BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4154

Length=949
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI36950.3|  unnamed protein product                                318   3e-97   Vitis vinifera
ref|XP_010652242.1|  PREDICTED: probable glutamyl endopeptidase, ...    318   6e-97   Vitis vinifera
ref|XP_010652241.1|  PREDICTED: probable glutamyl endopeptidase, ...    318   8e-97   Vitis vinifera
gb|KFK37479.1|  hypothetical protein AALP_AA4G262700                    318   1e-96   Arabis alpina [alpine rockcress]
ref|XP_012082895.1|  PREDICTED: probable glutamyl endopeptidase, ...    316   4e-96   
ref|XP_002515283.1|  dipeptidyl-peptidase, putative                     316   4e-96   
gb|KJB49819.1|  hypothetical protein B456_008G139300                    306   1e-95   Gossypium raimondii
ref|XP_009378724.1|  PREDICTED: probable glutamyl endopeptidase, ...    313   8e-95   Pyrus x bretschneideri [bai li]
ref|XP_008369043.1|  PREDICTED: probable glutamyl endopeptidase, ...    313   9e-95   
ref|XP_009378723.1|  PREDICTED: probable glutamyl endopeptidase, ...    313   9e-95   Pyrus x bretschneideri [bai li]
ref|XP_008369041.1|  PREDICTED: probable glutamyl endopeptidase, ...    313   1e-94   
ref|XP_006397934.1|  hypothetical protein EUTSA_v10001294mg             312   1e-94   Eutrema salsugineum [saltwater cress]
ref|XP_010544967.1|  PREDICTED: probable glutamyl endopeptidase, ...    312   1e-94   Tarenaya hassleriana [spider flower]
ref|XP_010544966.1|  PREDICTED: probable glutamyl endopeptidase, ...    312   2e-94   Tarenaya hassleriana [spider flower]
ref|XP_008235148.1|  PREDICTED: probable glutamyl endopeptidase, ...    312   2e-94   Prunus mume [ume]
ref|XP_008235149.1|  PREDICTED: probable glutamyl endopeptidase, ...    312   2e-94   Prunus mume [ume]
ref|XP_007051106.1|  Prolyl oligopeptidase family protein               311   3e-94   
gb|AAL57645.1|  At2g47390/T8I13.23                                      311   4e-94   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27492.1|  BnaC04g51330D                                          311   4e-94   Brassica napus [oilseed rape]
sp|Q8VZF3.2|CGEP_ARATH  RecName: Full=Probable glutamyl endopepti...    311   4e-94   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850473.1|  probable glutamyl endopeptidase                       311   5e-94   Arabidopsis thaliana [mouse-ear cress]
gb|AAB63841.1|  unknown protein                                         310   6e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507894.1|  PREDICTED: probable glutamyl endopeptidase, ...    310   1e-93   Camelina sativa [gold-of-pleasure]
ref|XP_009142541.1|  PREDICTED: probable glutamyl endopeptidase, ...    309   1e-93   Brassica rapa
gb|KHG24720.1|  putative glutamyl endopeptidase, chloroplastic -l...    308   1e-93   Gossypium arboreum [tree cotton]
ref|XP_009142540.1|  PREDICTED: probable glutamyl endopeptidase, ...    309   2e-93   Brassica rapa
emb|CDX80100.1|  BnaA05g00560D                                          309   2e-93   
ref|XP_006444496.1|  hypothetical protein CICLE_v10018738mg             309   2e-93   Citrus clementina [clementine]
ref|XP_007200322.1|  hypothetical protein PRUPE_ppa000899mg             309   2e-93   Prunus persica
gb|KDO86997.1|  hypothetical protein CISIN_1g002164mg                   309   2e-93   Citrus sinensis [apfelsine]
ref|XP_006492336.1|  PREDICTED: probable glutamyl endopeptidase, ...    309   2e-93   
gb|KDO86995.1|  hypothetical protein CISIN_1g002164mg                   309   2e-93   Citrus sinensis [apfelsine]
ref|XP_011041192.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   2e-93   Populus euphratica
ref|XP_010506775.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   3e-93   Camelina sativa [gold-of-pleasure]
ref|XP_011041183.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   3e-93   Populus euphratica
ref|XP_010518438.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   3e-93   Camelina sativa [gold-of-pleasure]
ref|XP_010518437.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   3e-93   Camelina sativa [gold-of-pleasure]
gb|KJB49818.1|  hypothetical protein B456_008G139300                    306   4e-93   Gossypium raimondii
ref|XP_006375435.1|  hypothetical protein POPTR_0014s11570g             308   4e-93   Populus trichocarpa [western balsam poplar]
ref|XP_002882118.1|  serine-type peptidase                              308   5e-93   
ref|XP_010679383.1|  PREDICTED: probable glutamyl endopeptidase, ...    304   6e-93   
gb|EEC75088.1|  hypothetical protein OsI_11240                          306   6e-93   Oryza sativa Indica Group [Indian rice]
gb|EEE58916.1|  hypothetical protein OsJ_10563                          307   7e-93   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002320974.2|  hypothetical protein POPTR_0014s11570g             307   8e-93   
ref|XP_006375436.1|  hypothetical protein POPTR_0014s11570g             307   9e-93   
ref|XP_008386780.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    307   1e-92   
ref|NP_001049893.1|  Os03g0307100                                       306   1e-92   
ref|XP_004229392.1|  PREDICTED: probable glutamyl endopeptidase, ...    307   1e-92   Solanum lycopersicum
emb|CDY55377.1|  BnaC04g51960D                                          306   1e-92   Brassica napus [oilseed rape]
dbj|BAJ95615.1|  predicted protein                                      291   2e-92   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010259303.1|  PREDICTED: probable glutamyl endopeptidase, ...    306   2e-92   Nelumbo nucifera [Indian lotus]
ref|XP_010259302.1|  PREDICTED: probable glutamyl endopeptidase, ...    306   3e-92   Nelumbo nucifera [Indian lotus]
gb|KJB49821.1|  hypothetical protein B456_008G139300                    306   3e-92   Gossypium raimondii
gb|KJB49822.1|  hypothetical protein B456_008G139300                    306   3e-92   Gossypium raimondii
ref|XP_006349188.1|  PREDICTED: probable glutamyl endopeptidase, ...    306   4e-92   Solanum tuberosum [potatoes]
ref|XP_009774674.1|  PREDICTED: probable glutamyl endopeptidase, ...    303   4e-92   Nicotiana sylvestris
ref|XP_010938262.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    305   5e-92   Elaeis guineensis
ref|XP_011465337.1|  PREDICTED: probable glutamyl endopeptidase, ...    305   6e-92   Fragaria vesca subsp. vesca
ref|XP_004300449.2|  PREDICTED: probable glutamyl endopeptidase, ...    305   6e-92   Fragaria vesca subsp. vesca
ref|XP_002301512.2|  hypothetical protein POPTR_0002s19700g             304   1e-91   
ref|XP_009774673.1|  PREDICTED: probable glutamyl endopeptidase, ...    304   1e-91   Nicotiana sylvestris
ref|XP_010679382.1|  PREDICTED: probable glutamyl endopeptidase, ...    304   2e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009774672.1|  PREDICTED: probable glutamyl endopeptidase, ...    303   2e-91   Nicotiana sylvestris
ref|XP_011042249.1|  PREDICTED: probable glutamyl endopeptidase, ...    303   3e-91   Populus euphratica
gb|EMT29865.1|  Dipeptidyl peptidase family member 6                    301   3e-91   
gb|ERN02133.1|  hypothetical protein AMTR_s00045p00176400               302   4e-91   Amborella trichopoda
ref|XP_006649964.1|  PREDICTED: probable glutamyl endopeptidase, ...    301   5e-91   
ref|XP_002467980.1|  hypothetical protein SORBIDRAFT_01g037483          302   5e-91   Sorghum bicolor [broomcorn]
ref|XP_004494425.1|  PREDICTED: probable glutamyl endopeptidase, ...    302   7e-91   Cicer arietinum [garbanzo]
ref|XP_004494424.1|  PREDICTED: probable glutamyl endopeptidase, ...    302   7e-91   Cicer arietinum [garbanzo]
ref|XP_006840458.2|  PREDICTED: probable glutamyl endopeptidase, ...    302   8e-91   Amborella trichopoda
ref|XP_007163177.1|  hypothetical protein PHAVU_001G213000g             301   1e-90   Phaseolus vulgaris [French bean]
ref|XP_007163178.1|  hypothetical protein PHAVU_001G213000g             301   1e-90   Phaseolus vulgaris [French bean]
gb|KCW58332.1|  hypothetical protein EUGRSUZ_H01015                     301   1e-90   Eucalyptus grandis [rose gum]
gb|KCW58331.1|  hypothetical protein EUGRSUZ_H01015                     301   1e-90   Eucalyptus grandis [rose gum]
ref|XP_010069839.1|  PREDICTED: probable glutamyl endopeptidase, ...    301   1e-90   Eucalyptus grandis [rose gum]
emb|CDY37804.1|  BnaC04g00210D                                          280   2e-90   Brassica napus [oilseed rape]
gb|KJB49820.1|  hypothetical protein B456_008G139300                    301   2e-90   Gossypium raimondii
gb|KHN19214.1|  Putative glutamyl endopeptidase, chloroplastic          301   2e-90   Glycine soja [wild soybean]
ref|XP_008813381.1|  PREDICTED: probable glutamyl endopeptidase, ...    301   3e-90   
ref|XP_008813382.1|  PREDICTED: probable glutamyl endopeptidase, ...    301   3e-90   
gb|KHN43458.1|  Putative glutamyl endopeptidase, chloroplastic          300   3e-90   Glycine soja [wild soybean]
ref|XP_008813383.1|  PREDICTED: probable glutamyl endopeptidase, ...    300   4e-90   Phoenix dactylifera
ref|XP_008813380.1|  PREDICTED: probable glutamyl endopeptidase, ...    301   4e-90   
ref|XP_008813379.1|  PREDICTED: probable glutamyl endopeptidase, ...    300   5e-90   
ref|XP_006604741.1|  PREDICTED: probable glutamyl endopeptidase, ...    300   5e-90   Glycine max [soybeans]
ref|XP_004135992.1|  PREDICTED: probable glutamyl endopeptidase, ...    300   5e-90   Cucumis sativus [cucumbers]
ref|XP_006604740.1|  PREDICTED: probable glutamyl endopeptidase, ...    300   6e-90   Glycine max [soybeans]
tpg|DAA45011.1|  TPA: hypothetical protein ZEAMMB73_493989              298   6e-90   
ref|XP_009604951.1|  PREDICTED: probable glutamyl endopeptidase, ...    300   8e-90   Nicotiana tomentosiformis
ref|XP_010087237.1|  putative glutamyl endopeptidase                    302   8e-90   
ref|XP_009604950.1|  PREDICTED: probable glutamyl endopeptidase, ...    299   1e-89   Nicotiana tomentosiformis
ref|XP_008654909.1|  PREDICTED: probable glutamyl endopeptidase, ...    297   1e-89   
ref|XP_008654905.1|  PREDICTED: probable glutamyl endopeptidase, ...    298   3e-89   
ref|XP_008654901.1|  PREDICTED: probable glutamyl endopeptidase, ...    297   3e-89   
ref|XP_010228712.1|  PREDICTED: probable glutamyl endopeptidase, ...    297   5e-89   Brachypodium distachyon [annual false brome]
ref|XP_003558080.1|  PREDICTED: probable glutamyl endopeptidase, ...    296   6e-89   Brachypodium distachyon [annual false brome]
ref|XP_010228711.1|  PREDICTED: probable glutamyl endopeptidase, ...    296   9e-89   Brachypodium distachyon [annual false brome]
ref|XP_004984623.1|  PREDICTED: probable glutamyl endopeptidase, ...    295   2e-88   Setaria italica
ref|XP_004984622.1|  PREDICTED: probable glutamyl endopeptidase, ...    295   2e-88   
gb|KEH24432.1|  glutamyl endopeptidase, putative                        296   2e-88   Medicago truncatula
gb|EYU46808.1|  hypothetical protein MIMGU_mgv1a000875mg                295   2e-88   Erythranthe guttata [common monkey flower]
gb|KEH24431.1|  glutamyl endopeptidase, putative                        295   2e-88   Medicago truncatula
ref|XP_003625970.1|  Acylamino-acid-releasing enzyme                    295   2e-88   Medicago truncatula
gb|KEH24430.1|  glutamyl endopeptidase, putative                        295   3e-88   Medicago truncatula
emb|CDP17069.1|  unnamed protein product                                294   4e-88   Coffea canephora [robusta coffee]
gb|EMS47754.1|  putative glutamyl endopeptidase, chloroplastic          290   4e-87   Triticum urartu
ref|XP_009414913.1|  PREDICTED: probable glutamyl endopeptidase, ...    292   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414908.1|  PREDICTED: probable glutamyl endopeptidase, ...    292   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414911.1|  PREDICTED: probable glutamyl endopeptidase, ...    292   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008451481.1|  PREDICTED: probable glutamyl endopeptidase, ...    292   5e-87   Cucumis melo [Oriental melon]
ref|XP_011079552.1|  PREDICTED: probable glutamyl endopeptidase, ...    288   9e-86   Sesamum indicum [beniseed]
ref|XP_010069840.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    283   7e-84   
