G RKDAP  V  L
Sbjct  558  YLYRTVVGTRKDAPSCVTIL  577



>ref|XP_009118055.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Brassica rapa]
Length=578

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 163/201 (81%), Gaps = 4/201 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD  T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALITVAKNCPNFIRFRLCILEPNKPDHTTSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  438  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE----TSHDDGQKVEK  230
            D  KY TMRSLWMSS EVTLG CK LA+  P LNVEIINE+E  +       D+ +KV++
Sbjct  498  DVDKYRTMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENNDVMERNEEDEREKVDR  557

Query  229  MYLYRTLAGPRKDAPGFVWTL  167
            +YLYRT+ G RKDAP  V  L
Sbjct  558  LYLYRTVVGARKDAPPCVTIL  578



>emb|CDX71968.1| BnaC08g29060D [Brassica napus]
Length=578

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 163/201 (81%), Gaps = 4/201 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD  T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALITVAKNCPNFIRFRLCILEPNKPDHTTSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  438  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE----TSHDDGQKVEK  230
            D  KY TMRSLWMSS EVTLG CK LA+  P LNVEIINE+E  +       D+ +KV++
Sbjct  498  DVDKYRTMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENNDLMERNEEDEREKVDR  557

Query  229  MYLYRTLAGPRKDAPGFVWTL  167
            +YLYRT+ G RKDAP  V  L
Sbjct  558  LYLYRTVVGARKDAPPCVTIL  578



>ref|XP_008805287.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
 ref|XP_008805288.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
 ref|XP_008805289.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Phoenix dactylifera]
Length=575

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI +AKNCP+F RFRLC L+P  PD VT QPLDEGFGAIVQSCK L+RLS+ 
Sbjct  376  CHQMTNAALITIAKNCPHFTRFRLCILDPGKPDPVTNQPLDEGFGAIVQSCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAE+LEMLSIAFAG SDKGM+YVLNGCK ++KL IRDSPFG+AALL 
Sbjct  436  GLLTDQVFLYIGMYAERLEMLSIAFAGDSDKGMMYVLNGCKNMRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN---ESEQAETSHDDGQKVEKM  227
            D GKYETMRSLWMSS ++TL  CK LA KMPRLNVE+IN   ES++ E +  D  +VEKM
Sbjct  496  DVGKYETMRSLWMSSCDITLRGCKTLAAKMPRLNVEVINERDESDEMEENPSDLHRVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+AGPR DAP FVWTL
Sbjct  556  YVYRTVAGPRNDAPDFVWTL  575



>ref|XP_010929637.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
Length=575

 Score =   296 bits (758),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 168/200 (84%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCP+F RFRLC L+P  PD VT QPLDEGFGAIVQSCK L+RLS+ 
Sbjct  376  CNQMTNAALITVAKNCPHFTRFRLCILDPKKPDPVTNQPLDEGFGAIVQSCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAE+LEMLSIAFAG SDKGM+YVLNGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDRVFLYIGMYAERLEMLSIAFAGDSDKGMVYVLNGCKNLRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN---ESEQAETSHDDGQKVEKM  227
            D GKYETMRSLWMSS +VTLG CK LA KMP LNVE+IN   ES++ E S  D  +VEKM
Sbjct  496  DVGKYETMRSLWMSSCDVTLGGCKTLAAKMPGLNVEVINERDESDEMEESPSDLGRVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+AGPR DAP FVWTL
Sbjct  556  YVYRTVAGPRNDAPDFVWTL  575



>emb|CDY26594.1| BnaA09g46830D [Brassica napus]
Length=578

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 161/201 (80%), Gaps = 4/201 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD  T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALITVAKNCPNFIRFRLCILEPNKPDHTTSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  438  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE----TSHDDGQKVEK  230
            D  KY TMRSLWM S  +TLG CK LA+  P LNVEIINE+E  +       D+ +KV++
Sbjct  498  DVDKYRTMRSLWMCSRGLTLGGCKRLARNAPWLNVEIINENENNDLMERNEEDEREKVDR  557

Query  229  MYLYRTLAGPRKDAPGFVWTL  167
            +YLYRT+ G RKDAP  V  L
Sbjct  558  LYLYRTVVGARKDAPPCVTIL  578



>ref|XP_010528142.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Tarenaya hassleriana]
Length=577

 Score =   293 bits (751),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 171/202 (85%), Gaps = 5/202 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N+ALI VAKNCPNFIRFRLC L+PT PD VT QPLD+GFGAIV++CKGL+RLS+ 
Sbjct  376  CKQMTNSALITVAKNCPNFIRFRLCILDPTKPDPVTSQPLDKGFGAIVKACKGLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVF YIGMYAE+LEMLSIAFAG +DKGMLYVLNGCK+L+KL IRDSPFGNAALLA
Sbjct  436  GLLTDQVFFYIGMYAERLEMLSIAFAGDTDKGMLYVLNGCKRLRKLEIRDSPFGNAALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE-----QAETSHDDGQKVE  233
            D GKYETMRSLWMS+ +VTLG CK +A+K  RLNVEIINE+      + +    +GQKVE
Sbjct  496  DVGKYETMRSLWMSACKVTLGGCKRVARKASRLNVEIINENGGNQMMEEQNGRGEGQKVE  555

Query  232  KMYLYRTLAGPRKDAPGFVWTL  167
            KMYLYRT+ G RKDAP FVW L
Sbjct  556  KMYLYRTVVGARKDAPPFVWIL  577



>gb|ADB92054.2| auxin signaling F-box 2 [Arabidopsis thaliana]
Length=324

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  129  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  188

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  189  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  248

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  249  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  308

Query  226  YLYRTLAGPRKDAPGF  179
            YLYRT+ G R DAP F
Sbjct  309  YLYRTVVGTRMDAPPF  324



>gb|ADB92052.2| auxin signaling F-box 2 [Arabidopsis thaliana]
 gb|ADL70230.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
 gb|ADL70232.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
 gb|ADL70234.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
 gb|ADL70237.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
 gb|ADL70238.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
 gb|ADL70240.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
 gb|ADL70242.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=324

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  129  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  188

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  189  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  248

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  249  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  308

Query  226  YLYRTLAGPRKDAPGF  179
            YLYRT+ G R DAP F
Sbjct  309  YLYRTVVGTRMDAPPF  324



>ref|XP_010909072.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
 ref|XP_010909073.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
 ref|XP_010909074.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
 ref|XP_010909075.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Elaeis guineensis]
Length=575

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ VAKNCP+F RFRLC L+P  PD VT QPLDEGFGAIVQSCK L+RLS+ 
Sbjct  376  CHQMTNAALVTVAKNCPHFTRFRLCILDPGKPDPVTNQPLDEGFGAIVQSCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYAE LEMLSIAFAG SDKGM+YVLNGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDQVFLYIGMYAECLEMLSIAFAGDSDKGMVYVLNGCKNLRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN---ESEQAETSHDDGQKVEKM  227
            D GKYETMRSLWMSS  VTL  CK LA KMPRLNVE+IN   ES++ E +  D ++VEKM
Sbjct  496  DVGKYETMRSLWMSSCYVTLKGCKTLAAKMPRLNVEVINERDESDEMEENPSDLRRVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+AGPR DAP FVW L
Sbjct  556  YVYRTVAGPRNDAPDFVWML  575



>ref|XP_010514346.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Camelina sativa]
Length=575

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  376  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKNLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  496  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINETDNNRMEENGHEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRMDAPPFVWIL  575



>ref|XP_009404746.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 163/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCP+F RFRLC L+P  PD VT QPLDEGFGAIV+SCK ++RLS+ 
Sbjct  376  CYQMTNAALITVAKNCPHFTRFRLCILDPGKPDPVTNQPLDEGFGAIVRSCKNIRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTDQVFLYIGMYAE+LEMLSIAFAG SDKGM+YVLNGCK L+KL IRD PFG+ ALL 
Sbjct  436  GRLTDQVFLYIGMYAERLEMLSIAFAGDSDKGMIYVLNGCKNLRKLEIRDCPFGDIALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSH---DDGQKVEKM  227
            +  KYETMRSLWMSS +VTLG CK LA KMPRLNVEIINE+E+         D  K+EK+
Sbjct  496  NVAKYETMRSLWMSSCDVTLGGCKALAAKMPRLNVEIINENEETYEFEENLSDRHKLEKI  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+AGPR DAP FVWTL
Sbjct  556  YVYRTVAGPRNDAPDFVWTL  575



>ref|XP_010502624.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Camelina sativa]
Length=575

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  376  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  496  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINETDNNRMEENGHEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRMDAPPFVWIL  575



>ref|XP_006395519.1| hypothetical protein EUTSA_v10003903mg [Eutrema salsugineum]
 gb|ESQ32805.1| hypothetical protein EUTSA_v10003903mg [Eutrema salsugineum]
Length=575

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAALI VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIVQ+CK L+RLS+ 
Sbjct  376  CQQMTNAALITVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVQACKNLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVF YIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFQYIGMYATQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KY+TMRSLWMSS EVTLG CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  496  DVNKYQTMRSLWMSSCEVTLGGCKRLAQKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRTDAPPFVWIL  575



>ref|XP_006290819.1| hypothetical protein CARUB_v10016928mg [Capsella rubella]
 gb|EOA23717.1| hypothetical protein CARUB_v10016928mg [Capsella rubella]
Length=575

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  376  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINES+     +  H+  QKV+K+
Sbjct  496  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINESDNNRMEQNGHEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRMDAPPFVWIL  575



>ref|NP_566800.1| auxin signaling F-box 2 [Arabidopsis thaliana]
 sp|Q9LW29.1|AFB2_ARATH RecName: Full=Protein AUXIN SIGNALING F-BOX 2 [Arabidopsis thaliana]
 dbj|BAB01228.1| transport inhibitor response-like protein [Arabidopsis thaliana]
 gb|AAL32646.1| transport inhibitor response-like protein [Arabidopsis thaliana]
 gb|AAQ56839.1| At3g26830 [Arabidopsis thaliana]
 gb|AEE77218.1| auxin signaling F-box 2 [Arabidopsis thaliana]
Length=575

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  376  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  496  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRMDAPPFVWIL  575



>gb|ADB92055.2| auxin signaling F-box 2 [Arabidopsis thaliana]
 gb|ADB92056.2| auxin signaling F-box 2 [Arabidopsis thaliana]
 gb|ADL70233.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=323

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 160/194 (82%), Gaps = 3/194 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  129  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  188

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  189  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  248

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  249  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  308

Query  226  YLYRTLAGPRKDAP  185
            YLYRT+ G R DAP
Sbjct  309  YLYRTVVGTRMDAP  322



>ref|XP_010425404.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Camelina sativa]
Length=575

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 164/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  376  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  436  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  496  DVSKYETMRSLWMSSCEVTLSGCKGLAEKAPWLNVEIINETDNNRMEENGHEGRQKVDKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYRT+ G R DAP FVW L
Sbjct  556  YLYRTVVGTRMDAPPFVWIL  575



>gb|EAY93933.1| hypothetical protein OsI_15707 [Oryza sativa Indica Group]
Length=575

 Score =   291 bits (744),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ VAKNCPNF RFRLC L P  PD VT QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  376  CHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTSQPLDEGFGAIVRECKGLQRLSIS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG YA+QLEMLSIAFAG SDKGM++V+NGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDKVFMYIGKYAKQLEMLSIAFAGDSDKGMMHVMNGCKNLRKLEIRDSPFGDAALLG  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINE---SEQAETSHDDGQKVEKM  227
            +  +YETMRSLWMSS  VTL  C++LA KMP LNVE+INE   S + E +H D  KVEK+
Sbjct  496  NFARYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEVINERDGSNEMEENHGDLPKVEKL  555

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT AG R DAP FV
Sbjct  556  YVYRTTAGARDDAPNFV  572



>ref|NP_001052659.1| Os04g0395600 [Oryza sativa Japonica Group]
 sp|Q7XVM8.1|TIR1B_ORYSJ RecName: Full=Transport inhibitor response 1-like protein Os04g0395600; 
Short=TIR1-like protein [Oryza sativa Japonica Group]
 emb|CAD40545.1| OSJNBa0072K14.18 [Oryza sativa Japonica Group]
 dbj|BAF14573.1| Os04g0395600 [Oryza sativa Japonica Group]
 gb|EAZ30576.1| hypothetical protein OsJ_14626 [Oryza sativa Japonica Group]
 dbj|BAG94804.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ VAKNCPNF RFRLC L P  PD VT QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  376  CHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTSQPLDEGFGAIVRECKGLQRLSIS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG YA+QLEMLSIAFAG SDKGM++V+NGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDKVFMYIGKYAKQLEMLSIAFAGDSDKGMMHVMNGCKNLRKLEIRDSPFGDAALLG  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINE---SEQAETSHDDGQKVEKM  227
            +  +YETMRSLWMSS  VTL  C++LA KMP LNVE+INE   S + E +H D  KVEK+
Sbjct  496  NFARYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEVINERDGSNEMEENHGDLPKVEKL  555

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT AG R DAP FV
Sbjct  556  YVYRTTAGARDDAPNFV  572



>gb|ADL70241.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=323

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 160/194 (82%), Gaps = 3/194 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  129  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  188

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  189  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDRALLA  248

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  249  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  308

Query  226  YLYRTLAGPRKDAP  185
            YLYRT+ G R DAP
Sbjct  309  YLYRTVVGTRMDAP  322



>emb|CDY31282.1| BnaC08g15770D [Brassica napus]
Length=587

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 157/202 (78%), Gaps = 5/202 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI VAKNCPNFIRFRLC L P  PD +T Q LDEGFGAIVQSCKGL+RLSV 
Sbjct  386  CKQMTNEALITVAKNCPNFIRFRLCILEPNKPDHITSQSLDEGFGAIVQSCKGLRRLSVS  445

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  446  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  505

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNV-----EIINESEQAETSHDDGQKVE  233
            D GKYETMRSLWMSS EVTLG CK LA+  P LNV                  D+ +KV+
Sbjct  506  DVGKYETMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENENGRMERNEEDEREKVD  565

Query  232  KMYLYRTLAGPRKDAPGFVWTL  167
            ++YLYRT+ G RKDAP  V  L
Sbjct  566  RLYLYRTVVGTRKDAPPCVTIL  587



>ref|XP_009415862.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415863.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415864.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCP FIRFRLC L+P  PD +T QPLDEGFGAIVQSCK L+RLS+ 
Sbjct  376  CCQMTNAALITVAKNCPRFIRFRLCILDPGKPDPITNQPLDEGFGAIVQSCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIG YA +LEMLSIAFAG SDKGM+YVLNGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDKVFLYIGEYAARLEMLSIAFAGDSDKGMIYVLNGCKNLRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA---ETSHDDGQKVEKM  227
            + GKYETMRSLWMSS +VTLG CK LA KMPRLNVE+INE +++   E +  D  KVEKM
Sbjct  496  NVGKYETMRSLWMSSCDVTLGGCKALAAKMPRLNVEVINEWDESVEMEENPSDTHKVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRTL GPR +AP FVWTL
Sbjct  556  YVYRTLTGPRNEAPDFVWTL  575



>ref|XP_008450007.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cucumis melo]
Length=587

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 168/212 (79%), Gaps = 15/212 (7%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ VAKN PNFIRFRLC L+PT PD VT  PLDEGFGAIVQ+CKGL+RLS+ 
Sbjct  376  CHQMTNAALVTVAKNNPNFIRFRLCILDPTKPDPVTGYPLDEGFGAIVQACKGLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVF YIG YA+ LEMLS+AFAG SDKGM++VL+GCKKL+KL I DSPFG+ ALL 
Sbjct  436  GLLTDQVFYYIGEYAKHLEMLSLAFAGNSDKGMIHVLSGCKKLRKLEIMDSPFGDMALLQ  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE---------------QAE  263
            D GKYETMRSLWMSS E+TLG CK LAKKMPRLNVEIINE++               Q+E
Sbjct  496  DVGKYETMRSLWMSSCEITLGGCKTLAKKMPRLNVEIINENDQLGFCRNVDMINENGQSE  555

Query  262  TSHDDGQKVEKMYLYRTLAGPRKDAPGFVWTL  167
               DD QKV KMYLYRTL GPRKDAP FVWTL
Sbjct  556  VCRDDEQKVGKMYLYRTLVGPRKDAPKFVWTL  587



>ref|XP_006652225.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600-like 
[Oryza brachyantha]
Length=575

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ VAKNCPNF RFRLC L P  PD VT QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  376  CHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTNQPLDEGFGAIVRECKGLQRLSIS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG YA+QLEMLSIAFAG SDKGM++V+NGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDKVFMYIGKYAKQLEMLSIAFAGDSDKGMMHVMNGCKNLRKLEIRDSPFGDAALLG  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINE---SEQAETSHDDGQKVEKM  227
            +  +YETMRSLWMSS  VTL  C++LA KMP LNVE+INE   S + E +H +  KVEK+
Sbjct  496  NFARYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEVINERDGSNEMEENHGELPKVEKL  555

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT AG R DAP FV
Sbjct  556  YVYRTTAGARDDAPNFV  572



>ref|XP_004975445.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600-like 
[Setaria italica]
Length=573

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N AL+ VAKNCPNFIRFRLC L P  PDA+T QPLDEGFGAIV+ C+GL+RLS+ 
Sbjct  374  CHQMTNDALMTVAKNCPNFIRFRLCILEPKKPDAITNQPLDEGFGAIVRECRGLRRLSIS  433

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG YA+QLEMLSIAFAG SDKGM++V+NGCK L+KL IRDSPFG+ ALL 
Sbjct  434  GLLTDKVFMYIGKYAKQLEMLSIAFAGDSDKGMMHVMNGCKNLRKLEIRDSPFGDVALLG  493

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINE---SEQAETSHDDGQKVEKM  227
            +  KYETMRSLWMSS  VTL  C++LA KMP LNVEI+NE   S + E +H D  +V+K+
Sbjct  494  NVAKYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEIMNELDGSSEMEENHGDPSRVDKL  553

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT AG R DAP FV
Sbjct  554  YVYRTTAGARDDAPNFV  570



>ref|XP_003577541.1| PREDICTED: transport inhibitor response 1-like protein Os11g0515500 
[Brachypodium distachyon]
Length=576

 Score =   286 bits (731),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 160/200 (80%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N+ALI +AKNCP F+ FRLC L P   DA+T QPLDEGFGAIV+SCKGL+RLSV 
Sbjct  377  CRQMTNSALITIAKNCPRFMSFRLCVLQPRSADAMTGQPLDEGFGAIVRSCKGLRRLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLSIAFAG +D GM+YVLNGCK LKKL IR  PFG+ ALLA
Sbjct  437  GLLTDSVFLYIGMYAERLEMLSIAFAGDTDNGMIYVLNGCKNLKKLEIRSCPFGDTALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINES---EQAETSHDDGQKVEKM  227
               +YE +RSLWMSS  +TLG C+ LA  MP +NVE+INE+   E+A+    D +KVEK+
Sbjct  497  GMHRYEALRSLWMSSCNITLGGCRSLAAHMPSINVEVINEAGTIEEADGDASDAKKVEKL  556

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            YLYR+++GPR DAPGFV TL
Sbjct  557  YLYRSVSGPRGDAPGFVKTL  576



>gb|ADL70236.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=317

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 156/188 (83%), Gaps = 3/188 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  129  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  188

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  189  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  248

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  249  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  308

Query  226  YLYRTLAG  203
            YLYRT+ G
Sbjct  309  YLYRTVVG  316



>gb|ADL70235.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=311

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 156/188 (83%), Gaps = 3/188 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  123  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  182

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  183  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  242

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  243  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  302

Query  226  YLYRTLAG  203
            YLYRT+ G
Sbjct  303  YLYRTVVG  310



>gb|ADL70239.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=310

 Score =   275 bits (703),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 156/188 (83%), Gaps = 3/188 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  122  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  181

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  182  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  241

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  242  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  301

Query  226  YLYRTLAG  203
            YLYRT+ G
Sbjct  302  YLYRTVVG  309



>ref|XP_009421041.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 163/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCP+F RFRLC L+P  PD VT QPLDEGFGAIV+SCK L+RLS+ 
Sbjct  376  CYQMTNAALITVAKNCPHFTRFRLCILDPWKPDPVTNQPLDEGFGAIVRSCKNLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIG+YA+ LEMLSIAFAG SDKGM+ +L GCK L+KL IRD PFG+ ALL 
Sbjct  436  GLLTDQVFLYIGLYAKCLEMLSIAFAGDSDKGMVCILKGCKNLRKLEIRDCPFGDIALLN  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE---QAETSHDDGQKVEKM  227
            D  KYETMRSLWMSS +VTLG CK LA KMPRLNVEIINESE   + E +  D  KVEKM
Sbjct  496  DVAKYETMRSLWMSSCDVTLGGCKALAAKMPRLNVEIINESEGTDKLEENISDLHKVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+AGPR DAP FVWTL
Sbjct  556  YVYRTVAGPRNDAPDFVWTL  575



>ref|NP_001267557.1| protein AUXIN SIGNALING F-BOX 2-like [Cucumis sativus]
 gb|AGA63734.1| transport inhibitor response 1 [Cucumis sativus]
 gb|AGI15226.1| auxin siganling F box protein [Cucumis sativus]
 gb|KGN58236.1| hypothetical protein Csa_3G597350 [Cucumis sativus]
Length=587

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 166/212 (78%), Gaps = 15/212 (7%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ VAKN PNFIRFRLC L+PT PD V    LDEGFGAIV++CKGL+RLS+ 
Sbjct  376  CHQMTNAALVTVAKNNPNFIRFRLCILDPTKPDPVMGNALDEGFGAIVKACKGLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLL+DQVF YIG YA+ LEMLS+AFAG SDKGM++VLNGCKKL+KL I DSPFG+ ALL 
Sbjct  436  GLLSDQVFYYIGEYAKHLEMLSLAFAGISDKGMIHVLNGCKKLRKLEIMDSPFGDMALLQ  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE---------------QAE  263
            D GKYETMRSLWMSS E+TLG CK LAKKMPRLNVEIINE++               Q+E
Sbjct  496  DVGKYETMRSLWMSSCEITLGGCKTLAKKMPRLNVEIINENDQLGFCRNVEMINENGQSE  555

Query  262  TSHDDGQKVEKMYLYRTLAGPRKDAPGFVWTL  167
               DD QKV KMYLYRTL GPRKDAP FVWTL
Sbjct  556  VCRDDKQKVGKMYLYRTLVGPRKDAPKFVWTL  587



>gb|ADB92053.1| auxin signaling F-box 2 [Arabidopsis thaliana]
Length=307

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 155/186 (83%), Gaps = 3/186 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFIRFRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  122  CQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  181

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  182  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  241

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  242  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  301

Query  226  YLYRTL  209
            YLYRT+
Sbjct  302  YLYRTV  307



>ref|XP_002447719.1| hypothetical protein SORBIDRAFT_06g014420 [Sorghum bicolor]
 gb|EES12047.1| hypothetical protein SORBIDRAFT_06g014420 [Sorghum bicolor]
Length=574

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 157/196 (80%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI VAKNCPNFIRFRLC L P  PDA+T QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  376  CHQMTNEALITVAKNCPNFIRFRLCILEPKKPDAMTGQPLDEGFGAIVRECKGLRRLSMS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG YA+ LEMLSIAFAG SDKGM+ V+NGCK L+KL IRDSPFG+ ALL 
Sbjct  436  GLLTDRVFMYIGKYAKYLEMLSIAFAGDSDKGMMDVMNGCKNLRKLEIRDSPFGDVALLG  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE--TSHDDGQKVEKMY  224
            +  KYETMRSLWMSS +VTL  C++LA KMP LNVEI+NE + +    +H D  KV+K+Y
Sbjct  496  NVAKYETMRSLWMSSCDVTLKGCQVLASKMPMLNVEIMNELDGSSEMENHTDLSKVDKLY  555

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT AG R DAP FV
Sbjct  556  VYRTTAGARDDAPNFV  571



>ref|XP_002450803.1| hypothetical protein SORBIDRAFT_05g018860 [Sorghum bicolor]
 gb|EES09791.1| hypothetical protein SORBIDRAFT_05g018860 [Sorghum bicolor]
Length=578

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 157/198 (79%), Gaps = 4/198 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C +M N ALI +AK CP    FRLC L P   DAVT QPLDEGFGAIVQSCKGL+R ++ 
Sbjct  378  CDRMTNTALITIAKYCPLLTSFRLCILEPRSADAVTGQPLDEGFGAIVQSCKGLRRFAMS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLS+AFAG +D GM+YVLNGCK LKKL IRDSPFG+AALLA
Sbjct  438  GLLTDSVFLYIGMYAEKLEMLSVAFAGDTDDGMVYVLNGCKNLKKLEIRDSPFGDAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDG----QKVEK  230
               +YE+MRSLWMSS E+TLGACK LA  MP +NVE+I+E+  +  + DDG    +KV+K
Sbjct  498  GAHRYESMRSLWMSSCEITLGACKTLAAAMPNINVEVISEAGASVGATDDGISNARKVDK  557

Query  229  MYLYRTLAGPRKDAPGFV  176
            +YLYRT+AGPR D PGFV
Sbjct  558  LYLYRTIAGPRSDTPGFV  575



>ref|XP_009405455.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 163/200 (82%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VAKNCP+F RFRLC L+P  PD  T QPLDEGFGAIV+SCK L+RLS+ 
Sbjct  376  CHQMTNAALITVAKNCPHFTRFRLCILDPGKPDPDTNQPLDEGFGAIVRSCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIG YA +LEMLSIAFAG SDKGM+YVLNGCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDKVFLYIGEYAARLEMLSIAFAGDSDKGMVYVLNGCKNLRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN---ESEQAETSHDDGQKVEKM  227
            + GKYETMRSLWMSS +VTLG CK LA KMPRLNVE+IN   ES++ E +  D  KVEKM
Sbjct  496  NVGKYETMRSLWMSSCDVTLGGCKALAAKMPRLNVEVINDRDESDEMEENPSDMHKVEKM  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRTLAG R DAP FV  L
Sbjct  556  YVYRTLAGARNDAPEFVEIL  575



>emb|CDY16034.1| BnaC08g40890D [Brassica napus]
Length=579

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 163/202 (81%), Gaps = 5/202 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P  PD  T Q LDEGFGAIVQ+CKGL+RLS+ 
Sbjct  378  CKQMTNAALITVAKNCPNFIRFRLCILEPNKPDHTTSQSLDEGFGAIVQACKGLRRLSLS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKK++KL IRDSPFGNAALLA
Sbjct  438  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE-----TSHDDGQKVE  233
            D  KY TMRSLWMSS EVTLG CK LA+  P LNVEIINE+E  +        D+ +KV+
Sbjct  498  DVDKYRTMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENNDLMMERNEEDEREKVD  557

Query  232  KMYLYRTLAGPRKDAPGFVWTL  167
            ++YLYRT+ G RKDAP  V  L
Sbjct  558  RLYLYRTVVGARKDAPPCVTIL  579



>gb|ADL70231.1| auxin signaling F-box 2, partial [Arabidopsis thaliana]
Length=310

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 155/188 (82%), Gaps = 3/188 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAAL+ VAKNCPNFI FRLC L P  PD VT QPLDEGFGAIV++CK L+RLS+ 
Sbjct  122  CQQMTNAALVTVAKNCPNFICFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLS  181

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMYA QLEMLSIAFAG +DKGMLYVLNGCKK+KKL IRDSPFG+ ALLA
Sbjct  182  GLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLA  241

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            D  KYETMRSLWMSS EVTL  CK LA+K P LNVEIINE++     E  H+  QKV+K+
Sbjct  242  DVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKL  301

Query  226  YLYRTLAG  203
            YLYRT+ G
Sbjct  302  YLYRTVVG  309



>gb|ABQ50561.1| hypothetical protein [Brassica rapa]
Length=715

 Score =   281 bits (719),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI VAKNCPNFIRFRLC L P   D +T Q LDEGFGAIVQ+CKGL+RLSV 
Sbjct  378  CKQMTNAALITVAKNCPNFIRFRLCILEPNKSDHITSQSLDEGFGAIVQACKGLRRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAEQLEMLSIAFAG +DKGMLYVLNGCKKL+KL IRDSPFGNAALLA
Sbjct  438  GLLTDKVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKLRKLEIRDSPFGNAALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKM  227
            D GKYETMRSLWMSS EVTLG CK LA+  P LNVEIINE+E      ++  + EK+
Sbjct  498  DVGKYETMRSLWMSSCEVTLGGCKRLARNAPWLNVEIINENENGRMERNEEDEREKL  554



>gb|EAY81084.1| hypothetical protein OsI_36265 [Oryza sativa Indica Group]
Length=459

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQ+M N+ALI VAKNCP F  FRLC L+P   DAVT QPLDEGFGAIVQSCKGL+RL + 
Sbjct  261  CQRMTNSALITVAKNCPRFTSFRLCVLDPGSADAVTGQPLDEGFGAIVQSCKGLRRLCLS  320

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLS+AFAG +D GM YVLNGCK LKKL IRDSPFG++ALLA
Sbjct  321  GLLTDTVFLYIGMYAERLEMLSVAFAGDTDDGMTYVLNGCKNLKKLEIRDSPFGDSALLA  380

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSH--DDGQKVEKMY  224
               +YE MRSLW+SS  VTLG CK LA  M  LN+E++N +     +   +D +KV+K+Y
Sbjct  381  GMHQYEAMRSLWLSSCNVTLGGCKSLAASMANLNIEVMNRAASINEADNANDAKKVKKLY  440

Query  223  LYRTLAGPRKDAPGFVWTL  167
            +YRT+AGPR DAP F+ T 
Sbjct  441  IYRTVAGPRGDAPEFISTF  459



>ref|XP_004979343.1| PREDICTED: transport inhibitor response 1-like protein Os11g0515500-like 
isoform X1 [Setaria italica]
 ref|XP_004979344.1| PREDICTED: transport inhibitor response 1-like protein Os11g0515500-like 
isoform X2 [Setaria italica]
Length=573

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 154/198 (78%), Gaps = 4/198 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C +M NAALI +AKNCP    FRLC L  +  DAVT  PLDEGFGAIVQSCKGL+RLS+ 
Sbjct  373  CNRMTNAALITIAKNCPQLTSFRLCILELSSADAVTGLPLDEGFGAIVQSCKGLRRLSMS  432

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLS+AFAG +D GM+YVLNGCK LKKL IRDSPFG+ ALLA
Sbjct  433  GLLTDCVFLYIGMYAEKLEMLSVAFAGGTDDGMVYVLNGCKNLKKLEIRDSPFGDTALLA  492

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINES----EQAETSHDDGQKVEK  230
               +YE MRSLWMSS  +TLGACK LA  MP +NVE+INE+     + +    + +KVEK
Sbjct  493  GVDRYEAMRSLWMSSCNITLGACKTLAASMPSVNVEVINEAGASINEVDEDASNAKKVEK  552

Query  229  MYLYRTLAGPRKDAPGFV  176
            +YLYRT+AGPR D PGFV
Sbjct  553  LYLYRTIAGPRGDTPGFV  570



>ref|XP_008669494.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Zea mays]
Length=575

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 155/196 (79%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI VA NCPNFIRFRLC L P  PDA+T QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  375  CHQMTNEALITVANNCPNFIRFRLCILEPKKPDAMTGQPLDEGFGAIVRECKGLRRLSIS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG +A+ LEMLSIAFAG SDKGM+ V+NGCK L+KL IRDSPFG+ ALL 
Sbjct  435  GLLTDKVFMYIGKHAKYLEMLSIAFAGDSDKGMMDVMNGCKNLRKLEIRDSPFGDVALLG  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE--TSHDDGQKVEKMY  224
            +  KYETMRSLWMSS  VTL  C++LA KMP LNVEI+NE + +    +H D  KV+K+Y
Sbjct  495  NVAKYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEIMNELDGSSEMENHGDLSKVDKLY  554

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT AG R DAP FV
Sbjct  555  VYRTTAGARDDAPNFV  570



>gb|EAZ18511.1| hypothetical protein OsJ_34040 [Oryza sativa Japonica Group]
Length=459

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQ+M N+ALI VAKNCP F  FRLC L+P   DAVT QPLDEG+GAIVQSCKGL+RL + 
Sbjct  261  CQRMTNSALITVAKNCPRFTSFRLCVLDPGSADAVTGQPLDEGYGAIVQSCKGLRRLCLS  320

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLS+AFAG +D GM YVLNGCK LKKL IRDSPFG++ALLA
Sbjct  321  GLLTDTVFLYIGMYAERLEMLSVAFAGDTDDGMTYVLNGCKNLKKLEIRDSPFGDSALLA  380

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSH--DDGQKVEKMY  224
               +YE MRSLW+SS  VTLG CK LA  M  LN+E++N +     +   +D +KV+K+Y
Sbjct  381  GMHQYEAMRSLWLSSCNVTLGGCKSLAASMANLNIEVMNRAASINEADNANDAKKVKKLY  440

Query  223  LYRTLAGPRKDAPGFVWTL  167
            +YRT+AGPR DAP F+ T 
Sbjct  441  IYRTVAGPRGDAPEFISTF  459



>ref|XP_003579653.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Brachypodium distachyon]
Length=575

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 156/197 (79%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI +AKNCPNF RFRLC L P  PDA+T QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  376  CHQMTNAALITIAKNCPNFTRFRLCILEPGKPDAMTNQPLDEGFGAIVRECKGLRRLSIS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG YA++LEMLSIAFAG SD GM++V+ GCK L+KL IRDSPFG+AALL 
Sbjct  436  GLLTDKVFMYIGTYAKELEMLSIAFAGDSDAGMMHVMKGCKNLRKLEIRDSPFGDAALLE  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIIN---ESEQAETSHDDGQKVEKM  227
            +  KYETMRSLWMSS  VT   C++LA KMP LNVE+IN   E+ + + +H    KV+K+
Sbjct  496  NVAKYETMRSLWMSSCNVTEKGCQVLASKMPMLNVEVINELDENNEMDENHGGLPKVDKL  555

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT AG R DAP FV
Sbjct  556  YVYRTTAGGRDDAPNFV  572



>ref|XP_009403780.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403781.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403782.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403783.1| PREDICTED: transport inhibitor response 1-like protein Os04g0395600 
[Musa acuminata subsp. malaccensis]
Length=575

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 161/200 (81%), Gaps = 3/200 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N AL+ VAKNCP+F RFRLC L+P  PD VT QPLDEGFGAIV+SCK L+RLS+ 
Sbjct  376  CYQMTNTALVTVAKNCPHFTRFRLCILDPGKPDPVTDQPLDEGFGAIVRSCKNLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGM+AE LEMLSIAFAG SDKGM+YVLNGCK L+KL IRD PFG+ ALL 
Sbjct  436  GLLTDKVFLYIGMHAEHLEMLSIAFAGDSDKGMVYVLNGCKNLRKLEIRDCPFGDDALLK  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHD---DGQKVEKM  227
            D  KYETMRSLWMSS +VTLG C+ LA KMP LNVEIINES++A+   +   D  KVEK+
Sbjct  496  DVTKYETMRSLWMSSCDVTLGGCRALAAKMPSLNVEIINESDEADEFQENLSDLHKVEKL  555

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YRT+A  R DAP FVW L
Sbjct  556  YVYRTVARGRTDAPDFVWIL  575