gb|EPS61481.1|  hypothetical protein M569_13316                         273   7e-84   Genlisea aurea
gb|KCW58328.1|  hypothetical protein EUGRSUZ_H01014                     278   2e-82   Eucalyptus grandis [rose gum]
ref|XP_002990171.1|  hypothetical protein SELMODRAFT_131182             260   5e-76   
ref|XP_002992516.1|  hypothetical protein SELMODRAFT_135368             260   6e-76   
ref|XP_001754620.1|  predicted protein                                  258   3e-75   
ref|XP_001761707.1|  predicted protein                                  256   3e-74   
ref|XP_001772878.1|  predicted protein                                  254   1e-73   
ref|XP_004958766.1|  PREDICTED: probable glutamyl endopeptidase, ...    249   1e-71   Setaria italica
gb|EMS61523.1|  putative glutamyl endopeptidase, chloroplastic          248   1e-71   Triticum urartu
gb|KDO41282.1|  hypothetical protein CISIN_1g004456mg                   241   2e-71   Citrus sinensis [apfelsine]
emb|CDY68614.1|  BnaC04g52020D                                          229   2e-70   Brassica napus [oilseed rape]
gb|EEE67855.1|  hypothetical protein OsJ_25660                          244   8e-70   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82725.1|  hypothetical protein OsI_27416                          244   8e-70   Oryza sativa Indica Group [Indian rice]
gb|KDO41278.1|  hypothetical protein CISIN_1g004456mg                   241   2e-69   Citrus sinensis [apfelsine]
gb|KDO41277.1|  hypothetical protein CISIN_1g004456mg                   241   2e-69   Citrus sinensis [apfelsine]
gb|KDO41275.1|  hypothetical protein CISIN_1g004456mg                   241   2e-69   Citrus sinensis [apfelsine]
gb|EMT02117.1|  Dipeptidyl peptidase family member 6                    241   3e-69   
ref|XP_006442099.1|  hypothetical protein CICLE_v10018865mg             240   1e-68   
ref|XP_005847852.1|  hypothetical protein CHLNCDRAFT_31155              226   6e-64   Chlorella variabilis
ref|WP_029944704.1|  hypothetical protein                               214   9e-64   
ref|XP_005642798.1|  alpha/beta-hydrolase                               226   9e-64   Coccomyxa subellipsoidea C-169
emb|CEN48224.1|  Uncharacterized peptidase yuxL (fragment)              210   1e-63   Capnocytophaga canimorsus
ref|XP_001419477.1|  predicted protein                                  225   3e-63   Ostreococcus lucimarinus CCE9901
ref|XP_003081027.1|  Dipeptidyl aminopeptidases/acylaminoacyl-pep...    224   5e-63   
emb|CEF98925.1|  Peptidase S9, prolyl oligopeptidase, catalytic d...    224   8e-63   Ostreococcus tauri
ref|XP_002954276.1|  hypothetical protein VOLCADRAFT_106292             224   2e-62   Volvox carteri f. nagariensis
ref|WP_023574169.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    219   2e-61   Flavobacterium enshiense
ref|WP_034921484.1|  aminoacyl peptidase                                220   2e-61   Gillisia sp. CAL575
ref|XP_005534945.1|  probable dipeptidyl aminopeptidase                 220   4e-61   Cyanidioschyzon merolae strain 10D
ref|WP_029038563.1|  aminoacyl peptidase                                219   4e-61   Salinimicrobium xinjiangense
ref|WP_026981266.1|  aminoacyl peptidase                                218   6e-61   Flavobacterium suncheonense
ref|WP_028890983.1|  aminoacyl peptidase                                218   6e-61   Tenacibaculum sp. 47A_GOM-205m
ref|WP_023580461.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    218   9e-61   Flavobacterium limnosediminis
ref|WP_008464492.1|  hypothetical protein                               218   1e-60   Flavobacterium sp. F52
ref|WP_024982364.1|  aminoacyl peptidase                                218   1e-60   Flavobacterium succinicans
emb|CEN47830.1|  putative glutamyl endopeptidase, chloroplastic (...    211   1e-60   Capnocytophaga canimorsus
ref|WP_035619417.1|  aminoacyl peptidase                                217   1e-60   Flavobacterium hydatis
ref|WP_037319528.1|  aminoacyl peptidase                                217   2e-60   Salegentibacter sp. Hel_I_6
ref|WP_035682291.1|  aminoacyl peptidase                                216   3e-60   Flavobacterium reichenbachii
ref|WP_017733953.1|  hypothetical protein                               216   3e-60   Nafulsella turpanensis
ref|WP_029034950.1|  aminoacyl peptidase                                216   4e-60   Salinimicrobium terrae
ref|WP_026897909.1|  aminoacyl peptidase                                216   4e-60   Pedobacter oryzae
ref|WP_007803898.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    216   4e-60   Flavobacterium sp. CF136
ref|WP_015755577.1|  hypothetical protein                               216   4e-60   Robiginitalea biformata
ref|WP_039111629.1|  MULTISPECIES: aminoacyl peptidase                  216   5e-60   Flavobacterium
ref|WP_031455942.1|  aminoacyl peptidase                                216   5e-60   Flavobacterium chungangense
ref|XP_011401392.1|  putative glutamyl endopeptidase, chloroplastic     216   5e-60   Auxenochlorella protothecoides
gb|EPB65502.1|  peptidase, S9A/B/C family, catalytic domain protein     203   5e-60   Ancylostoma ceylanicum
ref|WP_026628138.1|  aminoacyl peptidase                                216   5e-60   Dysgonomonas capnocytophagoides
ref|WP_026839309.1|  aminoacyl peptidase                                216   5e-60   Gillisia sp. JM1
ref|WP_007648506.1|  hypothetical protein                               216   6e-60   Xanthomarina gelatinilytica
ref|WP_008239252.1|  prolyl oligopeptidase                              215   7e-60   Imtechella halotolerans
ref|WP_026711422.1|  aminoacyl peptidase                                215   7e-60   Flavobacterium filum
ref|WP_027077948.1|  aminoacyl peptidase                                215   9e-60   Maribacter antarcticus
ref|WP_007094759.1|  50S ribosomal protein L33                          215   9e-60   Kordia algicida
ref|WP_033370130.1|  aminoacyl peptidase                                215   9e-60   Hymenobacter norwichensis
ref|WP_045802485.1|  aminoacyl peptidase                                215   1e-59   Muricauda lutaonensis
ref|WP_009780757.1|  hypothetical protein                               215   1e-59   Leeuwenhoekiella blandensis
ref|WP_006987956.1|  hypothetical protein                               215   1e-59   Gillisia limnaea
gb|KDD76957.1|  hypothetical protein H632_c56p2                         215   1e-59   Helicosporidium sp. ATCC 50920
ref|WP_026933879.1|  aminoacyl peptidase                                215   1e-59   Gramella echinicola
ref|WP_029952658.1|  MULTISPECIES: aminoacyl peptidase                  215   1e-59   
gb|EMY82435.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase...    214   1e-59   Psychroflexus gondwanensis ACAM 44
ref|WP_035650219.1|  aminoacyl peptidase                                214   1e-59   Flavobacterium sp. Fl
ref|WP_038527796.1|  aminoacyl peptidase                                214   1e-59   Formosa agariphila
ref|WP_026727763.1|  aminoacyl peptidase                                214   2e-59   Flavobacterium denitrificans
ref|WP_040555677.1|  aminoacyl peptidase                                214   2e-59   Psychroflexus gondwanensis
ref|WP_023570215.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...    214   2e-59   Flavobacterium cauense
ref|WP_026706913.1|  aminoacyl peptidase                                214   2e-59   Flavobacterium frigidarium
ref|WP_017494897.1|  glutamyl peptidase                                 214   2e-59   Flavobacterium sp. WG21
ref|WP_028607040.1|  aminoacyl peptidase                                214   2e-59   Olleya sp. VCSM12
ref|WP_028289494.1|  aminoacyl peptidase                                214   2e-59   Olleya sp. VCSA23
ref|WP_044399417.1|  aminoacyl peptidase                                214   3e-59   Lacinutrix sp. Hel_I_90
ref|WP_041519915.1|  aminoacyl peptidase                                214   3e-59   Flavobacterium hibernum
ref|WP_035654801.1|  aminoacyl peptidase                                214   3e-59   Flavobacterium saliperosum
ref|WP_026724532.1|  aminoacyl peptidase                                214   3e-59   Flavobacterium sasangense
emb|CAG27629.1|  unknown protein                                        198   3e-59   Populus deltoides x Populus maximowiczii
gb|ESU23872.1|  hypothetical protein FSS13T_21770                       214   3e-59   Flavobacterium saliperosum S13
ref|WP_026915443.1|  aminoacyl peptidase                                213   4e-59   Gramella portivictoriae
ref|WP_026451707.1|  aminoacyl peptidase                                213   4e-59   Aequorivita capsosiphonis
ref|WP_025607761.1|  aminoacyl peptidase                                213   4e-59   Pontibacter actiniarum
ref|WP_013598252.1|  prolyl oligopeptidase                              213   4e-59   Weeksella virosa
ref|WP_009581987.1|  hypothetical protein                               213   4e-59   Fulvivirga imtechensis
ref|WP_019038477.1|  hypothetical protein                               213   4e-59   Psychroflexus tropicus
ref|WP_045028808.1|  aminoacyl peptidase                                213   5e-59   
ref|WP_011710208.1|  hypothetical protein                               213   5e-59   Gramella forsetii
ref|WP_013445337.1|  hypothetical protein                               213   6e-59   Paludibacter propionicigenes
ref|WP_041496510.1|  aminoacyl peptidase                                213   7e-59   Nonlabens marinus
ref|WP_027880108.1|  aminoacyl peptidase                                213   7e-59   Mesoflavibacter zeaxanthinifaciens
ref|WP_009036124.1|  prolyl oligopeptidase family protein               213   7e-59   Indibacter alkaliphilus
ref|WP_026704194.1|  aminoacyl peptidase                                213   7e-59   Flavobacterium soli
ref|WP_026717986.1|  aminoacyl peptidase                                213   8e-59   Flavobacterium gelidilacus
ref|WP_028374744.1|  aminoacyl peptidase                                213   8e-59   Leeuwenhoekiella sp. MAR_2009_132
ref|WP_022826900.1|  glutamyl peptidase                                 212   8e-59   Flavobacterium antarcticum
ref|WP_041913606.1|  aminoacyl peptidase                                212   8e-59   
gb|AEK23470.1|  Uncharacterized peptidase yuxL                          212   9e-59   Capnocytophaga canimorsus Cc5
ref|WP_016989226.1|  glutamyl peptidase                                 212   9e-59   Flavobacterium sp. ACAM 123
ref|WP_028872772.1|  aminoacyl peptidase                                212   9e-59   Psychroserpens burtonensis
ref|WP_008272448.1|  hypothetical protein                               212   1e-58   Flavobacteriales bacterium ALC-1
ref|WP_045972581.1|  aminoacyl peptidase                                212   1e-58   Flavobacterium sp. 316
ref|WP_035125871.1|  aminoacyl peptidase                                212   1e-58   Flavobacterium aquatile
ref|WP_040443844.1|  aminoacyl peptidase                                212   1e-58   
ref|WP_032131229.1|  aminoacyl peptidase                                212   1e-58   Weeksella massiliensis
ref|WP_035084383.1|  aminoacyl peptidase                                212   1e-58   
ref|WP_044014202.1|  aminoacyl peptidase                                212   2e-58   Hymenobacter sp. APR13
ref|WP_007136399.1|  hypothetical protein                               211   2e-58   Flavobacterium frigoris
ref|WP_038334706.1|  aminoacyl peptidase                                211   2e-58   Empedobacter falsenii
ref|WP_008628244.1|  hypothetical protein                               211   2e-58   Mariniradius saccharolyticus
ref|WP_019975615.1|  hypothetical protein                               211   2e-58   Empedobacter brevis
ref|WP_013070685.1|  prolyl oligopeptidase                              211   2e-58   Zunongwangia profunda
ref|WP_026952618.1|  aminoacyl peptidase                                211   2e-58   Algoriphagus mannitolivorans
ref|WP_015265145.1|  prolyl oligopeptidase family protein               211   3e-58   Echinicola vietnamensis
ref|WP_026976430.1|  aminoacyl peptidase                                211   3e-58   Flavobacterium tegetincola
ref|WP_018479746.1|  glutamyl peptidase                                 211   3e-58   Pontibacter roseus
ref|WP_007653415.1|  peptidase S9 prolyl oligopeptidase active si...    211   3e-58   Pontibacter sp. BAB1700
ref|WP_008637476.1|  prolyl oligopeptidase family protein               211   3e-58   Bizionia argentinensis
ref|WP_018108058.1|  hypothetical protein                               211   3e-58   Bacteroides propionicifaciens
ref|WP_010519922.1|  hypothetical protein                               211   4e-58   Croceivirga radicis
ref|WP_045081693.1|  aminoacyl peptidase                                211   4e-58   Aequorivita vladivostokensis
ref|WP_015806071.1|  hypothetical protein                               210   4e-58   Flavobacteriaceae bacterium 3519-10
ref|WP_009184839.1|  Prolyl oligopeptidase family protein               210   5e-58   Cecembia lonarensis
ref|WP_035640609.1|  aminoacyl peptidase                                210   5e-58   Flavobacterium gilvum
ref|WP_034259045.1|  aminoacyl peptidase                                210   7e-58   Altibacter lentus
ref|WP_037459572.1|  aminoacyl peptidase                                209   8e-58   Sphingobacterium spiritivorum
ref|WP_044000965.1|  aminoacyl peptidase                                209   8e-58   Hymenobacter swuensis
ref|WP_026038813.1|  aminoacyl peptidase                                209   9e-58   Myroides injenensis
gb|EFK55894.1|  peptidase, S9A/B/C family, catalytic domain protein     209   1e-57   Sphingobacterium spiritivorum ATCC 33861
ref|WP_038987733.1|  aminoacyl peptidase                                209   1e-57   Myroides marinus
ref|WP_002986028.1|  MULTISPECIES: hypothetical protein                 209   1e-57   Myroides odoratus
ref|WP_009197199.1|  Poly(3-hydroxybutyrate) depolymerase               209   1e-57   Cesiribacter andamanensis
ref|WP_036471158.1|  aminoacyl peptidase                                209   1e-57   
ref|WP_020606187.1|  glutamyl peptidase                                 209   1e-57   Spirosoma spitsbergense
ref|WP_036496613.1|  MULTISPECIES: aminoacyl peptidase                  209   1e-57   
gb|EHO12957.1|  hypothetical protein HMPREF9712_00104                   209   1e-57   Myroides odoratimimus CCUG 10230
ref|WP_041889805.1|  aminoacyl peptidase                                209   1e-57   
ref|WP_036497222.1|  aminoacyl peptidase                                209   1e-57   
ref|WP_036474081.1|  aminoacyl peptidase                                209   1e-57   
gb|EHO12761.1|  hypothetical protein HMPREF9714_01131                   209   1e-57   Myroides odoratimimus CCUG 12901
gb|EPH11255.1|  hypothetical protein HMPREF9713_01740                   209   1e-57   Myroides odoratimimus CCUG 12700
gb|EKB03421.1|  hypothetical protein HMPREF9711_02748                   209   1e-57   Myroides odoratimimus CCUG 3837
ref|WP_019101413.1|  hypothetical protein                               209   2e-57   Chromobacterium
ref|WP_021987401.1|  peptidase S9 prolyl oligopeptidase active si...    209   2e-57   
ref|WP_043641829.1|  aminoacyl peptidase                                209   2e-57   Chromobacterium haemolyticum
ref|WP_034720686.1|  aminoacyl peptidase                                208   2e-57   Chryseobacterium antarcticum
ref|WP_014978909.1|  glutamyl peptidase                                 208   2e-57   Alteromonas macleodii
ref|WP_039230204.1|  aminoacyl peptidase                                208   2e-57   Alteromonas macleodii
ref|WP_019595958.1|  glutamyl peptidase                                 208   2e-57   Rhodonellum
ref|WP_003003761.1|  peptidase, S9A/B/C family, catalytic domain ...    208   2e-57   Sphingobacterium spiritivorum
gb|EIJ38584.1|  prolyl oligopeptidase family protein                    208   2e-57   Joostella marina DSM 19592
ref|WP_035401763.1|  aminoacyl peptidase                                208   3e-57   
ref|WP_035667868.1|  aminoacyl peptidase                                208   3e-57   Flavobacterium sp. 83
ref|WP_013409281.1|  hypothetical protein                               208   3e-57   Leadbetterella byssophila
ref|WP_042347553.1|  aminoacyl peptidase                                208   3e-57   Capnocytophaga canis
ref|WP_042343400.1|  aminoacyl peptidase                                208   3e-57   Capnocytophaga canis
ref|WP_034870236.1|  aminoacyl peptidase                                198   3e-57   
ref|WP_040879935.1|  aminoacyl peptidase                                208   3e-57   
gb|KER10044.1|  aminoacyl peptidase                                     208   3e-57   Candidatus Thermochlorobacteriaceae bacterium GBChlB
ref|WP_018621090.1|  glutamyl peptidase                                 208   3e-57   Spirosoma luteum
ref|WP_019538970.1|  hypothetical protein                               207   5e-57   Proteiniphilum acetatigenes
gb|ADV63172.1|  glutamyl peptidase                                      207   5e-57   Isosphaera pallida ATCC 43644
ref|WP_020570470.1|  hypothetical protein                               207   5e-57   Lewinella persica
ref|WP_006745111.1|  hypothetical protein                               207   5e-57   Bacteroides coprosuis
ref|WP_010602229.1|  peptidase S9                                       207   6e-57   Pedobacter agri
ref|WP_008197892.1|  putative secreted protein                          207   7e-57   Algoriphagus machipongonensis
ref|WP_013453011.1|  glutamyl peptidase                                 207   7e-57   Marivirga tractuosa
ref|WP_020607102.1|  hypothetical protein                               207   7e-57   Spirosoma spitsbergense
ref|WP_045689650.1|  aminoacyl peptidase                                207   8e-57   
ref|WP_026955831.1|  aminoacyl peptidase                                207   9e-57   
ref|WP_014771634.1|  prolyl oligopeptidase family protein               207   9e-57   
ref|WP_045690790.1|  hypothetical protein                               196   9e-57   
ref|WP_045502386.1|  aminoacyl peptidase                                206   9e-57   
dbj|BAP31351.1|  S9A/B/C family peptidase                               206   1e-56   
ref|WP_014997997.1|  glutamyl peptidase                                 206   1e-56   
ref|WP_025254805.1|  aminoacyl peptidase                                206   1e-56   
ref|WP_043593618.1|  aminoacyl peptidase                                206   1e-56   
ref|WP_035074703.1|  aminoacyl peptidase                                206   1e-56   
ref|WP_026948044.1|  aminoacyl peptidase                                206   1e-56   
ref|WP_025145192.1|  peptidase S9                                       206   2e-56   
ref|WP_012925251.1|  peptidase S9 prolyl oligopeptidase active si...    206   2e-56   
ref|WP_041887265.1|  peptidase S9                                       205   2e-56   
ref|WP_039475116.1|  peptidase S9                                       206   2e-56   
ref|WP_028526669.1|  aminoacyl peptidase                                206   2e-56   
dbj|GAK96963.1|  hypothetical protein JCM19294_469                      191   2e-56   
ref|WP_029416371.1|  aminoacyl peptidase                                205   2e-56   
ref|WP_037083173.1|  aminoacyl peptidase                                205   2e-56   
ref|WP_044201691.1|  aminoacyl peptidase                                205   2e-56   
ref|WP_029282738.1|  peptidase S9                                       205   3e-56   
ref|WP_037072850.1|  aminoacyl peptidase                                205   3e-56   
ref|XP_007510843.1|  predicted protein                                  206   3e-56   
gb|AGY52813.1|  putative peptidase yuxL                                 205   3e-56   
ref|WP_034761165.1|  aminoacyl peptidase                                205   3e-56   
ref|WP_038460301.1|  aminoacyl peptidase                                205   3e-56   
ref|XP_005706636.1|  serine-type peptidase                              206   3e-56   
ref|WP_037060516.1|  aminoacyl peptidase                                205   4e-56   
ref|WP_039453639.1|  aminoacyl peptidase                                205   4e-56   
ref|WP_034689027.1|  aminoacyl peptidase                                204   4e-56   
ref|WP_034750848.1|  aminoacyl peptidase                                204   5e-56   
ref|WP_044255181.1|  aminoacyl peptidase                                204   6e-56   
ref|WP_016199840.1|  hypothetical protein                               204   6e-56   
ref|WP_020595622.1|  glutamyl peptidase                                 204   9e-56   
ref|WP_027375218.1|  aminoacyl peptidase                                204   9e-56   
ref|WP_039128517.1|  hypothetical protein                               204   1e-55   
ref|WP_039344618.1|  aminoacyl peptidase                                204   1e-55   
ref|WP_041461808.1|  aminoacyl peptidase                                204   1e-55   
gb|KFF74718.1|  aminoacyl peptidase                                     203   1e-55   
gb|EFK35053.1|  peptidase, S9A/B/C family, catalytic domain protein     203   1e-55   
ref|WP_034736543.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_045809689.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_028665533.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_034707653.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_029661158.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_026108609.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_034696772.1|  aminoacyl peptidase                                203   1e-55   
ref|WP_034676023.1|  aminoacyl peptidase                                203   2e-55   
ref|WP_035309413.1|  aminoacyl peptidase                                203   2e-55   
ref|WP_034727666.1|  aminoacyl peptidase                                203   2e-55   
ref|WP_013665039.1|  hypothetical protein                               203   2e-55   
ref|WP_040349911.1|  aminoacyl peptidase                                203   2e-55   
gb|EDX79763.1|  peptidase, S9A/B/C family, catalytic domain protein     203   2e-55   
ref|WP_024598017.1|  glutamyl endopeptidase                             199   2e-55   
ref|WP_042010195.1|  aminoacyl peptidase                                203   2e-55   
ref|WP_008950420.1|  dipeptidyl aminopeptidase                          203   2e-55   
ref|WP_008606449.1|  dipeptidyl aminopeptidase                          202   2e-55   
ref|WP_013929979.1|  peptidase S9 prolyl oligopeptidase active si...    202   2e-55   
dbj|GAD58538.1|  LOW QUALITY PROTEIN: dipeptidyl aminopeptidases/...    202   3e-55   
ref|WP_033425637.1|  aminoacyl peptidase                                202   3e-55   
ref|WP_044129974.1|  aminoacyl peptidase                                202   3e-55   
ref|WP_023461582.1|  aminoacyl peptidase                                202   4e-55   
ref|WP_007842575.1|  MULTISPECIES: prolyl oligopeptidase family p...    202   4e-55   
ref|WP_035044916.1|  aminoacyl peptidase                                202   4e-55   
ref|WP_034752437.1|  aminoacyl peptidase                                202   4e-55   
ref|XP_003057252.1|  predicted protein                                  202   4e-55   
ref|WP_009280632.1|  peptidase S9 prolyl oligopeptidase active si...    202   4e-55   
ref|WP_037496671.1|  aminoacyl peptidase                                202   5e-55   
ref|WP_026193782.1|  aminoacyl peptidase                                201   6e-55   
ref|WP_024595056.1|  glutamyl endopeptidase                             197   6e-55   
ref|WP_003170123.1|  peptidase, S9A/B/C family, catalytic domain ...    201   6e-55   
ref|WP_041992873.1|  aminoacyl peptidase                                201   7e-55   
ref|WP_005491700.1|  hypothetical protein                               201   8e-55   
ref|WP_021476771.1|  glutamyl peptidase                                 201   8e-55   
ref|WP_040345782.1|  aminoacyl peptidase                                196   8e-55   
ref|WP_039244479.1|  aminoacyl peptidase                                201   9e-55   
ref|WP_040999116.1|  aminoacyl peptidase                                201   9e-55   
ref|WP_024606678.1|  glutamyl endopeptidase                             197   9e-55   
ref|WP_034682840.1|  aminoacyl peptidase                                201   1e-54   