>gb|EMT24313.1| hypothetical protein F775_12364 [Aegilops tauschii]
Length=539

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 154/196 (79%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAAL+ +AKNCPNF RFRLC L P  PDA+T QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  341  CHQMTNAALLTIAKNCPNFTRFRLCILEPGKPDAMTNQPLDEGFGAIVRECKGLRRLSIS  400

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YIG +A+QLEMLSIAFAG SD GM++V+ GC  L+KL IRDSPFG+AALL 
Sbjct  401  GLLTDKVFMYIGKFAKQLEMLSIAFAGDSDAGMMHVMEGCNNLRKLEIRDSPFGDAALLE  460

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINE-SEQAETSHDDG-QKVEKMY  224
            +  KYETMRSLWMSS  VT   C+ILA KMP LNVE+INE  E  E   + G  KV+K+Y
Sbjct  461  NVTKYETMRSLWMSSCNVTEKGCQILASKMPMLNVEVINEVDESNEMDENHGIPKVDKLY  520

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT AG R DAP FV
Sbjct  521  VYRTTAGARDDAPNFV  536



>ref|NP_001067971.2| Os11g0515500 [Oryza sativa Japonica Group]
 sp|Q2R3K5.1|TIRC_ORYSJ RecName: Full=Transport inhibitor response 1-like protein Os11g0515500; 
Short=TIR1-like protein [Oryza sativa Japonica Group]
 gb|ABA93930.1| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92936.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28334.2| Os11g0515500 [Oryza sativa Japonica Group]
Length=568

 Score =   273 bits (697),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQ+M N+ALI VAKNCP F  FRLC L+P   DAVT QPLDEG+GAIVQSCKGL+RL + 
Sbjct  370  CQRMTNSALITVAKNCPRFTSFRLCVLDPGSADAVTGQPLDEGYGAIVQSCKGLRRLCLS  429

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLS+AFAG +D GM YVLNGCK LKKL IRDSPFG++ALLA
Sbjct  430  GLLTDTVFLYIGMYAERLEMLSVAFAGDTDDGMTYVLNGCKNLKKLEIRDSPFGDSALLA  489

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSH--DDGQKVEKMY  224
               +YE MRSLW+SS  VTLG CK LA  M  LN+E++N +     +   +D +KV+K+Y
Sbjct  490  GMHQYEAMRSLWLSSCNVTLGGCKSLAASMANLNIEVMNRAASINEADNANDAKKVKKLY  549

Query  223  LYRTLAGPRKDAPGFVWTL  167
            +YRT+AGPR DAP F+ T 
Sbjct  550  IYRTVAGPRGDAPEFISTF  568



>ref|NP_001136608.1| hypothetical protein [Zea mays]
 ref|XP_008661488.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008661489.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF82259.1| unknown [Zea mays]
 gb|AFW58108.1| hypothetical protein ZEAMMB73_540791 [Zea mays]
 gb|AFW58109.1| hypothetical protein ZEAMMB73_540791 [Zea mays]
Length=573

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 155/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N AL  VAKNCP+FIRFRLC L P  PDA+T QPLDEGFGAIV+ CKGL+RLS+ 
Sbjct  375  CHQMTNEALTTVAKNCPSFIRFRLCILEPKKPDAMTGQPLDEGFGAIVRDCKGLRRLSMS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF+YI MYA+ LEMLSIAFAG  DKGM+ V+NGCK L+KL IRDSPFG+ ALL 
Sbjct  435  GLLTDRVFMYIRMYAKYLEMLSIAFAGDGDKGMMDVMNGCKNLRKLEIRDSPFGDFALLG  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE--TSHDDGQKVEKMY  224
            +  KY+TMRSLWMSS  VTL  C++LA KMP LNVEI+NE + +    +H +  KV+K+Y
Sbjct  495  NVAKYDTMRSLWMSSCNVTLKGCQVLASKMPMLNVEIMNELDGSSEMENHGNLSKVDKLY  554

Query  223  LYRTLAGPRKDAPGFVWTL  167
            +YRT AG R DAP FV  L
Sbjct  555  VYRTTAGVRDDAPNFVQIL  573



>gb|KHN28237.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Glycine soja]
Length=337

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PN  RFRLC + P  PD +T +PLD GFGAIV+ CK L+RLS+ 
Sbjct  133  CRQMSNAALHTIARNRPNLTRFRLCIIEPRTPDYLTQEPLDSGFGAIVEQCKDLQRLSLS  192

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  193  GLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  252

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    ++  DD   VEK+Y+Y
Sbjct  253  NAEKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPDSRPDDC-PVEKLYIY  311

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  312  RTVAGPRLDMPGFVWTM  328



>gb|KDP28084.1| hypothetical protein JCGZ_13855 [Jatropha curcas]
Length=581

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI VA+N PN  RFRLC + P  PD  T+QPLD+GFGAIVQ CK L+RLS+ 
Sbjct  377  CHQMTNDALITVARNRPNMTRFRLCIMEPRTPDYTTLQPLDDGFGAIVQHCKDLQRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +V++GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVMSGCENLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPD-SRPESCPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  556  RTVAGPRFDMPGFVWTM  572



>ref|XP_006662955.1| PREDICTED: transport inhibitor response 1-like protein Os11g0515500-like 
[Oryza brachyantha]
Length=571

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 160/197 (81%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQ+M N+ALI VAKNCP F  FRLC ++P   DAVT QPLDEGFGAIV SCK L+RLS+ 
Sbjct  372  CQRMTNSALITVAKNCPQFSSFRLCVVDPGSADAVTGQPLDEGFGAIVYSCKDLRRLSLS  431

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VFLYIGMYAE+LEMLS+AFAG +D GM YVLNGCK LKKL IRDSPFG++ALLA
Sbjct  432  GLLTDRVFLYIGMYAERLEMLSVAFAGDTDDGMTYVLNGCKNLKKLEIRDSPFGDSALLA  491

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINES---EQAETSHDDGQKVEKM  227
               KYE MRSLWMSS  +TLGACK LA  MP LNVE++NE+   ++A+   ++ +KV+K+
Sbjct  492  GMPKYEAMRSLWMSSCNITLGACKSLAANMPNLNVEVMNEAARIDEADEDANNAKKVQKL  551

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT+AGPR DAP F+
Sbjct  552  YIYRTVAGPRGDAPEFI  568



>ref|XP_012082666.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Jatropha curcas]
Length=584

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI VA+N PN  RFRLC + P  PD  T+QPLD+GFGAIVQ CK L+RLS+ 
Sbjct  380  CHQMTNDALITVARNRPNMTRFRLCIMEPRTPDYTTLQPLDDGFGAIVQHCKDLQRLSLS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +V++GC+ L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVMSGCENLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPD-SRPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  559  RTVAGPRFDMPGFVWTM  575



>gb|ACJ85650.1| unknown [Medicago truncatula]
Length=253

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PN  RFRLC + P  PD +T+Q LD GFGAIV+ CK L+RLS+ 
Sbjct  50   CRQMTNAALNTIARNRPNMTRFRLCIIEPRTPDYLTLQSLDSGFGAIVEHCKDLQRLSLS  109

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF +IG YA++LEMLS+AFAG SD G+ +VL+GC  L+KL +RD PFG+ ALLA
Sbjct  110  GLLTDRVFEHIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEVRDCPFGDKALLA  169

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E         D   VEK+Y+Y
Sbjct  170  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDE-RGPPNLRPDSNPVEKLYIY  228

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D PG+VWT+
Sbjct  229  RTISGPRLDMPGYVWTM  245



>dbj|BAJ97220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C +M N+ALI VAKNC     FRL        DAVT QPLDEGFGAIV+SCKGL+RLS+ 
Sbjct  231  CSRMTNSALITVAKNCSRITSFRLRICLHGSVDAVTGQPLDEGFGAIVRSCKGLRRLSMS  290

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LE LS+AFAG SD GM+YVLNGCK L+KL +R+ PFG+ ALLA
Sbjct  291  GLLTDSVFLYIGMYAERLETLSVAFAGDSDDGMIYVLNGCKNLRKLEMRNCPFGDTALLA  350

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE MRSLWMSS ++TLG C+ LA  MP LNVE++++ +       D +KVEK+Y+Y
Sbjct  351  GMHRYEAMRSLWMSSCDITLGGCRSLAATMPNLNVEVVSQVDGVSC---DAKKVEKLYVY  407

Query  217  RTLAGPRKDAPGFVWTL  167
            RTLAGPR DAPGFV  L
Sbjct  408  RTLAGPRGDAPGFVSAL  424



>gb|AFM95208.1| transport inhibitor response 1, partial [Cynara cardunculus var. 
scolymus]
Length=230

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N+ALI +A+N PN   FRLC L P  PD +T++PLD GFGAIV+ CKGL+RLS+ 
Sbjct  26   CRQMSNSALITIARNRPNLTCFRLCILEPRAPDYLTLEPLDAGFGAIVKHCKGLQRLSLS  85

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF YIG  A++LEMLSIAFAG SD G+ YVL+GC  L+KL IRD PFG+ ALLA
Sbjct  86   GLLTDCVFEYIGTRAKRLEMLSIAFAGDSDLGLHYVLSGCDSLQKLEIRDCPFGDKALLA  145

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK L++KMP LNVE+I+E+   + S  D   VEK+Y+Y
Sbjct  146  NVSKLETMRSLWMSSCAVSYGACKFLSQKMPMLNVEVIDENGSLD-SRFDSCPVEKLYIY  204

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PG++ T+
Sbjct  205  RTVAGPRSDMPGYIRTI  221



>ref|XP_010038170.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Eucalyptus 
grandis]
 gb|KCW49983.1| hypothetical protein EUGRSUZ_K03439 [Eucalyptus grandis]
Length=581

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T +PLD GFGAIVQ CK L+RLS+ 
Sbjct  377  CRQMSNAALLTIARNRPNMTRFRLCIIEPRCPDYITHEPLDTGFGAIVQHCKDLQRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDSLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVIDERGHPD-SRPESCPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D P FVWT+
Sbjct  556  RTVAGPRFDMPDFVWTM  572



>ref|XP_008386617.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Malus 
domestica]
Length=584

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P +PD +T+QPLD GFGAIV++CK L+RLS+ 
Sbjct  380  CRQMSNDALITIARNQPNFTCFRLCIIEPKIPDYLTLQPLDVGFGAIVENCKNLRRLSIS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG Y + LEMLS+AFAG SD G+ ++L+GC  L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRVFDYIGTYGKNLEMLSVAFAGDSDLGLHHILSGCDNLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    E S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDERGHPE-SRPENSPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  559  RSVAGPRFDMPGFVWTM  575



>ref|XP_010523990.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Tarenaya hassleriana]
 ref|XP_010523991.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Tarenaya hassleriana]
Length=590

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T+QPLD GFGAI + CK L+R S+ 
Sbjct  381  CRQMTNAALVTIARNRPNLTRFRLCIIEPKAPDYMTLQPLDVGFGAIAEHCKKLQRFSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDKVFEYIGTYAKKLEMLSVAFAGDSDLGMHHVLSGCDNLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  D   VE++Y+Y
Sbjct  501  NASKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVIDERGPPD-SRPDSSPVERVYIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>ref|XP_008368919.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Malus 
domestica]
Length=587

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P +PD +T+QPLD GFGAIV++CK L+RLSV 
Sbjct  383  CRQMSNDALITIARNQPNFTCFRLCIIEPKIPDYLTLQPLDVGFGAIVENCKNLRRLSVS  442

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQ F YIG Y ++LEMLS+AFAG SD G+ ++L+GC  L+KL IRD PFG+ ALLA
Sbjct  443  GLLTDQAFDYIGTYGKKLEMLSLAFAGDSDLGLHHILSGCDNLRKLEIRDCPFGDKALLA  502

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +++PRLNVE+I+E    E S  +   VEK+Y+Y
Sbjct  503  NAAKLETMRSLWMSSCSVSYGACKLLGQRLPRLNVEVIDERGHPE-SRPESSPVEKLYIY  561

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  562  RSVAGPRFDMPGFVWTM  578



>ref|XP_006844497.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Amborella trichopoda]
 gb|ERN06172.1| hypothetical protein AMTR_s00016p00126140 [Amborella trichopoda]
Length=575

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 151/196 (77%), Gaps = 1/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A++CPNF RFRLC + P  PD +T QPLDEGFG+IV+ CK L+RLSV 
Sbjct  378  CRQMTNAALTTIARSCPNFTRFRLCIIEPHTPDHLTRQPLDEGFGSIVRECKSLQRLSVS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQVFLYIGMY ++LEMLS+AFAG+S+KGM YVL GC  L+KL IRDSPFG+ ALL 
Sbjct  438  GLLTDQVFLYIGMYGKKLEMLSVAFAGESNKGMQYVLRGCSSLRKLEIRDSPFGDEALLT  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE-QAETSHDDGQKVEKMYL  221
              GK ETMRSLWMS  EV+ G CK LA++ P LNVE+++E E +   S     +V+K+Y+
Sbjct  498  GVGKLETMRSLWMSGCEVSYGGCKELAERAPGLNVEVMSERECRFIGSPVREHRVDKVYV  557

Query  220  YRTLAGPRKDAPGFVW  173
            YRTL G R+D P FVW
Sbjct  558  YRTLVGRREDMPNFVW  573



>gb|ACB30702.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30703.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30704.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30705.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30706.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30707.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30708.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30709.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30710.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30711.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30712.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30713.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30714.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30715.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30716.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30717.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30718.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30719.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30720.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30721.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30722.1| AFB3, partial [Arabidopsis thaliana]
 gb|ACB30723.1| AFB3, partial [Arabidopsis thaliana]
Length=154

 Score =   244 bits (623),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 3/154 (2%)
 Frame = -3

Query  655  VTMQPLDEGFGAIVQSCKGLKRLSVFGLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGML  476
            +T Q LDEGFGAIVQ+CKGL+RLSV GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGML
Sbjct  1    ITFQSLDEGFGAIVQACKGLRRLSVSGLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGML  60

Query  475  YVLNGCKKLKKLXIRDSPFGNAALLADXGKYETMRSLWMSSXEVTLGACKILAKKMPRLN  296
            YVLNGCKK++KL IRDSPFGNAALLAD G+YETMRSLWMSS EVTLG CK LA+  PRLN
Sbjct  61   YVLNGCKKMRKLEIRDSPFGNAALLADVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLN  120

Query  295  VEIINESEQ---AETSHDDGQKVEKMYLYRTLAG  203
            VEIINE+E     +   D+ +KV+K+YLYRT+ G
Sbjct  121  VEIINENENNGMEQNEEDEREKVDKLYLYRTVVG  154



>ref|XP_011082496.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011082497.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011082499.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
Length=581

 Score =   257 bits (657),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N P  IRFRLC + P  PD +T++PLD GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMSNAALVTIARNRPEMIRFRLCIIEPQAPDYLTLEPLDAGFGAIVENCKELRRLSMS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDKVFEYIGNHAKKLEMLSIAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVIDERGPPD-SRPESCPVEKLYVY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AG R D PGFVWT+
Sbjct  556  RTVAGRRADMPGFVWTM  572



>ref|XP_007163058.1| hypothetical protein PHAVU_001G202600g [Phaseolus vulgaris]
 gb|ADV56682.1| F-box/leucine rich repeat protein [Phaseolus vulgaris]
 gb|ESW35052.1| hypothetical protein PHAVU_001G202600g [Phaseolus vulgaris]
Length=591

 Score =   258 bits (658),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A N PN  RFRLC + P  PD +T +PLD GFGAIV+ CK L+RLS+ 
Sbjct  382  CRQMSNAALHTIALNRPNLTRFRLCIIEPKTPDYLTHEPLDSGFGAIVEHCKDLQRLSLS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG Y ++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  442  GLLTDRVFEYIGTYGKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  D   VEK+Y+Y
Sbjct  502  NAAKLETMRSLWMSSCSVSYGACKVLGQKMPRLNVEVIDERGPPD-SRPDNCPVEKLYIY  560

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  561  RTIAGPRLDMPGFVWTM  577



>ref|XP_004495993.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Cicer 
arietinum]
Length=583

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PN  RFRLC + P  PD +T+QPLD GFGAIV+ CK L+RLS+ 
Sbjct  380  CRQMSNAALNTIARNRPNMTRFRLCIIEPRTPDYLTLQPLDAGFGAIVEHCKNLQRLSLS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG Y ++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRVFEYIGTYGKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCYVSYGACKLLGQKLPRLNVEVIDERGPPD-SRPESSPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D PG+VWT+
Sbjct  559  RTISGPRSDMPGYVWTM  575



>gb|AIT18058.1| transport inhibitor response 1-like protein [Prunus salicina]
 gb|AIT18059.1| transport inhibitor response 1-like protein [Prunus salicina]
Length=584

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P  PD +T++PLD GFGAIV+ CK L+RLSV 
Sbjct  380  CRQMSNDALITIARNQPNFTCFRLCIIEPRTPDYITLEPLDVGFGAIVEHCKDLRRLSVS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG + ++LEMLS+AFAG SD G+ YVL+GC+ L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRAFEYIGTHGKKLEMLSLAFAGDSDLGLHYVLSGCENLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    E S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDERGHPE-SRPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  559  RSVAGPRFDMPGFVWTM  575



>emb|CDX76680.1| BnaC08g32660D [Brassica napus]
Length=595

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMTNAALVTIARNRPNMTRFRLCIIEPKAPDHLTLEPLDVGFGAIVEHCKDLRRLSMS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCESLRKLEIRDCPFGDNALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E    + S  +   VE++++Y
Sbjct  501  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGPPD-SRTESCPVERVFIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>gb|ACB30724.1| AFB3, partial [Arabidopsis thaliana]
Length=154

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = -3

Query  655  VTMQPLDEGFGAIVQSCKGLKRLSVFGLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGML  476
            +T Q LDEGFGAIVQ+CKGL+RLSV GLLTDQVFLYIGMYAEQLEMLSIAFAG +DKGML
Sbjct  1    ITFQSLDEGFGAIVQACKGLRRLSVSGLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGML  60

Query  475  YVLNGCKKLKKLXIRDSPFGNAALLADXGKYETMRSLWMSSXEVTLGACKILAKKMPRLN  296
            YVLNGCKK++KL IRDSPFGNAALLAD G+YETMRSLWMSS EVT G CK LA+  PRLN
Sbjct  61   YVLNGCKKMRKLEIRDSPFGNAALLADVGRYETMRSLWMSSCEVTFGGCKRLAQNSPRLN  120

Query  295  VEIINESEQ---AETSHDDGQKVEKMYLYRTLAG  203
            VEIINE+E     +   D+ +KV+K+YLYRT+ G
Sbjct  121  VEIINENENNGMEQNEEDEREKVDKLYLYRTVVG  154



>emb|CBI32265.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+++AKN PN  RFRLC + P   D  T++PLD GFGAIV+ CK L RLS+ 
Sbjct  267  CRQMTNAALVSIAKNRPNMTRFRLCIIEPRTRDYQTLEPLDVGFGAIVEHCKELHRLSLS  326

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLS+AFAG  D G+ +VL+GCK L+KL IRD PFG+ ALLA
Sbjct  327  GLLTDRVFEYIGTHAKKLEMLSVAFAGDGDLGLHHVLSGCKSLRKLEIRDCPFGDKALLA  386

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+++E  + + S  +   VEK+Y+Y
Sbjct  387  NAAKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVMDERGRPD-SRPESCSVEKLYIY  445

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D P FVWT+
Sbjct  446  RSVAGPRSDMPRFVWTM  462



>gb|AIG99441.1| transport inhibitor response 1 [Morus alba var. multicaulis]
Length=585

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PNF  FRLC + P  PD +T+ PLD GFGAIV+ CK L+RLSV 
Sbjct  380  CRQMSNAALTTIARNRPNFTCFRLCIIEPRTPDYLTLGPLDAGFGAIVEHCKDLRRLSVS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG YA++LEMLS+AFAG SD G+ YVL+GC+ L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRAFEYIGTYAKKLEMLSLAFAGDSDLGLNYVLSGCENLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E      S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCMVSYGACKLLGQKMPRLNVEVIDE-RGPPGSRPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  559  RSVAGPRFDMPGFVWTM  575



>ref|XP_010112739.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus notabilis]
 gb|EXC34697.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus notabilis]
Length=582

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PNF  FRLC + P  PD +T+ PLD GFGAIV+ CK L+RLSV 
Sbjct  377  CRQMSNAALTTIARNRPNFTCFRLCIIEPRTPDYLTLGPLDAGFGAIVEHCKDLRRLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG YA++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRAFEYIGTYAKKLEMLSLAFAGDSDLGLHHVLSGCENLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    +T   +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCMVSYGACKLLGQKMPRLNVEVIDERGPPDT-RPESCPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  556  RSVAGPRFDMPGFVWTM  572



>ref|NP_001054666.2| Os05g0150500 [Oryza sativa Japonica Group]
 dbj|BAF16580.2| Os05g0150500 [Oryza sativa Japonica Group]
Length=255

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC L P  PD +T +PLD GF AIV+SC+GL+RLS+ 
Sbjct  57   CRRMTNEALITIAKNRPNFTCFRLCILEPHTPDYITREPLDAGFSAIVESCRGLRRLSIS  116

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  117  GLLTDLVFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  176

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL+VEI+N+  ++    S  D   VEK+Y
Sbjct  177  NAAKLETMRSLWMSSCLLTLGACRQLARKMPRLSVEIMNDPGRSCPLDSLPDETPVEKLY  236

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P  V
Sbjct  237  VYRTIAGPRSDTPACV  252



>gb|EYU46730.1| hypothetical protein MIMGU_mgv1a003374mg [Erythranthe guttata]
Length=589

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N P  IRFRLC + P VPD +T++PLD GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMSNAALVTIARNRPKMIRFRLCIIEPRVPDYLTLEPLDTGFGAIVENCKELRRLSMS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTHAKKLEMLSIAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E     T   +   VE++Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVIDERGPPNT-RPESCPVERLYVY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+ G R D PGFVW +
Sbjct  556  RTVGGRRDDMPGFVWNM  572



>ref|XP_008234995.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Prunus mume]
Length=584

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P  PD +T++PLD GFGAIV+ CK L+RLSV 
Sbjct  380  CRQMSNDALITIARNQPNFTCFRLCIIEPRTPDYLTLEPLDVGFGAIVEHCKDLRRLSVS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG + ++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRAFEYIGTHGKKLEMLSLAFAGDSDLGLHHVLSGCENLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    E S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDERGHPE-SRPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  559  RSIAGPRFDMPGFVWTM  575



>ref|XP_009587773.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Nicotiana 
tomentosiformis]
Length=585

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  379  CRQMTNAALVTIARNRPNMTRFRLCIIEPRTPDYLTLEPLDTGFGAIVEECKELQRLSLS  438

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALL+
Sbjct  439  GLLTDRVFEYIGTHAKKLEMLSIAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDDALLS  498

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K E+MRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    +T   D   V+K+Y+Y
Sbjct  499  NAAKLESMRSLWMSSCSVSFGACKLLGQKLPRLNVEVIDERGPPDT-RPDSCPVDKLYIY  557

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D P +VWT+
Sbjct  558  RTVAGPRLDMPDYVWTM  574



>ref|NP_001148131.1| transport inhibitor response 1 protein [Zea mays]
 ref|XP_008667941.1| PREDICTED: transport inhibitor response 1 protein isoform X1 
[Zea mays]
 ref|XP_008667942.1| PREDICTED: transport inhibitor response 1 protein isoform X1 
[Zea mays]
 ref|XP_008667943.1| PREDICTED: transport inhibitor response 1 protein isoform X1 
[Zea mays]
 gb|ACF87293.1| unknown [Zea mays]
 gb|ACG29837.1| transport inhibitor response 1 protein [Zea mays]
 tpg|DAA42008.1| TPA: transport inhibitor response 1 protein [Zea mays]
Length=573

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C +M N AL+ +A+ CP    FRLC   P   DAVT QPLDEGFGAIV+SC+GL+RL++ 
Sbjct  375  CVRMTNTALMTIARYCPRLTSFRLCIRKPRSADAVTGQPLDEGFGAIVRSCRGLRRLAMS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VFLYIGMYAE+LEMLS+ FAG +D GM+YVLNGC+ LKKL I++SPFG+AALLA
Sbjct  435  GLLTDSVFLYIGMYAEKLEMLSVTFAGDTDDGMVYVLNGCRNLKKLVIKESPFGDAALLA  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE--QAETSHDDGQKVEKMY  224
               +YE+MRSLWMSS ++TLG CK LA  MP +NVE+I  +     +      +KV+ +Y
Sbjct  495  GAHRYESMRSLWMSSCQITLGGCKALAATMPNINVEVIGGASFGAMDGGVSGARKVDMLY  554

Query  223  LYRTLAGPRKDAPGFV  176
            LYRTLAGPR D PGFV
Sbjct  555  LYRTLAGPRCDTPGFV  570



>ref|XP_008799278.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Phoenix dactylifera]
Length=584

 Score =   254 bits (650),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 147/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL AVA+N PN   FRLC + P  PD VT++PLD GF AIV+SCK L+RLSV 
Sbjct  382  CRQMTNAALFAVARNSPNLTCFRLCIIEPRTPDYVTLEPLDAGFSAIVESCKDLRRLSVS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG  A  LEMLS+AFAG SD G+ Y+L+GCK L+KL IRD PFG+ ALLA
Sbjct  442  GLLTDNVFRSIGAAANHLEMLSVAFAGDSDAGLHYILSGCKSLRKLEIRDCPFGDKALLA  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAE-TSHDDGQKVEKMYL  221
            +  K ETMRSLWMSS  V+LGAC++LA+KMP LNVE+++E       S  D   VEK+Y+
Sbjct  502  NAAKLETMRSLWMSSCSVSLGACRLLARKMPWLNVEVMDERRGGSWASQPDDCPVEKLYV  561

Query  220  YRTLAGPRKDAPGFVWTL  167
            YRT+AGPR D P  VWT+
Sbjct  562  YRTVAGPRSDTPPCVWTV  579



>ref|XP_007201723.1| hypothetical protein PRUPE_ppa003344mg [Prunus persica]
 gb|EMJ02922.1| hypothetical protein PRUPE_ppa003344mg [Prunus persica]
Length=584

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P  PD +T++PLD GFGAIV+ CK L+RLSV 
Sbjct  380  CRQMSNDALITIARNQPNFTCFRLCIIEPRTPDYLTLEPLDVGFGAIVEHCKDLRRLSVS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG + ++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRAFEYIGTHGKKLEMLSLAFAGDSDLGLHHVLSGCENLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    E S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDERGHPE-SRPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  559  RSVAGPRFDMPGFVWTM  575



>gb|ACG48935.1| transport inhibitor response 1 protein [Zea mays]
Length=573

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C +M N AL+ +A+ CP    FRLC   P   DAVT QPLDEGFGAIV+SC+GL+RL++ 
Sbjct  375  CDRMTNTALMTIARYCPRLTSFRLCIRKPRSADAVTGQPLDEGFGAIVRSCRGLRRLAMS  434

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTD VFLYIGMYAE+LEMLS+ FAG +D GM+YVLNGC+ LKKL I++SPFG+AALLA
Sbjct  435  GFLTDSVFLYIGMYAEKLEMLSVTFAGDTDDGMVYVLNGCRNLKKLVIKESPFGDAALLA  494

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESE--QAETSHDDGQKVEKMY  224
               +YE+MRSLWMSS ++TLG CK LA  MP +NVE+I  +     +      +KV+ +Y
Sbjct  495  GAHRYESMRSLWMSSCQITLGGCKALAATMPNINVEVIGGASFGAMDGGVSGARKVDMLY  554

Query  223  LYRTLAGPRKDAPGFV  176
            LYRTLAGPR D PGFV
Sbjct  555  LYRTLAGPRCDTPGFV  570



>ref|XP_004309692.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Fragaria 
vesca subsp. vesca]
Length=584

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P  PD +T +PLD GFGAIV+ CK L+RLSV 
Sbjct  380  CRQMSNDALITIARNQPNFTCFRLCIIEPRTPDYLTREPLDVGFGAIVERCKDLRRLSVS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG Y ++LEMLS+AFAG+SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRAFEYIGTYGKKLEMLSVAFAGESDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    E    +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDERGHPEL-RPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGF+WT+
Sbjct  559  RSVAGPRFDMPGFIWTM  575



>ref|XP_002269127.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Vitis vinifera]
Length=576

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+++AKN PN  RFRLC + P   D  T++PLD GFGAIV+ CK L RLS+ 
Sbjct  377  CRQMTNAALVSIAKNRPNMTRFRLCIIEPRTRDYQTLEPLDVGFGAIVEHCKELHRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLS+AFAG  D G+ +VL+GCK L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTHAKKLEMLSVAFAGDGDLGLHHVLSGCKSLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+++E  + + S  +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVMDERGRPD-SRPESCSVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D P FVWT+
Sbjct  556  RSVAGPRSDMPRFVWTM  572



>gb|KEH43259.1| transport inhibitor response-like protein [Medicago truncatula]
Length=589

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PN  RFRLC + P  PD +T+Q LD GFGAIV+ CK L+RLS+ 
Sbjct  386  CRQMTNAALNTIARNRPNMTRFRLCIIEPRTPDYLTLQSLDSGFGAIVEHCKDLQRLSLS  445

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF +IG YA++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  446  GLLTDRVFEHIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  505

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E         D   VEK+Y+Y
Sbjct  506  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDE-RGPPNLRPDSNPVEKLYIY  564

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D PG+VWT+
Sbjct  565  RTISGPRLDMPGYVWTM  581



>gb|KHN43550.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Glycine soja]
Length=587

 Score =   252 bits (644),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N  N  RFRLC + P  PD +T +PLD GFGAIV+ CK L+RLS+ 
Sbjct  383  CRQMSNAALHTIARNRTNLTRFRLCIIEPRTPDYLTHEPLDSGFGAIVEQCKDLQRLSLS  442

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG   ++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  443  GLLTDRVFEYIGTCGKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  502

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    ++  DD   VEK+Y+Y
Sbjct  503  NAEKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPDSRPDDC-PVEKLYIY  561

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  562  RTIAGPRLDMPGFVWTM  578



>ref|XP_010241246.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nelumbo 
nucifera]
Length=581

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PN  RFRLC + P  PD +T+QPLD GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMSNAALFTIARNRPNLTRFRLCIIEPRAPDYLTLQPLDAGFGAIVENCKDLQRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTHAKKLEMLSIAFAGDSDLGLHHVLSGCNSLRKLEIRDCPFGDQALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+  ACK+L +KMP LNVE+I+E    E S  +   ++K+Y+Y
Sbjct  497  NASKLETMRSLWMSSCSVSFEACKLLGQKMPSLNVEVIDERGSPE-SRPESLPIDKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D P FVW +
Sbjct  556  RTIAGPRCDMPSFVWNM  572



>gb|ADL70207.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70211.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=230

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  17   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  76

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  77   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  136

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  137  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  195

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  196  RTVAGPRFDMPGFVWNM  212



>emb|CAN82353.1| hypothetical protein VITISV_036655 [Vitis vinifera]
Length=590

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+++AKN PN  RFRLC + P   D  T++PLD GFGAIV+ CK L RLS+ 
Sbjct  391  CRQMTNAALVSIAKNRPNMTRFRLCIIEPRTRDYQTLEPLDVGFGAIVEHCKELHRLSLS  450

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLS+AFAG  D G+ +VL+GCK L+KL IRD PFG+ ALLA
Sbjct  451  GLLTDRVFEYIGTHAKKLEMLSVAFAGDGDLGLHHVLSGCKSLRKLEIRDCPFGDKALLA  510

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+++E  + + S  +   VEK+Y+Y
Sbjct  511  NAAKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVMDERGRPD-SRPESCSVEKLYIY  569

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D P FVWT+
Sbjct  570  RSVAGPRSDMPRFVWTM  586



>gb|AHA44833.1| AFB6 [Larix kaempferi]
Length=573

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 149/197 (76%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+I VA+NCPN   FRLC + P  PD +T +P+DE FGAIV+ CK L+RL+V 
Sbjct  383  CRQMTNAAIITVAQNCPNLTHFRLCIMKPCQPDHLTDEPMDEAFGAIVKICKNLQRLAVS  442

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG+YA+ LE LS+AFAG SD GM  VL GC KL+KL IRDSPFGNAALL+
Sbjct  443  GLLTDKAFEYIGLYAKNLETLSVAFAGSSDSGMQCVLQGCPKLRKLEIRDSPFGNAALLS  502

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMSS +VT+  C+ LA+  PRLNVEII E+++      D  + +K+Y+Y
Sbjct  503  GLERYESMRSLWMSSCKVTMSGCRYLAQNKPRLNVEIIKENDE------DDNEADKLYVY  556

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+D P FV TL
Sbjct  557  RTIAGPRRDVPNFVLTL  573



>gb|KJB23183.1| hypothetical protein B456_004G085900 [Gossypium raimondii]
Length=586

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N AL+ +A+N PNF RFRLC + P   D +T++PLD GFGAIVQ CK LKRLS+ 
Sbjct  382  CRRMSNEALVTIARNRPNFTRFRLCIIEPKTADYLTLEPLDVGFGAIVQYCKDLKRLSLS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  442  GLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+  ACK+L +KMPRLNVE+I+E    + S  +   V+K+Y+Y
Sbjct  502  NAAKLETMRSLWMSSCAVSFAACKLLGQKMPRLNVEVIDERGPPD-SRPENCPVDKLYIY  560

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D P FVWT+
Sbjct  561  RSIAGPRFDMPPFVWTM  577



>gb|ADB92044.2| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70209.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=249

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  36   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  95

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  96   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  155

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  156  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  214

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  215  RTVAGPRFDMPGFVWNM  231



>gb|ADB92043.2| transport inhibitor response 1 [Arabidopsis thaliana]
Length=250

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  37   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  96

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  97   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  156

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  157  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  215

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  216  RTVAGPRFDMPGFVWNM  232



>gb|ADB92045.2| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADB92046.2| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70204.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70206.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70212.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70213.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70214.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70215.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70216.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=248

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  35   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  94

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  95   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  154

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  155  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  213

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  214  RTVAGPRFDMPGFVWNM  230



>gb|ADL70208.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=247

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  34   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  93

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  94   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  153

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  154  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  212

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  213  RTVAGPRFDMPGFVWNM  229



>gb|ADB92042.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|ADL70205.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=246

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  33   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  92

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  93   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  152

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  153  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  211

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  212  RTVAGPRFDMPGFVWNM  228



>ref|XP_006359432.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Solanum 
tuberosum]
Length=581

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN IRFRLC + P  PD +T+   D GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMTNAALVTIARNRPNMIRFRLCIIEPRTPDYLTLGSFDAGFGAIVENCKELRRLSLA  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGAHAKKLEMLSIAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+  ACK+LA+KMPRLNVE+I+E    +T   +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFEACKMLAQKMPRLNVEVIDERGPPDT-RPESCPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AG R D PG+VWT+
Sbjct  556  RTVAGRRFDTPGYVWTM  572



>gb|ADL70210.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=261

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  48   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  107

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  108  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  167

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  168  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  226

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  227  RTVAGPRFDMPGFVWNM  243



>ref|XP_003536281.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Glycine max]
 gb|KHN03749.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Glycine soja]
Length=585

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N+AL  +A+N PN  RFRLC + P  PD +T QPLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMTNSALDTIARNRPNMTRFRLCIIEPQAPDHLTHQPLDAGFGAIVEHCKDLQRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG Y ++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDRVFEYIGTYGKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  501  NAAKLETMRSLWMSSCLVSYGACKLLGQKLPRLNVEVIDERGPPD-SRPESSPVEKLYMY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D PG+VW +
Sbjct  560  RTVSGPRLDMPGYVWRM  576