ref|WP_024592897.1|  glutamyl endopeptidase                             196   1e-54   
ref|WP_039347148.1|  aminoacyl peptidase                                200   2e-54   
ref|WP_043629145.1|  aminoacyl peptidase                                200   2e-54   
ref|WP_036692766.1|  hypothetical protein                               200   2e-54   
ref|WP_045179286.1|  aminoacyl peptidase                                200   2e-54   
ref|WP_010920521.1|  hypothetical protein                               200   2e-54   
ref|WP_041659027.1|  aminoacyl peptidase                                200   2e-54   
ref|XP_002500610.1|  predicted protein                                  200   2e-54   
ref|WP_024353256.1|  aminoacyl peptidase                                199   3e-54   
gb|KFF10518.1|  aminoacyl peptidase                                     199   3e-54   
ref|WP_031301884.1|  aminoacyl peptidase                                199   3e-54   
gb|ERJ58555.1|  hypothetical protein M472_07235                         199   3e-54   
ref|WP_008108869.1|  MULTISPECIES: glutamyl endopeptidase               199   3e-54   
ref|WP_034714502.1|  aminoacyl peptidase                                199   3e-54   
gb|EJP78274.1|  hypothetical protein A1OC_00642                         187   3e-54   
ref|WP_039368837.1|  aminoacyl peptidase                                199   3e-54   
gb|ADU12961.1|  aminoacyl peptidase                                     199   3e-54   
ref|WP_033564477.1|  aminoacyl peptidase                                199   3e-54   
ref|WP_013534184.1|  hypothetical protein                               199   3e-54   
ref|WP_044151818.1|  aminoacyl peptidase                                199   3e-54   
ref|WP_014791739.1|  prolyl oligopeptidase family protein               199   3e-54   
ref|WP_044227088.1|  aminoacyl peptidase                                199   3e-54   
ref|WP_031330474.1|  aminoacyl peptidase                                187   3e-54   
ref|WP_008134481.1|  glutamyl endopeptidase                             199   4e-54   
ref|WP_007377220.1|  glutamyl endopeptidase                             199   4e-54   
ref|WP_045752781.1|  aminoacyl peptidase                                199   4e-54   
ref|WP_028788724.1|  peptidase S9                                       199   4e-54   
emb|CDS92136.1|  conserved exported hypothetical protein                199   4e-54   
ref|WP_014678753.1|  WD40-like beta propeller repeat protein,prol...    199   4e-54   
ref|WP_024891486.1|  aminoacyl peptidase                                199   5e-54   
ref|WP_035727191.1|  aminoacyl peptidase                                199   6e-54   
ref|WP_034758245.1|  aminoacyl peptidase                                199   6e-54   
ref|WP_021347170.1|  glutamyl peptidase                                 199   6e-54   
ref|WP_009088259.1|  hypothetical protein                               199   6e-54   
gb|ELR80356.1|  hypothetical protein D505_04629                         199   6e-54   
gb|KDS37935.1|  prolyl oligopeptidase family protein                    198   6e-54   
ref|WP_034847440.1|  aminoacyl peptidase                                198   6e-54   
ref|WP_024567679.1|  aminoacyl peptidase                                198   6e-54   
gb|KGT09649.1|  aminoacyl peptidase                                     198   6e-54   
ref|WP_024564101.1|  aminoacyl peptidase                                198   6e-54   
ref|WP_024568919.1|  aminoacyl peptidase                                198   7e-54   
ref|WP_029945871.1|  hypothetical protein                               195   7e-54   
ref|WP_036633352.1|  hypothetical protein                               198   7e-54   
ref|WP_043572150.1|  aminoacyl peptidase                                198   7e-54   
ref|WP_036617699.1|  hypothetical protein                               198   8e-54   
ref|WP_008772758.1|  hypothetical protein                               198   8e-54   
ref|WP_044545675.1|  hypothetical protein                               198   8e-54   
ref|WP_022192573.1|  hypothetical protein                               198   9e-54   
ref|WP_008779235.1|  MULTISPECIES: hypothetical protein                 198   9e-54   
ref|WP_024610902.1|  glutamyl endopeptidase                             195   9e-54   
ref|WP_036148309.1|  aminoacyl peptidase                                198   9e-54   
ref|WP_012056075.1|  hypothetical protein                               198   9e-54   
ref|WP_005867623.1|  MULTISPECIES: hypothetical protein                 198   9e-54   
ref|WP_045051973.1|  aminoacyl peptidase                                198   9e-54   
ref|WP_043614381.1|  aminoacyl peptidase                                198   1e-53   
ref|WP_005859321.1|  MULTISPECIES: hypothetical protein                 198   1e-53   
ref|WP_033031982.1|  glutamyl endopeptidase                             198   1e-53   
ref|WP_011135850.1|  hypothetical protein                               198   1e-53   
ref|WP_033103268.1|  MULTISPECIES: glutamyl endopeptidase               198   1e-53   
ref|WP_004589552.1|  hypothetical protein                               198   1e-53   
ref|WP_028295855.1|  aminoacyl peptidase                                198   1e-53   
ref|WP_007581800.1|  glutamyl endopeptidase                             198   1e-53   
ref|WP_024032744.1|  glutamyl endopeptidase                             198   1e-53   
ref|WP_013463043.1|  glutamyl endopeptidase                             198   1e-53   
emb|CDN18091.1|  prolyl oligopeptidase family protein                   188   1e-53   
ref|WP_029164535.1|  hypothetical protein                               197   1e-53   
ref|WP_008165798.1|  glutamyl endopeptidase                             197   1e-53   
ref|WP_002960138.1|  glutamyl endopeptidase                             197   1e-53   
ref|WP_035562151.1|  aminoacyl peptidase                                197   1e-53   
ref|WP_039488410.1|  MULTISPECIES: glutamyl endopeptidase               197   1e-53   
ref|WP_012141446.1|  peptidase S9                                       197   1e-53   
ref|WP_024591896.1|  MULTISPECIES: glutamyl endopeptidase               197   1e-53   
ref|WP_024605649.1|  glutamyl endopeptidase                             197   2e-53   
ref|WP_027069324.1|  aminoacyl peptidase                                197   2e-53   
ref|WP_013578758.1|  peptidase S9                                       197   2e-53   
ref|WP_037441839.1|  aminoacyl peptidase                                197   2e-53   
ref|WP_024602725.1|  glutamyl endopeptidase                             197   2e-53   
ref|WP_008984857.1|  dipeptidyl aminopeptidase                          197   2e-53   
ref|WP_035302640.1|  aminoacyl peptidase                                197   3e-53   
ref|WP_010553650.1|  glutamyl endopeptidase                             197   3e-53   
gb|KFA32428.1|  aminoacyl peptidase                                     186   3e-53   
ref|WP_026763394.1|  peptidase S9                                       197   3e-53   
ref|WP_036955080.1|  glutamyl endopeptidase                             197   3e-53   
ref|WP_040135984.1|  glutamyl endopeptidase                             196   3e-53   
ref|WP_028071920.1|  aminoacyl peptidase                                196   3e-53   
ref|WP_006792662.1|  glutamyl endopeptidase                             196   4e-53   
ref|WP_004621156.1|  glutamyl peptidase                                 196   4e-53   
ref|WP_039037562.1|  glutamyl endopeptidase                             196   4e-53   
ref|WP_007419109.1|  dipeptidyl aminopeptidase                          196   4e-53   
ref|WP_010556814.1|  glutamyl endopeptidase                             196   4e-53   
ref|WP_038496716.1|  aminoacyl peptidase                                196   4e-53   
ref|WP_036972297.1|  glutamyl endopeptidase                             196   5e-53   
emb|CDG85386.1|  prolyl oligopeptidase family protein                   196   5e-53   
ref|WP_010389253.1|  glutamyl endopeptidase                             196   5e-53   
gb|AIE93704.1|  glutamyl peptidase                                      196   5e-53   
dbj|BAL54632.1|  glutamyl peptidase                                     196   6e-53   
ref|WP_010559326.1|  glutamyl endopeptidase                             196   6e-53   
ref|WP_020264176.1|  MULTISPECIES: hypothetical protein                 196   6e-53   
ref|WP_034775121.1|  aminoacyl peptidase                                196   6e-53   
ref|WP_020715592.1|  peptidase S9                                       196   6e-53   
ref|WP_017258469.1|  hypothetical protein                               196   6e-53   
ref|WP_039491209.1|  glutamyl endopeptidase                             196   6e-53   
ref|WP_033370232.1|  aminoacyl peptidase                                196   6e-53   
ref|WP_010379360.1|  glutamyl endopeptidase                             196   6e-53   
ref|WP_041258970.1|  aminoacyl peptidase                                196   7e-53   
ref|WP_045989295.1|  glutamyl endopeptidase                             196   7e-53   
emb|CCH00873.1|  peptidase S9 prolyl oligopeptidase active site d...    196   8e-53   
ref|WP_012276156.1|  peptidase S9                                       195   9e-53   
ref|WP_043087814.1|  aminoacyl peptidase                                186   9e-53   
ref|WP_020258490.1|  hypothetical protein                               195   9e-53   
ref|WP_016706927.1|  glutamyl endopeptidase                             195   1e-52   
ref|WP_008129685.1|  glutamyl endopeptidase                             195   1e-52   
ref|WP_035787784.1|  aminoacyl peptidase                                195   1e-52   
ref|WP_034784341.1|  aminoacyl peptidase                                195   1e-52   
ref|WP_034753463.1|  aminoacyl peptidase                                195   1e-52   
ref|WP_034733426.1|  aminoacyl peptidase                                195   1e-52   
ref|WP_026752002.1|  peptidase S9                                       194   1e-52   
ref|WP_013078205.1|  peptidase S9                                       195   1e-52   
ref|XP_005974437.1|  PREDICTED: probable glutamyl endopeptidase, ...    195   1e-52   
ref|WP_028834181.1|  MULTISPECIES: glutamyl endopeptidase               194   2e-52   
ref|WP_036194337.1|  aminoacyl peptidase                                194   2e-52   
ref|WP_040280813.1|  aminoacyl peptidase                                181   2e-52   
ref|WP_041857608.1|  hypothetical protein                               194   3e-52   
ref|WP_014101391.1|  glutamyl peptidase                                 194   3e-52   
gb|ABJ83007.1|  glutamyl peptidase. Serine peptidase. MEROPS fami...    194   3e-52   
ref|WP_028762263.1|  peptidase S9                                       194   3e-52   
ref|XP_001700781.1|  hypothetical protein CHLREDRAFT_98354              179   3e-52   
ref|WP_017915577.1|  glutamyl peptidase                                 192   4e-52   
ref|WP_010604255.1|  glutamyl endopeptidase                             193   4e-52   
ref|WP_043059666.1|  aminoacyl peptidase                                193   5e-52   
ref|WP_017979090.1|  hypothetical protein                               193   5e-52   
ref|WP_028765986.1|  peptidase S9                                       193   5e-52   
ref|WP_045963261.1|  glutamyl endopeptidase                             193   5e-52   
ref|WP_013764632.1|  peptidase S9                                       193   6e-52   
ref|WP_026861220.1|  aminoacyl peptidase                                193   6e-52   
ref|WP_009838053.1|  glutamyl endopeptidase                             192   6e-52   
ref|WP_017217545.1|  glutamyl endopeptidase                             192   8e-52   
ref|WP_012154250.1|  peptidase S9                                       192   8e-52   
ref|WP_036983791.1|  glutamyl endopeptidase                             192   8e-52   
ref|WP_029496139.1|  aminoacyl peptidase                                192   9e-52   
ref|WP_010050638.1|  peptidase S9, prolyl oligopeptidase active s...    190   1e-51   
gb|KIQ98097.1|  Dipeptidyl aminopeptidase                               191   1e-51   