>ref|XP_003518950.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Glycine max]
 gb|KHN46593.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Glycine soja]
Length=585

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A++ PN  RFRLC + P  PD +T QPLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMSNAALDTIARSRPNMTRFRLCIIEPRAPDYLTHQPLDAGFGAIVEHCKDLQRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG Y ++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDRVFEYIGTYGKKLEMLSVAFAGDSDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    + S  +   VEK+Y+Y
Sbjct  501  NAAKLETMRSLWMSSCLVSYGACKLLGQKMPRLNVEVIDERGPPD-SRPESSPVEKLYIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D PG+VW +
Sbjct  560  RTVSGPRLDMPGYVWRM  576



>emb|CBI34249.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N AL  +A+N PN  RFRLC +    PD +T +PLD GFGAIV+ CK LKRLS+ 
Sbjct  267  CRRMSNVALSTIARNRPNLTRFRLCIIERFRPDYITQEPLDVGFGAIVEHCKDLKRLSLS  326

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG + ++LEMLS+AFAG SD G+ +VL+GCK L+KL IRD PFG+ ALLA
Sbjct  327  GLLTDRVFEYIGSHGKKLEMLSLAFAGDSDLGLHHVLSGCKSLRKLEIRDCPFGDKALLA  386

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMS+ +V+  ACK+L +KMPRLNVE+I E    ++S D+   VEK+Y+Y
Sbjct  387  NAAKLETMRSLWMSACQVSYRACKLLGQKMPRLNVEVIAEQGHPDSSPDE-YPVEKLYIY  445

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D P FVWT+
Sbjct  446  RTVSGPRSDMPSFVWTM  462



>ref|XP_004960270.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500-like 
[Setaria italica]
Length=590

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC + P  PD +T QPLD GF AIV+SCKGL+RLSV 
Sbjct  392  CRRMTNEALITIAKNRPNFTCFRLCIIEPHTPDYITHQPLDAGFSAIVESCKGLRRLSVS  451

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  452  GLLTDRVFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  511

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL+VE++N+  +A    S  D    E MY
Sbjct  512  NAAKLETMRSLWMSSCSLTLGACRQLARKMPRLSVEVMNDPRRACPLDSLTDESPAETMY  571

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P +V
Sbjct  572  VYRTIAGPRSDTPTWV  587



>gb|ADE76203.1| unknown [Picea sitchensis]
Length=570

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 150/197 (76%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA++ VA+NCP    FRLC + P  PD +T +P+DE FGAIV++CK L+RLS+ 
Sbjct  380  CRQMTNAAIVTVAQNCPKLTHFRLCIMAPHQPDHLTNEPMDEAFGAIVRNCKNLQRLSLS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTD+ F Y+G YA++L+ LS+AFAG SD+GM YVL GC KL+KL IRDSPFG+AALL+
Sbjct  440  GWLTDKTFEYVGCYAKKLQTLSVAFAGNSDRGMQYVLQGCPKLRKLEIRDSPFGDAALLS  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
              G YE+MRS WMS+   TL  CKILA++MPRLNVEI+ E +      D+  +VEK+Y+Y
Sbjct  500  GMGHYESMRSSWMSACTTTLNGCKILAQEMPRLNVEIMKEDD------DNNLQVEKLYVY  553

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++G R DAP FV+TL
Sbjct  554  RTVSGSRMDAPSFVYTL  570



>gb|AFS44506.1| auxin receptor 1, partial [Fragaria x ananassa]
Length=579

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PNF  FRLC + P  PD +T +PLD GFGAIV+ CK L+RLSV 
Sbjct  377  CRQMSNDALITIARNQPNFTCFRLCIIEPRTPDYLTREPLDVGFGAIVERCKDLRRLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG Y ++LEMLS+AFAG+SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRAFEYIGTYGKKLEMLSVAFAGESDLGLHHVLSGCDNLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMS   V+ GACK+L +K+PRLNVE+I+E    E    +   VE +Y+Y
Sbjct  497  NAAKLETMRSLWMSPCSVSYGACKLLGQKLPRLNVEVIDERGHPEL-RPESCPVENLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGF+WT+
Sbjct  556  RSVAGPRFDMPGFIWTM  572



>gb|EYU27894.1| hypothetical protein MIMGU_mgv1a003388mg [Erythranthe guttata]
Length=588

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAA+I + KNCP+F  FRLC + P  PD +T +P+DE FGA+ ++C  LKRLSV 
Sbjct  398  CRRMTNAAVITIVKNCPDFTHFRLCIMTPGQPDHLTNEPMDEAFGAVAKTCTKLKRLSVS  457

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGN ALL+
Sbjct  458  GLLTDVSFEYIGKYAKNLETLSVAFAGSSDWGMQSVLEGCPKLRKLEIRDCPFGNTALLS  517

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYETMRSLWMS+  VT+  C ILA++MPRLNVE+IN+         DG + +K+Y+Y
Sbjct  518  GKLKYETMRSLWMSACNVTMKGCGILAREMPRLNVEVINDEGS------DGSQADKVYVY  571

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAPGFV TL
Sbjct  572  RTVAGPRRDAPGFVLTL  588



>gb|AAV32196.1| putative transport inhibitor response TIR1 [Oryza sativa Japonica 
Group]
 gb|EEE62352.1| hypothetical protein OsJ_17141 [Oryza sativa Japonica Group]
Length=462

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC L P  PD +T +PLD GF AIV+SC+GL+RLS+ 
Sbjct  264  CRRMTNEALITIAKNRPNFTCFRLCILEPHTPDYITREPLDAGFSAIVESCRGLRRLSIS  323

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  324  GLLTDLVFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  383

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL+VEI+N+  ++    S  D   VEK+Y
Sbjct  384  NAAKLETMRSLWMSSCLLTLGACRQLARKMPRLSVEIMNDPGRSCPLDSLPDETPVEKLY  443

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P  V
Sbjct  444  VYRTIAGPRSDTPACV  459



>ref|XP_006347140.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Solanum 
tuberosum]
Length=589

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCPNF  FRLC +NP  PD +T +P+DE FGA+V++CK L+RLSV 
Sbjct  400  CRQMTNAAVATIVRNCPNFTHFRLCIMNPGQPDYLTNEPMDEAFGAVVKTCKKLQRLSVS  459

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL+GC KL+KL IRDSPFGNAALL+
Sbjct  460  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLDGCSKLRKLEIRDSPFGNAALLS  519

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
              GKYE+MR LWMS+  VT+  C+ILA++ PRLNVE+I +       H D    +K+Y+Y
Sbjct  520  GMGKYESMRCLWMSACRVTMNGCRILAQERPRLNVEVIKD------EHSD-DYADKLYVY  572

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPRKDAP FV TL
Sbjct  573  RSVAGPRKDAPPFVVTL  589



>ref|XP_006654054.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500-like 
[Oryza brachyantha]
Length=462

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC L P  PD +T +PLD GF AIV+SC+GL+RLS+ 
Sbjct  264  CRRMTNEALITIAKNRPNFTCFRLCILEPHTPDYITREPLDAGFSAIVESCRGLRRLSIS  323

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  324  GLLTDLVFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  383

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL+VEI+N+  +     S  D   VEK+Y
Sbjct  384  NAAKLETMRSLWMSSCLLTLGACRQLARKMPRLSVEIMNDPGRVCPLDSLPDESPVEKLY  443

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P  V
Sbjct  444  VYRTIAGPRSDTPACV  459



>ref|XP_003568922.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Brachypodium distachyon]
Length=590

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC L P  PD +T Q LD GF AIV+SCKGL+RLSV 
Sbjct  392  CRRMTNEALITIAKNRPNFTCFRLCILEPRTPDYITQQSLDAGFSAIVESCKGLRRLSVS  451

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFGN  LLA
Sbjct  452  GLLTDLVFKSIGEHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGNKPLLA  511

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL VEI+N+  +A    +  D   VEK+Y
Sbjct  512  NAAKLETMRSLWMSSCSLTLGACRQLAQKMPRLTVEIMNDPGRACPLDALPDESPVEKLY  571

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P +V
Sbjct  572  VYRTIAGPRSDTPDYV  587



>ref|XP_010522662.1| PREDICTED: GRR1-like protein 1 [Tarenaya hassleriana]
Length=578

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+Q  N A++ +A+N PN   FRLC + P  PD  T++PLDEGFGA+V+ CK L+RLSV 
Sbjct  379  CRQFSNVAMVTIARNRPNLKCFRLCIMEPFAPDYQTLEPLDEGFGAVVEHCKDLQRLSVS  438

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG +A++L+MLS+AFAG+SD G+ ++L+GC+ L+KL IRDSPFG+ A+L 
Sbjct  439  GLLTDKAFEYIGRHAKKLKMLSVAFAGESDMGLRHLLSGCENLRKLEIRDSPFGDEAILE  498

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  + ETMRSLWMSS  V+ GACK+L++KMPRLNVE+I+E    E S  +   VE++Y+Y
Sbjct  499  NAERLETMRSLWMSSCPVSFGACKLLSEKMPRLNVEVIDERGPPE-SRPESCPVERVYIY  557

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+D P FVWTL
Sbjct  558  RTVAGPREDMPDFVWTL  574



>ref|NP_001267546.1| protein TRANSPORT INHIBITOR RESPONSE 1-like [Cucumis sativus]
 gb|AGA63733.1| transport inhibitor response 1 [Cucumis sativus]
 gb|AGI15227.1| transport inhibitor response protein [Cucumis sativus]
 gb|KGN44877.1| hypothetical protein Csa_7G393970 [Cucumis sativus]
Length=584

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC L P  PD VT Q LD GFGAIV+ CK L+R S+ 
Sbjct  380  CRQMTNAALVTIARNRPNMTRFRLCILEPWTPDYVTGQALDVGFGAIVEYCKDLQRFSLS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG Y ++LEMLS+AFAG+SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRCFEYIGTYGKKLEMLSVAFAGESDLGLHHVLSGCDSLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+LA+K P+LNVE+I+E +   T   +   VE++Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSFGACKLLAQKFPQLNVEVIDERDPPNT-RPESCPVERLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AG R D PGFVWT+
Sbjct  559  RSVAGRRLDMPGFVWTM  575



>ref|XP_008451438.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Cucumis melo]
Length=584

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC L P  PD +T QPLD GFGAIV+ CK L+R S+ 
Sbjct  380  CRQMTNAALVTIARNRPNMTRFRLCILEPRTPDYLTDQPLDVGFGAIVEYCKDLQRFSLS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG Y ++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  440  GLLTDRCFEYIGTYGKKLEMLSVAFAGDSDLGLHHVLSGCDSLRKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+LA+K P+LNVE+I+E     T   +   VE++Y+Y
Sbjct  500  NAAKLETMRSLWMSSCSVSFGACKLLAQKFPQLNVEVIDERGPPNT-RPESCPVERLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AG R D PGFVWT+
Sbjct  559  RSVAGRRLDMPGFVWTM  575



>gb|EYU43421.1| hypothetical protein MIMGU_mgv1a003323mg [Erythranthe guttata]
Length=592

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAA+IA  KNCPNF  FRLC +NP  PD +T  P+D  F A+V++C  L+RLSV 
Sbjct  401  CRRMTNAAVIAAVKNCPNFTHFRLCIMNPGQPDHLTKSPMDAAFAAVVKTCPKLRRLSVS  460

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F  IG YA+ LE LS+AFAG SDK M+ VL GC KL+KL IRD PFGNAALL+
Sbjct  461  GLLTDKTFESIGEYAKNLETLSVAFAGSSDKAMVCVLRGCPKLRKLEIRDCPFGNAALLS  520

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE MRSLWMS+ +VT+  C++LA++MPRLNVE+I +        DDG K  K+Y+Y
Sbjct  521  GVEKYEMMRSLWMSACDVTMKGCRMLAREMPRLNVEVIEDE-----GSDDGAKAGKVYVY  575

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAP FV TL
Sbjct  576  RTVAGPRRDAPPFVLTL  592



>emb|CAN73714.1| hypothetical protein VITISV_038840 [Vitis vinifera]
Length=581

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N AL  +A+N PN  RFRLC +    PD +T +PLD GFGAIV+ CK LKRLS+ 
Sbjct  377  CRRMSNVALSTIARNRPNLTRFRLCIIERFRPDYITQEPLDVGFGAIVEHCKDLKRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG + ++LEMLS+AFAG SD G+ +VL+GCK L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGSHGKKLEMLSLAFAGDSDLGLHHVLSGCKSLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMS+ +V+  ACK+L +KMPRLNVE+I E    ++S D+   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSACQVSYRACKLLGQKMPRLNVEVIAEQGHPDSSPDE-YPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D P FVWT+
Sbjct  556  RTVSGPRSDMPSFVWTM  572



>ref|XP_002272850.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Vitis vinifera]
Length=581

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N AL  +A+N PN  RFRLC +    PD +T +PLD GFGAIV+ CK LKRLS+ 
Sbjct  377  CRRMSNVALSTIARNRPNLTRFRLCIIERFRPDYITQEPLDVGFGAIVEHCKDLKRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG + ++LEMLS+AFAG SD G+ +VL+GCK L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGSHGKKLEMLSLAFAGDSDLGLHHVLSGCKSLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMS+ +V+  ACK+L +KMPRLNVE+I E    ++S D+   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSACQVSYRACKLLGQKMPRLNVEVIAEQGHPDSSPDE-YPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++GPR D P FVWT+
Sbjct  556  RTVSGPRSDMPSFVWTM  572



>emb|CDO99639.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 148/197 (75%), Gaps = 7/197 (4%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQQM NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  399  CQQMTNAAVATIVQNCPDFTHFRLCIMNPGQPDYLTDEPMDEAFGAVVKTCTKLQRLAVS  458

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG+SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  459  GLLTDLTFEYIGKYAKNLETLSVAFAGRSDWGMQCVLGGCPKLRKLEIRDCPFGNAALLS  518

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+  C++LAK+MPRLNVE++ + E       D   V+K+Y+Y
Sbjct  519  GLKKYESMRSLWMSACNVTMNGCRLLAKEMPRLNVEVMKDEE-------DDSHVDKVYVY  571

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  572  RSVAGPRRDAPPFVLTL  588



>ref|XP_008800392.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Phoenix 
dactylifera]
Length=590

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  V +NCPNF  FRLC +N   PD +T +P+DE FG++V++C  L+RL+V 
Sbjct  400  CRQMTNAAVATVVRNCPNFTHFRLCIMNMCQPDYLTNEPMDEAFGSVVKTCSKLQRLAVS  459

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG YA+ LE LS+AFAG SD+GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  460  GLLTDRAFEYIGTYAKNLETLSVAFAGSSDRGMQCVLEGCPKLRKLEIRDCPFGNAALLS  519

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMS+  +T+  C++LA+KMPRLNVE+I E E       D    EK+Y+Y
Sbjct  520  GLERYESMRSLWMSACNLTMNGCQLLARKMPRLNVEVIKEDES------DDMHAEKVYVY  573

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  574  RSVAGPRRDAPPFVLTL  590



>ref|XP_010905566.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Elaeis 
guineensis]
 ref|XP_010905567.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Elaeis 
guineensis]
 ref|XP_010905568.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Elaeis 
guineensis]
Length=589

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAA+  V +NCPNF  FRLC ++   PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  399  CHQMTNAAVATVVRNCPNFTHFRLCIMDMRRPDYLTNEPMDEAFGAVVKTCSKLRRLAVS  458

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG YA+ LE LS+AFAG SD+GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  459  GLLTDRAFEYIGTYAKNLETLSVAFAGSSDRGMQCVLEGCPKLRKLEIRDCPFGNAALLS  518

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMS+  +T+  C++LA+KMPRLNVE+I E E       D    EK+Y+Y
Sbjct  519  GLERYESMRSLWMSACNLTMNGCQLLARKMPRLNVEVIKEDES------DDMHAEKVYVY  572

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  573  RSVAGPRRDAPPFVLTL  589



>dbj|BAD94031.1| transport inhibitor response 1 [Arabidopsis thaliana]
Length=226

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  13   CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  72

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IR+ PFG+ ALLA
Sbjct  73   GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRECPFGDKALLA  132

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  133  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  191

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR   PGFVW +
Sbjct  192  RTVAGPRFGMPGFVWNM  208



>ref|XP_009603009.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009603010.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009603011.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
tomentosiformis]
Length=584

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 146/197 (74%), Gaps = 7/197 (4%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  395  CRQMTNAAVATIVRNCPDFTHFRLCIMNPGQPDYLTNEPMDEAFGAVVKTCTKLQRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQ F YIG YA+ LE LS+AFAG SD GM  VL+GC KL+KL IRD PFGNAALL+
Sbjct  455  GLLTDQTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLDGCSKLRKLEIRDCPFGNAALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MR LWMS+  VT+  C++LAK+MPRLNVE+I +        D     +K+Y+Y
Sbjct  515  GLDKYESMRCLWMSACNVTMNGCRLLAKEMPRLNVEVIKD-------EDSDDYADKVYVY  567

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  568  RSVAGPRRDAPPFVKTL  584



>ref|XP_009122075.1| PREDICTED: GRR1-like protein 1 [Brassica rapa]
Length=585

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C Q  NAAL+++AKN PNF  FRLC + P  PD  T QPLDEGF AIV+ CK L+RLSV 
Sbjct  377  CVQFTNAALVSIAKNRPNFRCFRLCVMEPFAPDYRTQQPLDEGFKAIVEKCKDLRRLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG++A++L MLSIAFAG SD  + ++L+GC+ LKKL IRD PFG+ ALL 
Sbjct  437  GLLTDKAFEYIGVHAKKLRMLSIAFAGDSDLMLHHLLSGCQSLKKLEIRDCPFGDTALLE  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK L++KMPRLNVE+I+  E    +  D   VE++Y+Y
Sbjct  497  NAAKLETMRSLWMSSCFVSFGACKQLSQKMPRLNVEVID--EHPPKTRPDSSPVERIYIY  554

Query  217  RTLAGPRKDAPGFVWTL*MCP  155
            RT+AGPR D P FVWT+   P
Sbjct  555  RTVAGPRLDTPEFVWTIHKSP  575



>ref|XP_009763253.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
sylvestris]
 ref|XP_009763254.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
sylvestris]
 ref|XP_009763255.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
sylvestris]
 ref|XP_009763257.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
sylvestris]
Length=584

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 146/197 (74%), Gaps = 7/197 (4%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  395  CRQMTNAAVATIVRNCPDFTHFRLCIMNPGQPDYLTNEPMDEAFGAVVKTCTKLQRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQ F YIG YA+ LE LS+AFAG SD GM  VL+GC KL+KL IRD PFGNAALL+
Sbjct  455  GLLTDQTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLDGCSKLRKLEIRDCPFGNAALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MR LWMS+  VT+  C++LAK+MPRLNVE+I +        D     +K+Y+Y
Sbjct  515  GLDKYESMRCLWMSACNVTMNGCRLLAKEMPRLNVEVIKD-------EDSDDYADKVYVY  567

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  568  RSVAGPRRDAPPFVKTL  584



>ref|XP_008656496.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Zea mays]
 gb|AFW82629.1| hypothetical protein ZEAMMB73_053611 [Zea mays]
Length=590

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC + P  PD +T QPLD GF AIV+SCKGL+RLSV 
Sbjct  392  CRRMTNEALITIAKNRPNFTCFRLCIIEPHTPDYITHQPLDAGFSAIVESCKGLRRLSVS  451

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  452  GLLTDSVFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  511

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMS+  +TLGAC+ LA+KMPRL+VE++N+  +     S  D   VE +Y
Sbjct  512  NAAKLETMRSLWMSTCSMTLGACRQLARKMPRLSVEVMNDPRRGFPLDSLTDESPVETLY  571

Query  223  LYRTLAGPRKDAPGFVWTL  167
            +YRT++GPR D P  V  L
Sbjct  572  VYRTISGPRSDTPACVQIL  590



>ref|XP_010268854.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Nelumbo nucifera]
 ref|XP_010268855.1| PREDICTED: protein AUXIN SIGNALING F-BOX 3-like [Nelumbo nucifera]
Length=584

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAA+  V KNCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  394  CRRMTNAAVATVVKNCPDFTHFRLCIMNPWEPDYLTKEPVDEAFGAVVKTCPKLQRLAVS  453

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD+GM YVL GC KL+KL IRD PFGNAALL 
Sbjct  454  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDRGMQYVLGGCPKLRKLEIRDCPFGNAALLT  513

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMS+  VT+  C+ LA++MPRLNVE+I E    E   D      K+Y+Y
Sbjct  514  GLERYESMRSLWMSACHVTMNGCRQLAREMPRLNVEVIKEDGSDENHAD------KVYVY  567

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  568  RSVAGPRRDAPPFVLTL  584



>ref|XP_010545045.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X2 [Tarenaya hassleriana]
Length=442

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI +A+N PN  RFRLC + P  PD +T+QPLD GFGAI + CK L+RLS+ 
Sbjct  233  CHQMTNAALITIARNRPNLTRFRLCIIEPKTPDYMTLQPLDVGFGAIAEHCKELRRLSLS  292

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+  LLA
Sbjct  293  GLLTDKVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDSLRKLEIRDCPFGDKVLLA  352

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L  KMPRLNVE+I+E    + S  D   VE++Y+Y
Sbjct  353  NAPKLETMRSLWMSSCSVSFGACKLLGLKMPRLNVEVIDERGPPD-SRPDSCPVERVYIY  411

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  412  RTVAGPRFDMPGFVWNM  428



>emb|CDY21947.1| BnaC09g00530D [Brassica napus]
Length=626

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C Q  NAAL+++AKN PNF  FRLC + P  PD  T QPLDEGF AIV+ CK L+RLSV 
Sbjct  418  CVQFTNAALVSIAKNRPNFRCFRLCVMEPFAPDYRTQQPLDEGFKAIVERCKDLRRLSVS  477

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG++A++L MLSIAFAG SD  + ++L+GC+ LKKL IRD PFG+ ALL 
Sbjct  478  GLLTDKAFEYIGVHAKKLRMLSIAFAGDSDLMLHHLLSGCQSLKKLEIRDCPFGDTALLE  537

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK L++KMPRLNVE+I+  E    +  D   VE++Y+Y
Sbjct  538  NAAKLETMRSLWMSSCFVSFGACKQLSQKMPRLNVEVID--EHPPKTRPDSSPVERIYIY  595

Query  217  RTLAGPRKDAPGFVWTL*MCP  155
            RT+AGPR D P FVWT+   P
Sbjct  596  RTVAGPRLDTPEFVWTIHKSP  616



>sp|Q0DKP3.2|TIR1A_ORYSJ RecName: Full=Transport inhibitor response 1-like protein Os05g0150500; 
Short=TIR1-like protein [Oryza sativa Japonica Group]
 gb|ABY87942.1| transport inhibitor response 1 [Oryza sativa Indica Group]
 gb|EEC78531.1| hypothetical protein OsI_18478 [Oryza sativa Indica Group]
Length=587

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC L P  PD +T +PLD GF AIV+SC+GL+RLS+ 
Sbjct  389  CRRMTNEALITIAKNRPNFTCFRLCILEPHTPDYITREPLDAGFSAIVESCRGLRRLSIS  448

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  449  GLLTDLVFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  508

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL+VEI+N+  ++    S  D   VEK+Y
Sbjct  509  NAAKLETMRSLWMSSCLLTLGACRQLARKMPRLSVEIMNDPGRSCPLDSLPDETPVEKLY  568

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P  V
Sbjct  569  VYRTIAGPRSDTPACV  584



>ref|XP_010052384.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Eucalyptus 
grandis]
 gb|KCW76344.1| hypothetical protein EUGRSUZ_D00716 [Eucalyptus grandis]
 gb|KCW76345.1| hypothetical protein EUGRSUZ_D00716 [Eucalyptus grandis]
Length=584

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 148/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FGA+V+ C  L+RL+V 
Sbjct  394  CRQMTNAAVATIVQNCPDFTHFRLCIMNPGQPDYLTNEPMDEAFGAVVKRCTKLQRLAVS  453

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTDQ F YIG YA+ LE LS+AFAG SD+GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  454  GLLTDQTFEYIGTYAKNLETLSVAFAGSSDRGMQCVLRGCPKLRKLEIRDCPFGNAALLS  513

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+ +VT+  C +LA++ PRLNVE++ + E +     DGQ   K+Y+Y
Sbjct  514  GLEKYESMRSLWMSACKVTMNGCAVLARERPRLNVEVMKDEESS-----DGQAY-KVYVY  567

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAP FV TL
Sbjct  568  RTVAGPRRDAPPFVLTL  584



>ref|XP_009375118.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Pyrus 
x bretschneideri]
Length=568

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAA+  VA+NCP+   FRLC + P  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  377  CWQMTNAAVATVAQNCPDITHFRLCIMTPAKPDHLTGEPMDEAFGAVVKTCTKLERLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD+GM YV+NGC KLKKL IRD PFG+AALL+
Sbjct  437  GLLTDLTFEYIGKYAKNLEYLSVAFAGDSDQGMQYVMNGCPKLKKLEIRDCPFGDAALLS  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LA K+PRLNVE++ + E  + S  D     K+Y+Y
Sbjct  497  GLEKYESMRSLWMSACLVTMNACRSLASKVPRLNVEVMKDDEIGDDSQAD-----KVYVY  551

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPRKDAP FV T 
Sbjct  552  RSIAGPRKDAPAFVLTF  568



>emb|CDY22108.1| BnaA09g01370D [Brassica napus]
Length=639

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C Q  NAAL+++AKN PNF  FRLC + P  PD  T QPLDEGF AIV+ CK L+RLSV 
Sbjct  431  CVQFTNAALVSIAKNRPNFRCFRLCVMEPFAPDYRTQQPLDEGFKAIVEKCKDLRRLSVS  490

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG++A++L MLSIAFAG SD  + ++L+GC+ LKKL IRD PFG+ ALL 
Sbjct  491  GLLTDKAFEYIGVHAKKLRMLSIAFAGDSDLMLHHLLSGCQSLKKLEIRDCPFGDTALLE  550

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK L++KMPRLNVE+I+  E    +  D   VE++Y+Y
Sbjct  551  NAAKLETMRSLWMSSCFVSFGACKQLSQKMPRLNVEVID--EHPPKTRPDSSPVERIYIY  608

Query  217  RTLAGPRKDAPGFVWTL*MCP  155
            RT+AGPR D P FVWT+   P
Sbjct  609  RTVAGPRLDTPEFVWTIHKSP  629



>gb|KDO75707.1| hypothetical protein CISIN_1g007916mg [Citrus sinensis]
 gb|KDO75708.1| hypothetical protein CISIN_1g007916mg [Citrus sinensis]
 gb|KDO75709.1| hypothetical protein CISIN_1g007916mg [Citrus sinensis]
Length=585

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCPNF  FRLC + P +PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  395  CRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG+SD+GM  VL GC KL+KL IRD PFGN ALL+
Sbjct  455  GLLTDLTFEYIGKYAKNLETLSVAFAGRSDRGMQCVLEGCPKLRKLEIRDCPFGNEALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE++ E        DD Q  +K+Y+Y
Sbjct  515  GLEKYESMRSLWMSACNVTMNACRRLAKQMPRLNVEVMKED-----GSDDSQ-ADKVYIY  568

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAP  V TL
Sbjct  569  RTVAGPRRDAPPSVLTL  585



>ref|XP_006467903.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Citrus 
sinensis]
Length=585

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCPNF  FRLC + P +PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  395  CRQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG+SD+GM  VL GC KL+KL IRD PFGN ALL+
Sbjct  455  GLLTDLTFEYIGKYAKNLETLSVAFAGRSDRGMQCVLEGCPKLRKLEIRDCPFGNEALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE++ E        DD Q  +K+Y+Y
Sbjct  515  GLEKYESMRSLWMSACNVTMNACRRLAKQMPRLNVEVMKED-----GSDDSQ-ADKVYIY  568

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAP  V TL
Sbjct  569  RTVAGPRRDAPPSVLTL  585



>ref|XP_009587288.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
tomentosiformis]
Length=581

 Score =   244 bits (624),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN IRFRLC + P  PD +T+ PLD GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMTNAALVTIARNRPNMIRFRLCIIEPRCPDYLTLGPLDAGFGAIVENCKELRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTHAKKLEMLSIAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+LA+K+PRLNVE+I+E    +T   +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFGACKLLAQKIPRLNVEVIDERGPPDT-RPESCPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFVWT+
Sbjct  556  RSVAGPRFDKPGFVWTM  572



>ref|XP_006290791.1| hypothetical protein CARUB_v10016894mg [Capsella rubella]
 gb|EOA23689.1| hypothetical protein CARUB_v10016894mg [Capsella rubella]
Length=437

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  224  CRQMTNAALVTIARNRPNMTRFRLCIIEPKAPDYLTLEPLDVGFGAIVEHCKDLRRLSLS  283

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  284  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  343

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E    + S  +   VE++++Y
Sbjct  344  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGSPD-SRPESCPVERVFIY  402

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  403  RTVAGPRFDMPGFVWNM  419



>ref|XP_002440601.1| hypothetical protein SORBIDRAFT_09g003870 [Sorghum bicolor]
 gb|EES19031.1| hypothetical protein SORBIDRAFT_09g003870 [Sorghum bicolor]
Length=591

 Score =   244 bits (623),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 145/196 (74%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N ALI +AKN PNF  FRLC + P  PD  T QPLD GF AIV+SCKGL+RLSV 
Sbjct  393  CRRMTNEALITIAKNRPNFTCFRLCIIEPHTPDYTTHQPLDAGFSAIVESCKGLRRLSVS  452

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD +F  IG +A++LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFG+  LLA
Sbjct  453  GLLTDSLFKSIGAHADRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGDKPLLA  512

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMS+  +TLGAC+ LA+KMPRL+VE++N+  +     S  D   VE +Y
Sbjct  513  NAAKLETMRSLWMSTCSLTLGACRQLARKMPRLSVEVMNDPRRGCPLDSLTDESPVETLY  572

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P  V
Sbjct  573  VYRTIAGPRSDTPACV  588



>ref|XP_010277925.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nelumbo 
nucifera]
Length=583

 Score =   244 bits (623),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M N+A+ AV KNCP+F  FRLC +NP  PD +T +P+DE FG +V++C  L+RL+V 
Sbjct  393  CRRMTNSAVAAVVKNCPDFTHFRLCIMNPWEPDYLTKEPMDEAFGVVVKTCTKLQRLAVS  452

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD+GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  453  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDRGMQCVLAGCPKLRKLEIRDCPFGNAALLS  512

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMS+  VT+  C++LA++MPRLNVE+I E         D    EK+Y+Y
Sbjct  513  GLERYESMRSLWMSACHVTMNGCRLLAREMPRLNVEVIKE------DGSDDTHAEKVYVY  566

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  567  RSVAGPRRDAPPFVLTL  583



>emb|CBI23303.3| unnamed protein product [Vitis vinifera]
Length=553

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + KNCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  363  CRQMTNAAVATIVKNCPDFTHFRLCVMNPGEPDYLTDEPMDEAFGAVVKNCTKLQRLAVS  422

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL+GC KL+KL IRD PFGN ALL+
Sbjct  423  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLSGCSKLRKLEIRDCPFGNEALLS  482

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE++ + E      DD Q  +K+Y+Y
Sbjct  483  GLEKYESMRSLWMSACNVTMNACRRLAKQMPRLNVEVMKDEES-----DDSQ-ADKVYVY  536

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  537  RSVAGPRRDAPPFVLTL  553



>ref|XP_009788922.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nicotiana 
sylvestris]
Length=581

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 156/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN IRFRLC + P  PD +T+ PLD GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMTNAALVTIARNRPNMIRFRLCIIEPRSPDYLTLGPLDTGFGAIVENCKELRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFEYIGTHAKKLEMLSIAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+LA+K+PRLNVE+I+E    +T   +   VEK+Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSFGACKLLAQKIPRLNVEVIDERGPPDT-RPESCPVEKLYIY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  556  RTVAGPRFDTPGFVWRM  572



>gb|KJB41985.1| hypothetical protein B456_007G131300 [Gossypium raimondii]
Length=585

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAAL+ +A+NCPN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  382  CRRMSNAALVTIAQNCPNLTRFRLCIIEPKTPDYLTLEPLDAGFGAIVEHCKDLRRLSLS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF YIG Y ++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  442  GLLTDHVFEYIGTYGKKLEMLSVAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E+E  + S  +   V+K+Y+Y
Sbjct  502  NAAKLETMRSLWMSSCAVSFGACKLLGQKMPKLNVEVIDETEPPD-SRPESYPVDKLYIY  560

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D P FVW++
Sbjct  561  RSVAGPRFDMPPFVWSM  577



>ref|XP_002271412.2| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Vitis vinifera]
Length=583

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + KNCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  393  CRQMTNAAVATIVKNCPDFTHFRLCVMNPGEPDYLTDEPMDEAFGAVVKNCTKLQRLAVS  452

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL+GC KL+KL IRD PFGN ALL+
Sbjct  453  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLSGCSKLRKLEIRDCPFGNEALLS  512

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE++ + E      DD Q  +K+Y+Y
Sbjct  513  GLEKYESMRSLWMSACNVTMNACRRLAKQMPRLNVEVMKDEES-----DDSQ-ADKVYVY  566

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  567  RSVAGPRRDAPPFVLTL  583



>ref|XP_010904761.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Elaeis guineensis]
 ref|XP_010904762.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Elaeis guineensis]
 ref|XP_010904763.1| PREDICTED: transport inhibitor response 1-like protein Os05g0150500 
[Elaeis guineensis]
Length=580

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 150/199 (75%), Gaps = 2/199 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N AL AVA++ PN   FRLC ++P  PD VT++PLD GF AIV+SCK L+RLSV 
Sbjct  382  CRQMTNDALFAVARSSPNLTCFRLCIIDPHTPDYVTLEPLDAGFSAIVESCKDLRRLSVS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLT+ VF  IG  A+ LEMLSIAFAG SD G+ Y+L+GCK L+KL IRD PFG+ ALLA
Sbjct  442  GLLTNNVFRSIGASADCLEMLSIAFAGDSDAGLHYILSGCKSLRKLEIRDCPFGDKALLA  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAET--SHDDGQKVEKMY  224
            +  K ETMRSLWMSS  V+LGAC++LA+KMP LNVE+++E ++  +  S  D   VEK+Y
Sbjct  502  NAAKLETMRSLWMSSCFVSLGACRLLAQKMPLLNVEVMDEKKRGGSWDSQPDDCLVEKLY  561

Query  223  LYRTLAGPRKDAPGFVWTL  167
            +YRT+AG R D P  VWT+
Sbjct  562  VYRTVAGQRSDTPPCVWTV  580



>ref|XP_011033611.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1 [Populus euphratica]
Length=584

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +AKNCP+   FRLC + P  PD  T++PLD GFGAIV++CK L+RLS+ 
Sbjct  380  CRQMTNAALVTIAKNCPSMTCFRLCIIEPRAPDYQTLRPLDLGFGAIVENCKDLRRLSLS  439

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +VL+GC+KL KL IRD PFG+ ALLA
Sbjct  440  GLLTDRVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCEKLCKLEIRDCPFGDKALLA  499