>emb|CBI36950.3| unnamed protein product [Vitis vinifera]
Length=913

 Score =   318 bits (816),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 159/187 (85%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  710  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTYVE  769

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+P+LLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  770  MSPFMSANKIKRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  829

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QKHCV NT+ V        D   +   DPESK V ASG G PELA
Sbjct  830  RESIMHVLWETDRWLQKHCVSNTTNVNENLDTCNDEAKEEITDPESKTVPASGGGNPELA  889

Query  369  SDSNDTF  349
               ++ F
Sbjct  890  ESEHEGF  896



>ref|XP_010652242.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Vitis vinifera]
Length=962

 Score =   318 bits (816),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 159/187 (85%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  768  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTYVE  827

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+P+LLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  828  MSPFMSANKIKRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  887

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QKHCV NT+ V        D   +   DPESK V ASG G PELA
Sbjct  888  RESIMHVLWETDRWLQKHCVSNTTNVNENLDTCNDEAKEEITDPESKTVPASGGGNPELA  947

Query  369  SDSNDTF  349
               ++ F
Sbjct  948  ESEHEGF  954



>ref|XP_010652241.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Vitis vinifera]
Length=963

 Score =   318 bits (815),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 159/187 (85%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  768  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTYVE  827

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+P+LLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  828  MSPFMSANKIKRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  887

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QKHCV NT+ V        D   +   DPESK V ASG G PELA
Sbjct  888  RESIMHVLWETDRWLQKHCVSNTTNVNENLDTCNDEAKEEITDPESKTVPASGGGNPELA  947

Query  369  SDSNDTF  349
               ++ F
Sbjct  948  ESEHEGF  954



>gb|KFK37479.1| hypothetical protein AALP_AA4G262700 [Arabis alpina]
Length=964

 Score =   318 bits (814),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 159/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R+K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ Y
Sbjct  774  RSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVY  833

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
            VEMSPFM+ANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY
Sbjct  834  VEMSPFMNANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGY  893

Query  531  TARESIMHVLWETDRWVQKHCVPNTSKVDTD---TKVTEDPESKAVSASGAGVPELA  370
            +ARESIMHVLWETDRW+QK+CVPNTS+ DT+   TK + D   K  +A+G G PE  
Sbjct  894  SARESIMHVLWETDRWLQKYCVPNTSEADTNPDQTKESSDSAEKVATATGGGTPEFG  950



>ref|XP_012082895.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Jatropha curcas]
 ref|XP_012082896.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Jatropha curcas]
 gb|KDP28258.1| hypothetical protein JCGZ_14029 [Jatropha curcas]
Length=961

 Score =   316 bits (810),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 163/187 (87%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  767  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  826

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSAN+IKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY +
Sbjct  827  MSPFMSANRIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAS  886

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD--------TKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV NTS V+ +        +K   DPE KAV+ASG G  ELA
Sbjct  887  RESIMHVLWETDRWLQKYCVSNTSDVNAELDDSKDDVSKGVTDPEGKAVAASGGGGLELA  946

Query  369  SDSNDTF  349
               ++ F
Sbjct  947  DFEHEEF  953



>ref|XP_002515283.1| dipeptidyl-peptidase, putative [Ricinus communis]
 gb|EEF47267.1| dipeptidyl-peptidase, putative [Ricinus communis]
Length=926

 Score =   316 bits (809),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 161/188 (86%), Gaps = 8/188 (4%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
             K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYV
Sbjct  731  GKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATTTYV  790

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY 
Sbjct  791  EMSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYA  850

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPEL  373
            ARESIMHVLWETDRW+QK+CVPNTS V        D  +K   D E+ AV+A+G G PEL
Sbjct  851  ARESIMHVLWETDRWLQKYCVPNTSDVNAELGARKDEASKGVIDTENNAVAATGGGGPEL  910

Query  372  ASDSNDTF  349
            A   ++ F
Sbjct  911  ADSEHEGF  918



>gb|KJB49819.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=585

 Score =   306 bits (784),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  390  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  449

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSAN+IKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  450  MSPFMSANRIKKPILLIHGEEDNNAGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  509

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS  400
            RESIMHVLWETDRW+QKHCV NTS+V  D   ++D E K V+
Sbjct  510  RESIMHVLWETDRWLQKHCVSNTSEVSADIGKSKDGEGKEVT  551



>ref|XP_009378724.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=971

 Score =   313 bits (802),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  777  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  836

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY A
Sbjct  837  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYAA  896

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED--------PESKAVSASGAGVPELA  370
            RESIMHVLWE+DRW+QK+CV NTS V+ D+  +++         ESK+V+ASG G PE++
Sbjct  897  RESIMHVLWESDRWLQKYCVSNTSNVNADSDASKENLGTGSTYSESKSVAASGGGSPEVS  956

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  957  NSEHEGF  963



>ref|XP_008369043.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Malus domestica]
 ref|XP_008369044.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Malus domestica]
 ref|XP_008363721.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Malus domestica]
 ref|XP_008363722.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Malus domestica]
Length=971

 Score =   313 bits (801),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  777  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  836

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY A
Sbjct  837  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYAA  896

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED--------PESKAVSASGAGVPELA  370
            RESIMHVLWE+DRW+QK+CV NTS V+ D+  +++         ESK+V+ASG G PE++
Sbjct  897  RESIMHVLWESDRWLQKYCVSNTSNVNADSDASKENLSPGSTVSESKSVAASGGGGPEVS  956

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  957  NSEHEGF  963



>ref|XP_009378723.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=972

 Score =   313 bits (801),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  777  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  836

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY A
Sbjct  837  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYAA  896

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED--------PESKAVSASGAGVPELA  370
            RESIMHVLWE+DRW+QK+CV NTS V+ D+  +++         ESK+V+ASG G PE++
Sbjct  897  RESIMHVLWESDRWLQKYCVSNTSNVNADSDASKENLGTGSTYSESKSVAASGGGSPEVS  956

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  957  NSEHEGF  963



>ref|XP_008369041.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Malus domestica]
Length=972

 Score =   313 bits (801),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  777  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  836

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY A
Sbjct  837  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYAA  896

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED--------PESKAVSASGAGVPELA  370
            RESIMHVLWE+DRW+QK+CV NTS V+ D+  +++         ESK+V+ASG G PE++
Sbjct  897  RESIMHVLWESDRWLQKYCVSNTSNVNADSDASKENLSPGSTVSESKSVAASGGGGPEVS  956

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  957  NSEHEGF  963



>ref|XP_006397934.1| hypothetical protein EUTSA_v10001294mg [Eutrema salsugineum]
 gb|ESQ39387.1| hypothetical protein EUTSA_v10001294mg [Eutrema salsugineum]
Length=956

 Score =   312 bits (800),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 161/189 (85%), Gaps = 9/189 (5%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  760  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  819

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+ YVEMSPFM+ANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  820  EDRTLWEATNVYVEMSPFMAANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  879