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    E S  +   VEK+Y+Y
Sbjct  500  NAAKLETMRSLWMSSCCVSFGACKLLGQKMPRLNVEVIDERGPPE-SRPESCPVEKLYIY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  559  RTIAGPRFDMPGFVWTM  575



>ref|XP_006449208.1| hypothetical protein CICLE_v10014716mg [Citrus clementina]
 gb|ESR62448.1| hypothetical protein CICLE_v10014716mg [Citrus clementina]
Length=585

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAA+  + +NCPNF  FRLC + P +PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  395  CWQMTNAAVATIVQNCPNFTHFRLCIMTPGLPDYLTNEPMDEAFGAVVKTCSKLQRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG+SD+GM  VL GC KL+KL IRD PFGN ALL+
Sbjct  455  GLLTDLTFEYIGKYAKNLETLSVAFAGRSDRGMQCVLEGCPKLRKLEIRDCPFGNEALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE++ E        DD Q  +K+Y+Y
Sbjct  515  GLEKYESMRSLWMSACNVTMNACRRLAKQMPRLNVEVMKED-----GSDDSQ-ADKVYIY  568

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAP  V TL
Sbjct  569  RTVAGPRRDAPPSVLTL  585



>gb|ACV87282.1| TIR1/AFB auxin receptor protein PintaAFB6 [Pinus taeda]
Length=575

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+I VA+NCP    FRLC +NP  PD +T +P+DE FGAIV+ CKGL+RL++ 
Sbjct  385  CRQMTNAAIIEVAQNCPRLTHFRLCIMNPCQPDHLTDEPMDEAFGAIVKICKGLQRLAIS  444

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG+YA+ LE LS+AFAG SD GM  VL GC KL+KL IRDSPFGNAALL+
Sbjct  445  GLLTDKAFEYIGLYAKNLETLSVAFAGSSDLGMECVLRGCPKLRKLEIRDSPFGNAALLS  504

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMSS +VT+  C+ LA+  PRLNVEII E+++ +         +K+Y+Y
Sbjct  505  GLEQYESMRSLWMSSCKVTMSGCRYLAQNKPRLNVEIIKENDEDDND------ADKLYVY  558

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR+DAP FV TL
Sbjct  559  RTIAGPRRDAPNFVLTL  575



>emb|CAN66468.1| hypothetical protein VITISV_016565 [Vitis vinifera]
Length=620

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 148/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + KNCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  430  CRQMTNAAVATIVKNCPDFTHFRLCVMNPGEPDYLTDEPMDEAFGAVVKNCTKLQRLAVS  489

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL+GC KL+KL IRD PFGN ALL+
Sbjct  490  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLSGCSKLRKLEIRDCPFGNEALLS  549

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE++ + E      DD Q  +K+Y+Y
Sbjct  550  GLEKYESMRSLWMSACNVTMNACRRLAKQMPRLNVEVMKDEES-----DDSQ-ADKVYVY  603

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  604  RSVAGPRRDAPPFVLTL  620



>ref|XP_006449206.1| hypothetical protein CICLE_v10014739mg [Citrus clementina]
 gb|ESR62446.1| hypothetical protein CICLE_v10014739mg [Citrus clementina]
Length=579

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQ M NAA+  + +NCPNF  FRLC +NP  PD VT +P+DE FGA+V++C  L+RLS+ 
Sbjct  389  CQAMTNAAVATIVRNCPNFTCFRLCIMNPGQPDYVTNEPMDEAFGAVVKTCTNLQRLSLS  448

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            G LTD  F YIG YA+ LE+LS+AFAG SD GM  VL GC KL+K  IRD PFG+AALL+
Sbjct  449  GFLTDLTFEYIGQYAKNLELLSVAFAGSSDWGMQCVLRGCPKLRKFEIRDCPFGDAALLS  508

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+  CK+LA K PRLNVE+I E+E      DD Q  +K+Y+Y
Sbjct  509  GLDKYESMRSLWMSACNVTMDGCKLLASKKPRLNVEVIKEAES-----DDNQ-ADKVYVY  562

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPRKDAP  V TL
Sbjct  563  RTVAGPRKDAPPSVITL  579



>dbj|BAJ87145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI +AKN PNF  FRLC L P  PD VT Q LD GF AIV+SCKGL+RLSV 
Sbjct  395  CGQMTNEALITIAKNRPNFTCFRLCILEPRTPDYVTRQSLDAGFSAIVESCKGLRRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG    +LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFGN  LLA
Sbjct  455  GLLTDLVFKSIGANGNRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGNKPLLA  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL VEI+N+  +     S  D   VE +Y
Sbjct  515  NAAKLETMRSLWMSSCSLTLGACRQLAEKMPRLTVEIMNDPGRTCPVESLPDDSPVETLY  574

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P +V
Sbjct  575  VYRTIAGPRSDTPDYV  590



>dbj|BAK05356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI +AKN PNF  FRLC L P  PD VT Q LD GF AIV+SCKGL+RLSV 
Sbjct  395  CGQMTNEALITIAKNRPNFTCFRLCILEPRTPDYVTRQSLDAGFSAIVESCKGLRRLSVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG    +LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFGN  LLA
Sbjct  455  GLLTDLVFKSIGANGNRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGNKPLLA  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA--ETSHDDGQKVEKMY  224
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL VEI+N+  +     S  D   VE +Y
Sbjct  515  NAAKLETMRSLWMSSCSLTLGACRQLAEKMPRLTVEIMNDPGRTCPVESLPDDSPVETLY  574

Query  223  LYRTLAGPRKDAPGFV  176
            +YRT+AGPR D P +V
Sbjct  575  VYRTIAGPRSDTPDYV  590



>ref|XP_012091485.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Jatropha curcas]
 gb|KDP20879.1| hypothetical protein JCGZ_21350 [Jatropha curcas]
Length=603

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCPNF  FRLC +NP  PD  T +P+DE FGA+V++C  L+RLSV 
Sbjct  396  CRQMTNAAVATIVQNCPNFTHFRLCIMNPGQPDYTTNEPMDEAFGAVVKTCNKLQRLSVS  455

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  456  GLLTDLTFEYIGRYAKNLETLSVAFAGSSDWGMQCVLGGCPKLRKLEIRDCPFGNAALLS  515

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMSS +VT+  C++LA++MPRLNVE++ E         D  + +K+Y+Y
Sbjct  516  GLEKYESMRSLWMSSCKVTMNGCRLLAREMPRLNVEVMKE------EWSDDSQADKVYVY  569

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP  V TL
Sbjct  570  RSVAGPRRDAPPSVLTL  586



>ref|XP_012091486.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X2 [Jatropha curcas]
Length=589

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCPNF  FRLC +NP  PD  T +P+DE FGA+V++C  L+RLSV 
Sbjct  396  CRQMTNAAVATIVQNCPNFTHFRLCIMNPGQPDYTTNEPMDEAFGAVVKTCNKLQRLSVS  455

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  456  GLLTDLTFEYIGRYAKNLETLSVAFAGSSDWGMQCVLGGCPKLRKLEIRDCPFGNAALLS  515

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMSS +VT+  C++LA++MPRLNVE++ E         D  + +K+Y+Y
Sbjct  516  GLEKYESMRSLWMSSCKVTMNGCRLLAREMPRLNVEVMKE------EWSDDSQADKVYVY  569

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP  V TL
Sbjct  570  RSVAGPRRDAPPSVLTL  586



>ref|XP_010087910.1| hypothetical protein L484_002775 [Morus notabilis]
 gb|EXB30584.1| hypothetical protein L484_002775 [Morus notabilis]
Length=576

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + KNCP+F  FRLC ++P  PD +T +P+DE FGA+V++C  L+RL+V 
Sbjct  386  CRQMTNAAVATIVKNCPDFTHFRLCIMDPGQPDYLTNEPMDEAFGAVVKTCTQLQRLAVS  445

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VLNGC KL+KL IRD PFGN ALL+
Sbjct  446  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLNGCPKLRKLEIRDCPFGNVALLS  505

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+  C++LA++MPRLNVE+I E    E S D   +  K+Y+Y
Sbjct  506  GLEKYESMRSLWMSACNVTMNGCRLLAREMPRLNVEVIKE----EGSED--SQANKVYVY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  560  RSVAGPRRDAPPFVLTL  576



>ref|XP_010245369.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Nelumbo 
nucifera]
Length=582

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL  +A+N PN  RFRLC + P  PD +T+QPLD GFGAIV+ CK L+RLS+ 
Sbjct  377  CRQMTNAALFTIARNRPNMTRFRLCIIEPRTPDYLTLQPLDAGFGAIVEHCKDLRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF YIG +A++LEMLS+AFAG+SD G+ +VL+GCK L+KL IRD PFG+ AL  
Sbjct  437  GLLTDLVFEYIGTHAQKLEMLSVAFAGESDLGLHHVLSGCKSLRKLEIRDCPFGDKALFV  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    +    + + +E++Y+Y
Sbjct  497  NASKLETMRSLWMSSCSVSFGACKLLGQKMPRLNVEVIDERAPPDL-RPESEPIERLYVY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVWT+
Sbjct  556  RTIAGPRLDMPGFVWTM  572



>gb|KHG14995.1| transport inhibitor response 1 -like protein [Gossypium arboreum]
Length=587

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 148/196 (76%), Gaps = 1/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAAL+ +A+N PN  RFRLC + P   D +T +P D GFGAIV+ CK L RLS+ 
Sbjct  382  CRRMSNAALVTIAQNRPNLTRFRLCIIEPNTTDYLTGEPFDVGFGAIVEHCKDLIRLSLS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF YIG YA++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALL 
Sbjct  442  GLLTDCVFEYIGKYAKKLEMLSVAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLT  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GAC++L++KMPRLNVE+I+E    + S  +   V+K+Y+Y
Sbjct  502  NAAKLETMRSLWMSSCSVSFGACQLLSQKMPRLNVEVIDERGPPD-SRPENCTVDKLYIY  560

Query  217  RTLAGPRKDAPGFVWT  170
            R++AGPR D P FVWT
Sbjct  561  RSVAGPRFDMPPFVWT  576



>ref|XP_002305651.1| hypothetical protein POPTR_0004s03400g [Populus trichocarpa]
 gb|EEE86162.1| hypothetical protein POPTR_0004s03400g [Populus trichocarpa]
Length=579

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  386  CRQMTNAAVATIVQNCPDFTHFRLCIMNPGQPDYLTNEPMDEAFGAVVRTCTKLQRLSVS  445

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD+GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  446  GLLTDLTFEYIGQYAKNLETLSVAFAGSSDRGMQCVLEGCPKLRKLEIRDCPFGNAALLS  505

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+  C++LA++MPRLNVE++ E        DD Q  +K+Y+Y
Sbjct  506  GLEKYESMRSLWMSACNVTMNGCRLLAREMPRLNVEVMKED-----GSDDSQ-ADKVYVY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP  V TL
Sbjct  560  RSVAGPRRDAPPCVLTL  576



>ref|XP_007025805.1| F-box/RNI-like superfamily protein [Theobroma cacao]
 gb|EOY28427.1| F-box/RNI-like superfamily protein [Theobroma cacao]
Length=586

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC ++P  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  396  CRQMTNAAVATIVQNCPDFTHFRLCIMDPGQPDYLTNEPMDEAFGAVVKTCSKLQRLSVS  455

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  456  GLLTDLTFEYIGSYAKNLETLSVAFAGSSDWGMQCVLRGCPKLRKLEIRDCPFGNAALLS  515

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC++LAK+MPRLNVE++ E         DG + +K+Y+Y
Sbjct  516  GLEKYESMRSLWMSACNVTMNACRLLAKEMPRLNVEVMKE------DGSDGIQADKVYVY  569

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP  V TL
Sbjct  570  RSIAGPRRDAPPSVLTL  586



>ref|XP_011079740.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
Length=581

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+A+A+N P  IRFRLC L P VPD +T++PLD GFGAIV++CK L+RLS+ 
Sbjct  377  CRQMSNAALVAIARNRPKLIRFRLCILEPRVPDYLTLEPLDTGFGAIVENCKELRRLSLS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLSIAFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  437  GLLTDRVFKYIGTHAKKLEMLSIAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLA  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +K+PRLNVE+I+E    + S  +   VE++Y+Y
Sbjct  497  NAAKLETMRSLWMSSCSVSYGACKLLGQKLPRLNVEVIDERGPPD-SRPESCPVERLYVY  555

Query  217  RTLAGPRKDAPGFVWTL  167
            RT++G R D PGFVWT+
Sbjct  556  RTVSGRRVDMPGFVWTM  572



>ref|XP_004134961.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2 [Cucumis sativus]
 gb|KGN49186.1| hypothetical protein Csa_6G516940 [Cucumis sativus]
Length=584

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 148/200 (74%), Gaps = 12/200 (6%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N A+  + +NCP+F  FRLC +NP  PD +T QP+DE FGA+V++C  L+RL++ 
Sbjct  394  CHQMTNEAVATIVQNCPDFTHFRLCIMNPHQPDYLTKQPMDEAFGAVVKTCSKLRRLAIS  453

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG++D GM  V++GC KLKKL IRDSPFGNAALL+
Sbjct  454  GLLTDLTFEYIGKYAKNLETLSVAFAGRTDWGMQCVMSGCPKLKKLEIRDSPFGNAALLS  513

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQ---KVEKM  227
               +YE+MRSLWMS+ +VT+  C++LAK++PRLNVE+I          DDG    + E +
Sbjct  514  GLERYESMRSLWMSACKVTMNGCRVLAKQVPRLNVEVIK---------DDGNDECEAESV  564

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YR++AGPR+DAP FV TL
Sbjct  565  YVYRSVAGPRRDAPPFVLTL  584



>ref|XP_002524686.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
 gb|EEF37705.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
Length=589

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCPNF  FRLC +NP  PD  T +P+DE FGA+V++C  L+RLSV 
Sbjct  396  CRQMTNAAVATIVQNCPNFTHFRLCIMNPRQPDYTTNKPMDEAFGAVVKTCTKLQRLSVS  455

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  456  GLLTDLTFEYIGRYAKNLETLSVAFAGSSDWGMQCVLGGCPKLRKLEIRDCPFGNAALLS  515

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMSS  VT+  C++LA++MPRLNVE++ E        DD Q  +K+Y+Y
Sbjct  516  GLEKYESMRSLWMSSCNVTMNGCRLLAREMPRLNVEVMKED-----GSDDSQ-ADKVYVY  569

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP  V  L
Sbjct  570  RSVAGPRRDAPSTVLNL  586



>ref|XP_011096196.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011096197.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011096199.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
 ref|XP_011096200.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Sesamum 
indicum]
Length=588

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAA++ + +NCP+F  FRLC + P  PD +T +P+DE F A+V++C  LKRLSV 
Sbjct  398  CRRMTNAAVVTIVQNCPDFTHFRLCIMTPGQPDYLTNEPMDEAFAAVVKTCTKLKRLSVS  457

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  458  GLLTDLTFEYIGKYAKNLETLSVAFAGSSDWGMQCVLEGCPKLRKLEIRDCPFGNAALLS  517

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE MRSLWMSS  VT+  C++LA++MPRLNVE+I +       +DDGQ  +++Y+Y
Sbjct  518  GREKYEMMRSLWMSSCNVTMKGCRLLAREMPRLNVEVIKDE-----GNDDGQ-ADRVYVY  571

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  572  RSVAGPRRDAPPFVLTL  588



>ref|XP_002520681.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
 gb|EEF41643.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis]
Length=585

 Score =   241 bits (616),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N ALI +A+N PN  RFRLC + P +PD VT QPLD+GFGAIVQ CK L+RLS+ 
Sbjct  381  CRQMTNDALITIARNRPNMTRFRLCIIEPRMPDNVTHQPLDDGFGAIVQYCKDLRRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG +A++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDRVFEYIGTHAKKLEMLSVAFAGDSDLGLHHVLSGCENLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMPRLNVE+I+E    +T   +   VEK+Y+Y
Sbjct  501  NAAKLETMRSLWMSSCSVSYGACKLLGQKMPRLNVEVIDERGPPDT-RPESCPVEKLYIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D PGFV+T+
Sbjct  560  RSVAGPRFDMPGFVYTM  576



>ref|NP_567135.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana]
 sp|Q570C0.2|TIR1_ARATH RecName: Full=Protein TRANSPORT INHIBITOR RESPONSE 1; AltName: 
Full=Weak ethylene-insensitive protein 1 [Arabidopsis thaliana]
 pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure
 pdb|2P1N|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|E Chain E, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1P|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1Q|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|3C6N|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate 
Interactions In Auxin Perception And Signaling
 pdb|3C6P|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 gb|AAB69175.1| transport inhibitor response 1 [Arabidopsis thaliana]
 gb|AAB69176.1| transport inhibitor response 1 [Arabidopsis thaliana]
 emb|CAB87743.1| transport inhibitor response 1 (TIR1) [Arabidopsis thaliana]
 gb|AAN71945.1| putative transport inhibitor response TIR1, AtFBL1 protein [Arabidopsis 
thaliana]
 gb|AEE80419.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana]
Length=594

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E   A  S  +   VE++++Y
Sbjct  501  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDE-RGAPDSRPESCPVERVFIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>ref|XP_008224957.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Prunus 
mume]
Length=585

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  V KNCP+F  FRLC +NP  PD +T +P+DEGFGA+V++C  L+RL+V 
Sbjct  395  CRQMTNAAVATVVKNCPDFTHFRLCIMNPRQPDHITNEPMDEGFGAVVKTCTKLQRLAVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG YA+ LE LS+AFAGKSD GM  VLNGC KLKKL IRD PFGNAALL+
Sbjct  455  GLLTDRTFEYIGEYAKNLETLSVAFAGKSDWGMQCVLNGCPKLKKLEIRDCPFGNAALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC++LA +MPRLNVE++ +    +         +K+Y+Y
Sbjct  515  GFEKYESMRSLWMSACNVTMNACRLLASEMPRLNVEVMKDDGNDDDQ------ADKVYVY  568

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AG R+DAP FV T 
Sbjct  569  RSVAGSRRDAPPFVLTF  585



>gb|KJB22544.1| hypothetical protein B456_004G053500 [Gossypium raimondii]
 gb|KJB22545.1| hypothetical protein B456_004G053500 [Gossypium raimondii]
Length=587

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 147/196 (75%), Gaps = 1/196 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAAL+ +A+N PN  RFRLC + P   D +T +P D GFGAIV+ CK L RLS+ 
Sbjct  382  CRRMSNAALVTIAQNRPNLTRFRLCIIEPNTADYLTGEPFDVGFGAIVEHCKDLIRLSLS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF YIG YA++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+ ALL 
Sbjct  442  GLLTDCVFEYIGKYAKKLEMLSVAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKALLT  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+  ACK+L++KMPRLNVE+I+E    + S  +   V+K+Y+Y
Sbjct  502  NAAKLETMRSLWMSSCSVSFEACKLLSQKMPRLNVEVIDERGPPD-SRPENYTVDKLYIY  560

Query  217  RTLAGPRKDAPGFVWT  170
            R++AGPR D P FVWT
Sbjct  561  RSVAGPRFDMPPFVWT  576



>gb|EMS47226.1| hypothetical protein TRIUR3_32567 [Triticum urartu]
Length=541

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI +AKN PNF  FRLC L P  PD VT + LD GF AIV+SCKGL+RLSV 
Sbjct  343  CGQMTNEALITIAKNRPNFTCFRLCILEPRTPDYVTRESLDAGFSAIVESCKGLRRLSVS  402

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG     LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFGN  LLA
Sbjct  403  GLLTDLVFKSIGANGNCLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGNKPLLA  462

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQ---AETSHDDGQKVEKM  227
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL VEI+N+  +    E+  DD   VE +
Sbjct  463  NAAKLETMRSLWMSSCSLTLGACRQLAEKMPRLTVEIMNDPGRICPVESLPDD-SPVETL  521

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT+AGPR D P +V
Sbjct  522  YVYRTIAGPRSDTPDYV  538



>ref|XP_008439908.1| PREDICTED: protein AUXIN SIGNALING F-BOX 2-like [Cucumis melo]
Length=584

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 147/200 (74%), Gaps = 12/200 (6%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N A+  + +NCP+F  FRLC +NP  PD +T QP+DE FGA+V++C  L+RL++ 
Sbjct  394  CHQMTNEAVATIVQNCPDFTHFRLCIMNPHQPDYLTKQPMDEAFGAVVKTCSKLRRLAIS  453

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG +D GM  V++GC KLKKL IRDSPFGNAALL+
Sbjct  454  GLLTDLTFEYIGKYAKNLETLSVAFAGSTDWGMQCVMSGCPKLKKLEIRDSPFGNAALLS  513

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQ---KVEKM  227
               +YE+MRSLWMS+ +VT+  C++LAK++PRLNVE+I          DDG    + E +
Sbjct  514  GLERYESMRSLWMSACKVTMNGCRVLAKQVPRLNVEVIK---------DDGNDECEAESV  564

Query  226  YLYRTLAGPRKDAPGFVWTL  167
            Y+YR++AGPR+DAP FV TL
Sbjct  565  YVYRSVAGPRRDAPPFVVTL  584



>dbj|BAK06180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 143/197 (73%), Gaps = 4/197 (2%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM N ALI +AKN PNF  FRLC L P  PD VT Q LD GF AIV+SCKGL+RLSV 
Sbjct  533  CGQMTNEALITIAKNRPNFTCFRLCILEPRTPDYVTRQSLDAGFSAIVESCKGLRRLSVS  592

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD VF  IG    +LEMLSIAFAG SD G+ Y+L+GCK LKKL IRD PFGN  LLA
Sbjct  593  GLLTDLVFKSIGANGNRLEMLSIAFAGNSDLGLHYILSGCKSLKKLEIRDCPFGNKPLLA  652

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQA---ETSHDDGQKVEKM  227
            +  K ETMRSLWMSS  +TLGAC+ LA+KMPRL VEI+N+  +    E+  DD   VE +
Sbjct  653  NAAKLETMRSLWMSSCSLTLGACRQLAEKMPRLTVEIMNDPGRTCPVESLPDD-SPVETL  711

Query  226  YLYRTLAGPRKDAPGFV  176
            Y+YRT+AGPR D P +V
Sbjct  712  YVYRTIAGPRSDTPDYV  728



>gb|KHG00218.1| transport inhibitor response 1 -like protein [Gossypium arboreum]
Length=586

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+NCPNF RFRLC L+P + D  T+QPLD GFGAIV+ CK L+RLS+ 
Sbjct  382  CRQMSNAALVTIAQNCPNFTRFRLCLLDPKIADYRTLQPLDVGFGAIVEHCKDLRRLSLS  441

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIGM+A++LEMLS+AFAG+SD  + +VL+GC+ L+KL I + PFG+ ALLA
Sbjct  442  GLLTDRVFEYIGMHAKKLEMLSVAFAGESDLALHHVLSGCESLRKLEIMNCPFGDKALLA  501

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+LGACK+L +KMPRLN+E+++E    + S  +   V+K+Y+Y
Sbjct  502  NAAKLETMRSLWMSSCSVSLGACKMLGQKMPRLNIEVMDEKGPPD-SRAESDPVDKLYIY  560

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR D P FVWT+
Sbjct  561  RSVAGPRFDMPPFVWTM  577



>ref|XP_009116967.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Brassica 
rapa]
Length=595

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMTNAALVTIARNRPNMTRFRLCIIEPKAPDHMTLEPLDVGFGAIVEHCKDLRRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCESLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E    + S  +   VE++++Y
Sbjct  501  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGPPD-SRPESCPVERVFIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>ref|XP_010468900.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Camelina 
sativa]
Length=576

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAALI +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  376  CRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDVGFGAIVEHCKDLRRLSLS  435

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  436  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  495

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E    + S  +   VE++++Y
Sbjct  496  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGPPD-SRPESCPVERVFIY  554

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  555  RTVAGPRFDMPGFVWNM  571



>emb|CDY11468.1| BnaA09g40340D [Brassica napus]
Length=595

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMTNAALVTIARNRPNMTRFRLCIIEPKAPDHLTLEPLDVGFGAIVEHCKDLRRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC+ L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCESLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E    + S  +   VE++++Y
Sbjct  501  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGPPD-SRPESCPVERVFIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>ref|XP_007025803.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY28425.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao]
Length=586

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC ++P  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  396  CRQMTNAAVATIVQNCPDFTHFRLCIMDPGQPDYLTNEPMDEAFGAVVKTCTKLQRLSVS  455

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD GM  VL GC KL+KL IRD PFGNAALL+
Sbjct  456  GLLTDLTFEYIGRYAKNLETLSVAFAGSSDWGMQCVLTGCPKLRKLEIRDCPFGNAALLS  515

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+  C+ LA++MPRLNVE++ E         D  + +K+Y+Y
Sbjct  516  GLDKYESMRSLWMSACNVTMDGCRQLAREMPRLNVEVMKEDGS------DDSEADKVYVY  569

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPR+DAP FV TL
Sbjct  570  RSIAGPRRDAPPFVLTL  586



>ref|XP_010545044.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like isoform 
X1 [Tarenaya hassleriana]
Length=590

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI +A+N PN  RFRLC + P  PD +T+QPLD GFGAI + CK L+RLS+ 
Sbjct  381  CHQMTNAALITIARNRPNLTRFRLCIIEPKTPDYMTLQPLDVGFGAIAEHCKELRRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA++LEMLS+AFAG SD G+ +VL+GC  L+KL IRD PFG+  LLA
Sbjct  441  GLLTDKVFEYIGTYAKKLEMLSVAFAGDSDLGLHHVLSGCDSLRKLEIRDCPFGDKVLLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L  KMPRLNVE+I+E    + S  D   VE++Y+Y
Sbjct  501  NAPKLETMRSLWMSSCSVSFGACKLLGLKMPRLNVEVIDERGPPD-SRPDSCPVERVYIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>ref|XP_006467904.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Citrus 
sinensis]
 gb|KDO75706.1| hypothetical protein CISIN_1g008051mg [Citrus sinensis]
Length=579

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            CQ M NAA+  + +NCPNF  FRLC +NP  PD VT +P+DE FGA+V++C  L+RLS+ 
Sbjct  389  CQAMTNAAVATIVRNCPNFTCFRLCIMNPGQPDYVTNEPMDEAFGAVVRTCTNLQRLSLS  448

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE+LS+AFAG SD GM  VL GC KL+K  IRD PFG+AALL+
Sbjct  449  GLLTDLTFEYIGQYAKNLELLSVAFAGSSDWGMQCVLRGCPKLRKFEIRDCPFGDAALLS  508

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               K E+MRSLWMS+  VT+  CK+LA K PRLNVE+I E+E      DD Q  +K+Y+Y
Sbjct  509  GLDKCESMRSLWMSACNVTMDGCKLLASKKPRLNVEVIKEAES-----DDNQ-ADKVYVY  562

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPRKDAP  V TL
Sbjct  563  RTVAGPRKDAPPSVITL  579



>ref|XP_010686279.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Beta 
vulgaris subsp. vulgaris]
Length=583

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FG++V+SCK L+RL+V 
Sbjct  393  CREMTNAAVATIVQNCPDFTHFRLCIMNPGQPDHLTNEPMDEAFGSVVKSCKKLRRLAVS  452

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD  M  VL+GC KL++L IRD PFGN ALL+
Sbjct  453  GLLTDSTFEYIGKYAKNLETLSVAFAGSSDLAMKSVLSGCPKLRRLEIRDCPFGNFALLS  512

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               +YE+MRSLWMS+  VT+ AC+ LAK+MPRLNVE+I + +       D     K+Y+Y
Sbjct  513  GLERYESMRSLWMSACNVTMSACRQLAKEMPRLNVEVIKDEDT------DDCHANKVYVY  566

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPRKDAP FV TL
Sbjct  567  RTVAGPRKDAPPFVLTL  583



>ref|XP_008364135.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Malus 
domestica]
Length=568

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 143/197 (73%), Gaps = 5/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAA+  VA+NCP+   FRLC + P  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  377  CWQMTNAAVATVAQNCPDITHFRLCIMTPAKPDHLTGEPMDEAFGAVVKTCXKLERLSVS  436

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD+GM YV+NGC KLKKL IRD PFG  ALL+
Sbjct  437  GLLTDLTFEYIGKYAKNLEYLSVAFAGDSDQGMQYVMNGCPKLKKLEIRDCPFGXXALLS  496

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC+ LA K+ RLNVE++ + E  + S  D     K+Y+Y
Sbjct  497  GLEKYESMRSLWMSACXVTMNACRSLASKVRRLNVEVMKDDENGDDSQAD-----KVYVY  551

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AGPRKDAP FV T 
Sbjct  552  RSIAGPRKDAPAFVLTF  568



>ref|XP_006290792.1| hypothetical protein CARUB_v10016894mg [Capsella rubella]
 gb|EOA23690.1| hypothetical protein CARUB_v10016894mg [Capsella rubella]
Length=594

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAAL+ +A+N PN  RFRLC + P  PD +T++PLD GFGAIV+ CK L+RLS+ 
Sbjct  381  CRQMTNAALVTIARNRPNMTRFRLCIIEPKAPDYLTLEPLDVGFGAIVEHCKDLRRLSLS  440

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG YA+++EMLS+AFAG SD GM +VL+GC  L+KL IRD PFG+ ALLA
Sbjct  441  GLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLA  500

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+L +KMP+LNVE+I+E    + S  +   VE++++Y
Sbjct  501  NASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGSPD-SRPESCPVERVFIY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D PGFVW +
Sbjct  560  RTVAGPRFDMPGFVWNM  576



>ref|XP_007211398.1| hypothetical protein PRUPE_ppa003317mg [Prunus persica]
 gb|EMJ12597.1| hypothetical protein PRUPE_ppa003317mg [Prunus persica]
Length=585

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  V KNCP+F  FRLC +NP  PD ++ +P+DEGFGA+V++C  L+RL+V 
Sbjct  395  CRQMTNAAVATVVKNCPDFTHFRLCIMNPGQPDHISNEPMDEGFGAVVKTCTKLQRLAVS  454

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+ F YIG YA+ LE LS+AFAGKSD GM  VLNGC KLKKL IRD PFGNAALL+
Sbjct  455  GLLTDRTFEYIGEYAKNLETLSVAFAGKSDWGMQCVLNGCPKLKKLEIRDCPFGNAALLS  514

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+ AC++LA +MPRLNVE++ +    +         +K+Y+Y
Sbjct  515  GFEKYESMRSLWMSACNVTMNACRLLASEMPRLNVEVMKDDGNDDDQ------ADKVYVY  568

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AG R+DAP FV T 
Sbjct  569  RSVAGSRRDAPPFVLTF  585



>emb|CDP03546.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C++M NAAL+A+A++CPNFI FRLC + P  PD +T++P D GFGAIV+ CK L+RLS+ 
Sbjct  282  CRRMSNAALVAIARSCPNFICFRLCIIEPRTPDYLTLEPFDTGFGAIVERCKELRRLSLS  341

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF YIG + ++LEMLS+AFAG SD G+ +VL+GC+ L+KL IRD PFG+  LLA
Sbjct  342  GLLTDRVFGYIGQHGKKLEMLSVAFAGDSDLGLHHVLSGCESLRKLEIRDCPFGDKPLLA  401

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS  V+ GACK+LA+K+PRLNVE+++E    + S  +   VEK+Y+Y
Sbjct  402  NAAKLETMRSLWMSSCSVSFGACKLLAQKLPRLNVEVMDERGPPD-SRPESCPVEKLYIY  460

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+AGPR D P FVW +
Sbjct  461  RTVAGPRFDMPDFVWKM  477



>gb|ACV87279.1| TIR1/AFB auxin receptor protein PintaTIR1 [Pinus taeda]
Length=574

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 145/197 (74%), Gaps = 0/197 (0%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C QM NAALI VA+N P    FRLC ++PT PD +T QPLDEGFG +VQSCK L+RLS+ 
Sbjct  378  CCQMTNAALITVARNSPLLTCFRLCIIDPTSPDHLTKQPLDEGFGTVVQSCKSLRRLSMS  437

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF  IG Y + LEMLS+AFAG SD GM  VL+GC  L+KL +RDSPFG+ ALLA
Sbjct  438  GLLTDKVFQVIGTYGKCLEMLSVAFAGDSDFGMQCVLSGCINLRKLEVRDSPFGDLALLA  497

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMSS  VT+  CK LA KM  LNVE+I++ +Q E      Q V+ +Y+Y
Sbjct  498  GSEKYESMRSLWMSSCSVTVHGCKELAAKMRNLNVEVIHDRDQFEDISTMTQPVDGLYVY  557

Query  217  RTLAGPRKDAPGFVWTL  167
            R++AG RKD P F++T+
Sbjct  558  RSVAGHRKDTPHFIYTM  574



>ref|XP_010674940.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM N AL  +AKN PN  RFRLC + P  PD +T QPLDEGFGAIV+ CK L+RLS+ 
Sbjct  390  CRQMSNEALFTIAKNRPNLTRFRLCIIEPQCPDYLTNQPLDEGFGAIVEHCKDLRRLSLS  449

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD+VF  IG +A+ LEMLS+AFAG+SD G+ Y+L+GCK L+KL IRD PFG  AL+ 
Sbjct  450  GLLTDRVFELIGTHAKNLEMLSLAFAGESDLGLHYILSGCKNLRKLEIRDCPFGARALVV  509

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
            +  K ETMRSLWMSS +V+ G CK+L KKMPRLNVE+++E    +   D+G  +EK+Y+Y
Sbjct  510  NAAKLETMRSLWMSSCQVSYGECKLLGKKMPRLNVEVMDERGHPDLRSDEGS-IEKLYIY  568

Query  217  RTLAGPRKDAPGFVWTL  167
            RT+ GPR D+P FVWT+
Sbjct  569  RTIVGPRVDSPEFVWTM  585



>ref|XP_002316664.1| hypothetical protein POPTR_0011s04200g [Populus trichocarpa]
 gb|EEE97276.1| hypothetical protein POPTR_0011s04200g [Populus trichocarpa]
Length=579

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -3

Query  757  CQQMXNAALIAVAKNCPNFIRFRLCTLNPTVPDAVTMQPLDEGFGAIVQSCKGLKRLSVF  578
            C+QM NAA+  + +NCP+F  FRLC +NP  PD +T +P+DE FGA+V++C  L+RLSV 
Sbjct  386  CRQMTNAAVATIVQNCPDFTHFRLCIMNPGQPDYLTNEPMDEAFGAVVRTCTKLQRLSVS  445

Query  577  GLLTDQVFLYIGMYAEQLEMLSIAFAGKSDKGMLYVLNGCKKLKKLXIRDSPFGNAALLA  398
            GLLTD  F YIG YA+ LE LS+AFAG SD+GM  +L GC KL+KL IRD PFGNAALL+
Sbjct  446  GLLTDLTFEYIGQYAKNLETLSVAFAGSSDRGMQCMLEGCPKLRKLEIRDCPFGNAALLS  505

Query  397  DXGKYETMRSLWMSSXEVTLGACKILAKKMPRLNVEIINESEQAETSHDDGQKVEKMYLY  218
               KYE+MRSLWMS+  VT+  C++LA++MPRLNVE++ E        DD Q  +K+Y+Y
Sbjct  506  GLEKYESMRSLWMSACNVTMNGCRVLAREMPRLNVEVMKED-----GSDDSQ-ADKVYVY  559

Query  217  RTLAGPRKDAPGFVWTL  167
            R++ GPR+DAP  V TL
Sbjct  560  RSVVGPRRDAPPCVLTL  576



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1483248998725