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSA  397
            RLV+LP+ESHGY+ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  +A
Sbjct  880  RLVVLPYESHGYSARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVATA  939

Query  396  SGAGVPELA  370
            +G G PE  
Sbjct  940  TGGGNPEFG  948



>ref|XP_010544967.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=960

 Score =   312 bits (800),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 162/186 (87%), Gaps = 7/186 (4%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  762  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  821

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+TYVEMSPFMSANKIKKPILL+HGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  822  EDRTLWEATNTYVEMSPFMSANKIKKPILLMHGEEDNNPGTLTMQSDRFFNALKGHGALC  881

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTE-DPESKAVSASG  391
            RLVILP ESHGY+ARESIMHVLWETDRW+QKHCVPNT + DT  + ++ D   KA + +G
Sbjct  882  RLVILPLESHGYSARESIMHVLWETDRWLQKHCVPNTLEEDTKKEASDSDSADKAAAGTG  941

Query  390  AGVPEL  373
               PEL
Sbjct  942  GCNPEL  947



>ref|XP_010544966.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=961

 Score =   312 bits (799),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 162/186 (87%), Gaps = 7/186 (4%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  762  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  821

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+TYVEMSPFMSANKIKKPILL+HGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  822  EDRTLWEATNTYVEMSPFMSANKIKKPILLMHGEEDNNPGTLTMQSDRFFNALKGHGALC  881

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTE-DPESKAVSASG  391
            RLVILP ESHGY+ARESIMHVLWETDRW+QKHCVPNT + DT  + ++ D   KA + +G
Sbjct  882  RLVILPLESHGYSARESIMHVLWETDRWLQKHCVPNTLEEDTKKEASDSDSADKAAAGTG  941

Query  390  AGVPEL  373
               PEL
Sbjct  942  GCNPEL  947



>ref|XP_008235148.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Prunus mume]
Length=966

 Score =   312 bits (799),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV+
Sbjct  772  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVK  831

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEED+NPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY +
Sbjct  832  MSPFMSANKIKKPILLIHGEEDSNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYAS  891

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTK--------VTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV +TS V+ D          V+ D ESKA++ASG   PE++
Sbjct  892  RESIMHVLWETDRWLQKYCVSHTSTVNVDPDASKDDSGTVSTDSESKAIAASGGSGPEVS  951

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  952  NTEHEGF  958



>ref|XP_008235149.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Prunus mume]
Length=966

 Score =   312 bits (799),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV+
Sbjct  772  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVK  831

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEED+NPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY +
Sbjct  832  MSPFMSANKIKKPILLIHGEEDSNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYAS  891

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTK--------VTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV +TS V+ D          V+ D ESKA++ASG   PE++
Sbjct  892  RESIMHVLWETDRWLQKYCVSHTSTVNVDPDASKDDSGTVSTDSESKAIAASGGSGPEVS  951

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  952  NTEHEGF  958



>ref|XP_007051106.1| Prolyl oligopeptidase family protein [Theobroma cacao]
 gb|EOX95263.1| Prolyl oligopeptidase family protein [Theobroma cacao]
Length=974

 Score =   311 bits (798),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 158/187 (84%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  780  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATTTYVE  839

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILL+HGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  840  MSPFMSANKIKKPILLVHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  899

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDP--------ESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV NTS +      ++D         E+K V+ASG    ELA
Sbjct  900  RESIMHVLWETDRWLQKYCVSNTSDISAGLDTSKDAASDEVTESENKVVAASGGSGAELA  959

Query  369  SDSNDTF  349
               N+ F
Sbjct  960  DSENEEF  966



>gb|AAL57645.1| At2g47390/T8I13.23 [Arabidopsis thaliana]
 gb|AAO11566.1| At2g47390/T8I13.23 [Arabidopsis thaliana]
Length=960

 Score =   311 bits (796),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 155/177 (88%), Gaps = 3/177 (2%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R+K AVGGHSYGAFMTANLLAHAPHLF+CGIARSGAYNRTLTPFGFQNEDRTLWEAT+ Y
Sbjct  771  RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY  830

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
            VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LP ESHGY
Sbjct  831  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY  890

Query  531  TARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELA  370
            +ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  + +G G PE  
Sbjct  891  SARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVSTGTGGGNPEFG  947



>emb|CDY27492.1| BnaC04g51330D [Brassica napus]
Length=953

 Score =   311 bits (796),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 155/176 (88%), Gaps = 3/176 (2%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  764  SKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYV  823

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY+
Sbjct  824  EMSPFMSADKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYS  883

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELA  370
            ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  +A+G G PE  
Sbjct  884  ARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEESDSADKVATATGGGNPEFG  939



>sp|Q8VZF3.2|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
Length=960

 Score =   311 bits (796),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 155/177 (88%), Gaps = 3/177 (2%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R+K AVGGHSYGAFMTANLLAHAPHLF+CGIARSGAYNRTLTPFGFQNEDRTLWEAT+ Y
Sbjct  771  RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY  830

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
            VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LP ESHGY
Sbjct  831  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY  890

Query  531  TARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELA  370
            +ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  + +G G PE  
Sbjct  891  SARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVSTGTGGGNPEFG  947



>ref|NP_850473.1| probable glutamyl endopeptidase [Arabidopsis thaliana]
 gb|AEC10835.1| probable glutamyl endopeptidase [Arabidopsis thaliana]
Length=961

 Score =   311 bits (796),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 155/177 (88%), Gaps = 3/177 (2%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R+K AVGGHSYGAFMTANLLAHAPHLF+CGIARSGAYNRTLTPFGFQNEDRTLWEAT+ Y
Sbjct  772  RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY  831

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
            VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LP ESHGY
Sbjct  832  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY  891

Query  531  TARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELA  370
            +ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  + +G G PE  
Sbjct  892  SARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVSTGTGGGNPEFG  948



>gb|AAB63841.1| unknown protein [Arabidopsis thaliana]
Length=955

 Score =   310 bits (795),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 155/177 (88%), Gaps = 3/177 (2%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R+K AVGGHSYGAFMTANLLAHAPHLF+CGIARSGAYNRTLTPFGFQNEDRTLWEAT+ Y
Sbjct  766  RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY  825

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
            VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LP ESHGY
Sbjct  826  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY  885

Query  531  TARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELA  370
            +ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  + +G G PE  
Sbjct  886  SARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVSTGTGGGNPEFG  942



>ref|XP_010507894.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Camelina 
sativa]
Length=959

 Score =   310 bits (793),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 159/189 (84%), Gaps = 9/189 (5%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  758  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  817

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+ YVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  818  EDRTLWEATNVYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  877

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSA  397
            RLV+LP ESHGY+ARESIMHVLWETDRW+QK+CVPNTS  DT    +K   D   K  + 
Sbjct  878  RLVVLPHESHGYSARESIMHVLWETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVAAG  937

Query  396  SGAGVPELA  370
            +G G PE  
Sbjct  938  TGGGNPEFG  946



>ref|XP_009142541.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Brassica rapa]
Length=945

 Score =   309 bits (792),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  760  SKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYV  819

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY+
Sbjct  820  EMSPFMSADKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYS  879

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTD---TKVTEDPESKAVSASGAGVPELASDSN  358
            ARESIMHVLWETDRW+QK+CVPNTS  D+    +K   D   K  +A+G G PE    S 
Sbjct  880  ARESIMHVLWETDRWLQKYCVPNTSDADSSPDKSKEGSDSADKVATATGGGNPEFEDHSK  939



>gb|KHG24720.1| putative glutamyl endopeptidase, chloroplastic -like protein 
[Gossypium arboreum]
Length=896

 Score =   308 bits (790),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  701  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  760

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSAN+IKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  761  MSPFMSANRIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  820

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS  400
            RESIMHVLWETDRW+QKHCV NTS+V  D    +D E K V+
Sbjct  821  RESIMHVLWETDRWLQKHCVSNTSEVSADIGKNKDGEGKEVT  862



>ref|XP_009142540.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Brassica rapa]
Length=946

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  760  SKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYV  819

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY+
Sbjct  820  EMSPFMSADKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYS  879

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTD---TKVTEDPESKAVSASGAGVPELASDSN  358
            ARESIMHVLWETDRW+QK+CVPNTS  D+    +K   D   K  +A+G G PE    S 
Sbjct  880  ARESIMHVLWETDRWLQKYCVPNTSDADSSPDKSKEGSDSADKVATATGGGNPEFEDHSK  939



>emb|CDX80100.1| BnaA05g00560D [Brassica napus]
Length=946

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  760  SKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYV  819

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY+
Sbjct  820  EMSPFMSADKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYS  879

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTD---TKVTEDPESKAVSASGAGVPELASDSN  358
            ARESIMHVLWETDRW+QK+CVPNTS  D+    +K   D   K  +A+G G PE    S 
Sbjct  880  ARESIMHVLWETDRWLQKYCVPNTSDADSSPDKSKEGSDSADKVATATGGGNPEFEDHSK  939



>ref|XP_006444496.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 ref|XP_006492337.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR57736.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 gb|KDO86996.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=953

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 161/189 (85%), Gaps = 14/189 (7%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQN
Sbjct  746  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQN  805

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEATSTYVEMSPFMSANK+KKPILL+HGEEDNN GTLTMQSDRFFNALKGHGALC
Sbjct  806  EDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALC  865

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA------  406
            RLVILPFESHGY ARESIMHVLWETDRW+QK+CV NT+   TD KV++D ESK       
Sbjct  866  RLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQN  925

Query  405  --VSASGAG  385
              V+ASG G
Sbjct  926  KTVAASGGG  934



>ref|XP_007200322.1| hypothetical protein PRUPE_ppa000899mg [Prunus persica]
 gb|EMJ01521.1| hypothetical protein PRUPE_ppa000899mg [Prunus persica]
Length=967

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 164/187 (88%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV+
Sbjct  772  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVK  831

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEED+N GTLTMQSDRFFNALKGHGALCRLVILP+ESHGY +
Sbjct  832  MSPFMSANKIKKPILLIHGEEDSNSGTLTMQSDRFFNALKGHGALCRLVILPYESHGYAS  891

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTE--------DPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV +TS V+ D  V++        D ESKA++ASG   PE++
Sbjct  892  RESIMHVLWETDRWLQKYCVSHTSTVNVDPDVSKDNSGTVSTDSESKAIAASGGSGPEVS  951

Query  369  SDSNDTF  349
            +  ++ F
Sbjct  952  NTEHEGF  958



>gb|KDO86997.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=954

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 161/189 (85%), Gaps = 14/189 (7%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQN
Sbjct  746  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQN  805

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEATSTYVEMSPFMSANK+KKPILL+HGEEDNN GTLTMQSDRFFNALKGHGALC
Sbjct  806  EDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALC  865

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA------  406
            RLVILPFESHGY ARESIMHVLWETDRW+QK+CV NT+   TD KV++D ESK       
Sbjct  866  RLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQN  925

Query  405  --VSASGAG  385
              V+ASG G
Sbjct  926  KTVAASGGG  934



>ref|XP_006492336.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=969

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 156/176 (89%), Gaps = 8/176 (5%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV
Sbjct  775  SKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  834

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSANK+KKPILL+HGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY 
Sbjct  835  EMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYA  894

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA--------VSASGAG  385
            ARESIMHVLWETDRW+QK+CV NT+   TD KV++D ESK         V+ASG G
Sbjct  895  ARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQNKTVAASGGG  950



>gb|KDO86995.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=958

 Score =   309 bits (791),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 161/189 (85%), Gaps = 14/189 (7%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQN
Sbjct  746  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQN  805

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEATSTYVEMSPFMSANK+KKPILL+HGEEDNN GTLTMQSDRFFNALKGHGALC
Sbjct  806  EDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALC  865

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA------  406
            RLVILPFESHGY ARESIMHVLWETDRW+QK+CV NT+   TD KV++D ESK       
Sbjct  866  RLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQN  925

Query  405  --VSASGAG  385
              V+ASG G
Sbjct  926  KTVAASGGG  934



>ref|XP_011041192.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Populus euphratica]
Length=954

 Score =   308 bits (790),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 156/187 (83%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  760  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATGTYVE  819

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCR  ILPFESHGY A
Sbjct  820  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRPAILPFESHGYAA  879

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESK--------AVSASGAGVPELA  370
            RESI+HVLWETDRW+QKHCVPN+S    +    +D ESK        AV ASG G PELA
Sbjct  880  RESILHVLWETDRWLQKHCVPNSSDASAELDACKDEESKGVADSDKQAVVASGGGGPELA  939

Query  369  SDSNDTF  349
               ++ F
Sbjct  940  DFEHEGF  946



>ref|XP_010506775.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Camelina 
sativa]
Length=959

 Score =   308 bits (790),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 159/189 (84%), Gaps = 9/189 (5%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  758  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  817

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+ YVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  818  EDRTLWEATNVYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  877

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSA  397
            RLV+LP ESHGY+ARESIMHVLWETDRW+QK+CVPNT+  DT    +K   D   K  + 
Sbjct  878  RLVVLPHESHGYSARESIMHVLWETDRWLQKYCVPNTADADTSPDQSKEGSDTADKVAAG  937

Query  396  SGAGVPELA  370
            +G G PE  
Sbjct  938  TGGGNPEFG  946



>ref|XP_011041183.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Populus euphratica]
Length=958

 Score =   308 bits (790),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 156/187 (83%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  764  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATGTYVE  823

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCR  ILPFESHGY A
Sbjct  824  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRPAILPFESHGYAA  883

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESK--------AVSASGAGVPELA  370
            RESI+HVLWETDRW+QKHCVPN+S    +    +D ESK        AV ASG G PELA
Sbjct  884  RESILHVLWETDRWLQKHCVPNSSDASAELDACKDEESKGVADSDKQAVVASGGGGPELA  943

Query  369  SDSNDTF  349
               ++ F
Sbjct  944  DFEHEGF  950



>ref|XP_010518438.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Camelina sativa]
Length=960

 Score =   308 bits (790),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 159/189 (84%), Gaps = 9/189 (5%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  759  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  818

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+ YVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  819  EDRTLWEATNVYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  878

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSA  397
            RLV+LP ESHGY+ARESIMHVLWETDRW+QK+CVPNT+  DT    +K   D   K  + 
Sbjct  879  RLVVLPHESHGYSARESIMHVLWETDRWLQKYCVPNTADADTSPDQSKEGSDTADKVAAG  938

Query  396  SGAGVPELA  370
            +G G PE  
Sbjct  939  TGGGNPEFG  947



>ref|XP_010518437.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Camelina sativa]
Length=960

 Score =   308 bits (790),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 159/189 (84%), Gaps = 9/189 (5%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN
Sbjct  759  AVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  818

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            EDRTLWEAT+ YVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC
Sbjct  819  EDRTLWEATNVYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  878

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSA  397
            RLV+LP ESHGY+ARESIMHVLWETDRW+QK+CVPNT+  DT    +K   D   K  + 
Sbjct  879  RLVVLPHESHGYSARESIMHVLWETDRWLQKYCVPNTADADTSPDQSKEGSDTADKVAAG  938

Query  396  SGAGVPELA  370
            +G G PE  
Sbjct  939  TGGGNPEFG  947



>gb|KJB49818.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=830

 Score =   306 bits (783),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  635  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  694

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSAN+IKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  695  MSPFMSANRIKKPILLIHGEEDNNAGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  754

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS  400
            RESIMHVLWETDRW+QKHCV NTS+V  D   ++D E K V+
Sbjct  755  RESIMHVLWETDRWLQKHCVSNTSEVSADIGKSKDGEGKEVT  796



>ref|XP_006375435.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|ERP53232.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=957

 Score =   308 bits (789),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 158/187 (84%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  763  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATGTYVE  822

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  823  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  882

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESI+HVLWETDRW+QKHCV N+S          D  +K   D +++AV ASG G PELA
Sbjct  883  RESILHVLWETDRWLQKHCVSNSSDASAELDACKDEVSKGVTDSDNQAVVASGGGGPELA  942

Query  369  SDSNDTF  349
               ++ F
Sbjct  943  DFEHEGF  949



>ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]
Length=962

 Score =   308 bits (789),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 154/176 (88%), Gaps = 3/176 (2%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  773  SKIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYV  832

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LP ESHGY+
Sbjct  833  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGYS  892

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTDT---KVTEDPESKAVSASGAGVPELA  370
            ARESIMHVLWETDRW+QK+CVPNT+  DT+    K   D   K  + +G G PE  
Sbjct  893  ARESIMHVLWETDRWLQKYCVPNTADADTNPDQFKEGSDSSDKVATGTGGGNPEFG  948



>ref|XP_010679383.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=764

 Score =   304 bits (778),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 6/182 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CG+ARSGAYNRTLTPFGFQNEDRTLWE T+TY+E
Sbjct  573  KIAVGGHSYGAFMTANLLAHAPHLFCCGVARSGAYNRTLTPFGFQNEDRTLWEVTNTYIE  632

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+PILL+HGEEDNN GTLTMQS+RF+ ALKGHGALCRLVILP+ESHGY+A
Sbjct  633  MSPFMSANKIKRPILLVHGEEDNNSGTLTMQSERFYTALKGHGALCRLVILPYESHGYSA  692

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDT------KVTEDPESKAVSASGAGVPELASD  364
            RESIMHVLWETDRW+QKHCV NTS+++ D          E+ ESK +SA+G GV E+   
Sbjct  693  RESIMHVLWETDRWLQKHCVSNTSEINADIGSLKKEDSAENAESKVISATGGGVAEMEEP  752

Query  363  SN  358
             N
Sbjct  753  EN  754



>gb|EEC75088.1| hypothetical protein OsI_11240 [Oryza sativa Indica Group]
Length=887

 Score =   306 bits (785),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 2/169 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  689  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  748

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  749  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  808

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVP  379
            RESIMHVLWETDRW+QK+C+  +SK D+D+    D E+K VSASG G P
Sbjct  809  RESIMHVLWETDRWLQKYCLSGSSKTDSDS--VADTENKTVSASGGGAP  855



>gb|EEE58916.1| hypothetical protein OsJ_10563 [Oryza sativa Japonica Group]
Length=920

 Score =   307 bits (786),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 2/169 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  722  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  781

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  782  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  841

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVP  379
            RESIMHVLWETDRW+QK+C+  +SK D+D+    D E+K VSASG G P
Sbjct  842  RESIMHVLWETDRWLQKYCLSGSSKTDSDS--VADTENKTVSASGGGAP  888



>ref|XP_002320974.2| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|EEE99289.2| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=967

 Score =   307 bits (787),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 158/187 (84%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  773  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATGTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESI+HVLWETDRW+QKHCV N+S          D  +K   D +++AV ASG G PELA
Sbjct  893  RESILHVLWETDRWLQKHCVSNSSDASAELDACKDEVSKGVTDSDNQAVVASGGGGPELA  952

Query  369  SDSNDTF  349
               ++ F
Sbjct  953  DFEHEGF  959



>ref|XP_006375436.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|ERP53233.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=968

 Score =   307 bits (787),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 158/187 (84%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVE
Sbjct  773  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATGTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESI+HVLWETDRW+QKHCV N+S          D  +K   D +++AV ASG G PELA
Sbjct  893  RESILHVLWETDRWLQKHCVSNSSDASAELDACKDEVSKGVTDSDNQAVVASGGGGPELA  952

Query  369  SDSNDTF  349
               ++ F
Sbjct  953  DFEHEGF  959



>ref|XP_008386780.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Malus domestica]
Length=969

 Score =   307 bits (787),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 161/188 (86%), Gaps = 9/188 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  773  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEED+N GTLTMQSDRFFNALKGHGAL RLVILPFESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDSNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYAA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED---------PESKAVSASGAGVPEL  373
            RESIMHVLWE+DRW+QK+CV +TS V+ D+  +E           ESK V+ASG G PE 
Sbjct  893  RESIMHVLWESDRWLQKYCVSDTSNVNADSDASEKENLGTGSTASESKPVAASGGGGPEA  952

Query  372  ASDSNDTF  349
            ++  ++ F
Sbjct  953  SNSXHEGF  960



>ref|NP_001049893.1| Os03g0307100 [Oryza sativa Japonica Group]
 sp|Q10MJ1.1|CGEP_ORYSJ RecName: Full=Probable glutamyl endopeptidase, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF95536.1| prolyl oligopeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11807.1| Os03g0307100 [Oryza sativa Japonica Group]
Length=938

 Score =   306 bits (785),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 154/169 (91%), Gaps = 2/169 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  755  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  814

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  815  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  874

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVP  379
            RESIMHVLWETDRW+QK+C+  +SK D+D+    D E+K VSASG G P
Sbjct  875  RESIMHVLWETDRWLQKYCLSGSSKTDSDS--VADTENKTVSASGGGAP  921



>ref|XP_004229392.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Solanum 
lycopersicum]
Length=977

 Score =   307 bits (787),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 160/186 (86%), Gaps = 9/186 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNE+RTLWEATSTYVE
Sbjct  786  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATSTYVE  845

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  846  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  905

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKV-------TEDPESKAVSASGAGVPELAS  367
            RESIMH LWETDRW+QKHCV  +S V  D  V       T D +SKAV A+G GV ELA+
Sbjct  906  RESIMHTLWETDRWLQKHCV-YSSNVKADGSVCKDNAEGTVDSQSKAVGAAG-GVQELAN  963

Query  366  DSNDTF  349
              +D F
Sbjct  964  LDDDQF  969



>emb|CDY55377.1| BnaC04g51960D [Brassica napus]
Length=939

 Score =   306 bits (785),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAP+LFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  753  SKIAVGGHSYGAFMTANLLAHAPYLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYV  812

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY+
Sbjct  813  EMSPFMSADKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYS  872

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELASDSN  358
            ARESIMHVLWETDRW+QK+CVPNTS  D+    +K   D   +  +A+G G PE    S 
Sbjct  873  ARESIMHVLWETDRWLQKYCVPNTSDADSSPDQSKEISDSADRVATATGGGNPEFEDHSK  932



>dbj|BAJ95615.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 153/182 (84%), Gaps = 5/182 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  163  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  222

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+PILLIHGE+DNN GTLTMQSDRFFNALKGHG   RLVILPFESHGY+A
Sbjct  223  MSPFMSANKIKRPILLIHGEQDNNSGTLTMQSDRFFNALKGHGVQSRLVILPFESHGYSA  282

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASG--AGVPELASDSNDT  352
            RESIMHVLWE+DRW+QK+CV  TSK D++         K +SASG  A    L+SD   +
Sbjct  283  RESIMHVLWESDRWLQKYCVNGTSKADSEAAAD---GGKTLSASGGVAASEGLSSDGFSS  339

Query  351  FP  346
             P
Sbjct  340  IP  341



>ref|XP_010259303.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010259304.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Nelumbo nucifera]
Length=963

 Score =   306 bits (784),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 154/187 (82%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  769  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  828

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LPFESHGY A
Sbjct  829  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYAA  888

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD--------TKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+C+ N+S +  D         K  +D   KAVS  G G  E  
Sbjct  889  RESIMHVLWETDRWLQKYCISNSSDIVADRDDCKVDGNKAKDDLGGKAVSVGGEGGQEQD  948

Query  369  SDSNDTF  349
                D F
Sbjct  949  DVDQDEF  955



>ref|XP_010259302.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=964

 Score =   306 bits (784),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 154/187 (82%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  769  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  828

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LPFESHGY A
Sbjct  829  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYAA  888

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD--------TKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+C+ N+S +  D         K  +D   KAVS  G G  E  
Sbjct  889  RESIMHVLWETDRWLQKYCISNSSDIVADRDDCKVDGNKAKDDLGGKAVSVGGEGGQEQD  948

Query  369  SDSNDTF  349
                D F
Sbjct  949  DVDQDEF  955



>gb|KJB49821.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=961

 Score =   306 bits (783),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  766  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  825

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSAN+IKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  826  MSPFMSANRIKKPILLIHGEEDNNAGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  885

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS  400
            RESIMHVLWETDRW+QKHCV NTS+V  D   ++D E K V+
Sbjct  886  RESIMHVLWETDRWLQKHCVSNTSEVSADIGKSKDGEGKEVT  927



>gb|KJB49822.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=964

 Score =   306 bits (783),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  766  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  825

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSAN+IKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  826  MSPFMSANRIKKPILLIHGEEDNNAGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  885

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS  400
            RESIMHVLWETDRW+QKHCV NTS+V  D   ++D E K V+
Sbjct  886  RESIMHVLWETDRWLQKHCVSNTSEVSADIGKSKDGEGKEVT  927



>ref|XP_006349188.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Solanum tuberosum]
Length=976

 Score =   306 bits (783),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 159/185 (86%), Gaps = 7/185 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNE+RTLWEATSTYVE
Sbjct  785  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATSTYVE  844

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  845  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  904

Query  525  RESIMHVLWETDRWVQKHCV------PNTSKVDTDTKVTEDPESKAVSASGAGVPELASD  364
            RESIMH LWETDRW+QKHCV       + S    + + T D +SKAV A+G GV ELA+ 
Sbjct  905  RESIMHTLWETDRWLQKHCVYSSDVKADVSACKDNAEGTVDSQSKAVGAAG-GVQELANL  963

Query  363  SNDTF  349
             +D F
Sbjct  964  DDDQF  968



>ref|XP_009774674.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Nicotiana sylvestris]
Length=809

 Score =   303 bits (775),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 159/186 (85%), Gaps = 9/186 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNE+RTLWEAT+TYVE
Sbjct  607  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATNTYVE  666

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  667  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  726

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKV-------TEDPESKAVSASGAGVPELAS  367
            RESIMHVLWETDRW+QKHC   +S V  D          T D +SKAV A+G GV ELA+
Sbjct  727  RESIMHVLWETDRWLQKHCA-YSSDVKADLNACKDNAEGTVDSQSKAVGAAG-GVQELAN  784

Query  366  DSNDTF  349
              +D F
Sbjct  785  LDDDKF  790



>ref|XP_010938262.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Elaeis guineensis]
Length=951

 Score =   305 bits (781),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 156/172 (91%), Gaps = 4/172 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  762  KVAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  821

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  822  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  881

Query  525  RESIMHVLWETDRWVQKHCVPNTSK-VDTDTKVTE---DPESKAVSASGAGV  382
            RESIMHVLWET+RW+QK+CV N+ K  D D   TE   D E+KA+SASG G+
Sbjct  882  RESIMHVLWETNRWLQKYCVNNSDKPADPDASNTESLNDIENKALSASGGGL  933



>ref|XP_011465337.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=954

 Score =   305 bits (781),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 158/185 (85%), Gaps = 8/185 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF+CG+ARSGAYNRTLTPFGFQNE+RTLWEATSTYVE
Sbjct  760  KIAVGGHSYGAFMTANLLAHAPHLFACGVARSGAYNRTLTPFGFQNEERTLWEATSTYVE  819

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  820  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  879

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED--------PESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV +TS V+ D    +D         E+K V+  G    E++
Sbjct  880  RESIMHVLWETDRWLQKYCVSDTSDVNVDEDACKDNVGTGSTNSENKTVATGGGSASEVS  939

Query  369  SDSND  355
            S  ++
Sbjct  940  SSEHE  944



>ref|XP_004300449.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=955

 Score =   305 bits (781),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 158/185 (85%), Gaps = 8/185 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF+CG+ARSGAYNRTLTPFGFQNE+RTLWEATSTYVE
Sbjct  761  KIAVGGHSYGAFMTANLLAHAPHLFACGVARSGAYNRTLTPFGFQNEERTLWEATSTYVE  820

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  821  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAA  880

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED--------PESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK+CV +TS V+ D    +D         E+K V+  G    E++
Sbjct  881  RESIMHVLWETDRWLQKYCVSDTSDVNVDEDACKDNVGTGSTNSENKTVATGGGSASEVS  940

Query  369  SDSND  355
            S  ++
Sbjct  941  SSEHE  945



>ref|XP_002301512.2| hypothetical protein POPTR_0002s19700g [Populus trichocarpa]
 gb|EEE80785.2| hypothetical protein POPTR_0002s19700g [Populus trichocarpa]
Length=952

 Score =   304 bits (779),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 157/187 (84%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ+EDRTLWEAT+TYVE
Sbjct  751  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQHEDRTLWEATTTYVE  810

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTL MQSDRFFNALKGHGALCRLVILPFESHGY A
Sbjct  811  MSPFMSANKIKKPILLIHGEEDNNSGTLNMQSDRFFNALKGHGALCRLVILPFESHGYAA  870

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QKHCV N +          D  +K   D +++AV ASG G PELA
Sbjct  871  RESIMHVLWETDRWLQKHCVQNPTDASAELDACKDEVSKGVRDSDNQAVVASGGGGPELA  930

Query  369  SDSNDTF  349
               ++ F
Sbjct  931  DFEHEGF  937



>ref|XP_009774673.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=964

 Score =   304 bits (779),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 159/186 (85%), Gaps = 9/186 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNE+RTLWEAT+TYVE
Sbjct  773  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATNTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKV-------TEDPESKAVSASGAGVPELAS  367
            RESIMHVLWETDRW+QKHC   +S V  D          T D +SKAV A+G GV ELA+
Sbjct  893  RESIMHVLWETDRWLQKHCA-YSSDVKADLNACKDNAEGTVDSQSKAVGAAG-GVQELAN  950

Query  366  DSNDTF  349
              +D F
Sbjct  951  LDDDKF  956



>ref|XP_010679382.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=965

 Score =   304 bits (778),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 157/182 (86%), Gaps = 6/182 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CG+ARSGAYNRTLTPFGFQNEDRTLWE T+TY+E
Sbjct  774  KIAVGGHSYGAFMTANLLAHAPHLFCCGVARSGAYNRTLTPFGFQNEDRTLWEVTNTYIE  833

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+PILL+HGEEDNN GTLTMQS+RF+ ALKGHGALCRLVILP+ESHGY+A
Sbjct  834  MSPFMSANKIKRPILLVHGEEDNNSGTLTMQSERFYTALKGHGALCRLVILPYESHGYSA  893

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDT------KVTEDPESKAVSASGAGVPELASD  364
            RESIMHVLWETDRW+QKHCV NTS+++ D          E+ ESK +SA+G GV E+   
Sbjct  894  RESIMHVLWETDRWLQKHCVSNTSEINADIGSLKKEDSAENAESKVISATGGGVAEMEEP  953

Query  363  SN  358
             N
Sbjct  954  EN  955



>ref|XP_009774672.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=975

 Score =   303 bits (777),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 159/186 (85%), Gaps = 9/186 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNE+RTLWEAT+TYVE
Sbjct  773  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATNTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKV-------TEDPESKAVSASGAGVPELAS  367
            RESIMHVLWETDRW+QKHC   +S V  D          T D +SKAV A+G GV ELA+
Sbjct  893  RESIMHVLWETDRWLQKHCA-YSSDVKADLNACKDNAEGTVDSQSKAVGAAG-GVQELAN  950

Query  366  DSNDTF  349
              +D F
Sbjct  951  LDDDKF  956



>ref|XP_011042249.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Populus 
euphratica]
 ref|XP_011042250.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Populus 
euphratica]
Length=936

 Score =   303 bits (775),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 154/180 (86%), Gaps = 8/180 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ+EDRTLWEAT+TYVE
Sbjct  755  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQHEDRTLWEATTTYVE  814

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKG GALCRLVILPFESHGY A
Sbjct  815  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGLGALCRLVILPFESHGYAA  874

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--------DTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QKHCV N S          D  +K   D +++AV ASG G PELA
Sbjct  875  RESIMHVLWETDRWLQKHCVQNPSDASAELDACKDEVSKGVRDSDNQAVVASGGGGPELA  934



>gb|EMT29865.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=854

 Score =   301 bits (771),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 159/182 (87%), Gaps = 4/182 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  670  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  729

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIK+PILLIHGE+DNN GTLTMQSDRFFNALKGHG   RLVILPFESHGY+A
Sbjct  730  MSPFMSANKIKRPILLIHGEQDNNSGTLTMQSDRFFNALKGHGVQSRLVILPFESHGYSA  789

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAG-VPE-LASDSNDT  352
            RESIMHVLWE+DRW+QK+CV  TSK D++T    D ESK ++ASG G  PE L+SD   +
Sbjct  790  RESIMHVLWESDRWLQKYCVNGTSKADSETAA--DGESKTLAASGGGAAPEGLSSDGFSS  847

Query  351  FP  346
             P
Sbjct  848  IP  849



>gb|ERN02133.1| hypothetical protein AMTR_s00045p00176400 [Amborella trichopoda]
Length=899

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 9/180 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNE+RTLWEAT+ YVE
Sbjct  706  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEERTLWEATNIYVE  765

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF++ANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LPFESHGY+A
Sbjct  766  MSPFIAANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYSA  825

Query  525  RESIMHVLWETDRWVQKHCVP--------NTSKVDTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK C+         NTSKVD   KV +D E + VSA+G G  E A
Sbjct  826  RESIMHVLWETDRWLQKFCINAPDTVSDINTSKVDESQKV-DDSEVEVVSATGGGESETA  884



>ref|XP_006649964.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Oryza brachyantha]
Length=851

 Score =   301 bits (770),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  668  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  727

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  728  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  787

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVP  379
            RESIMHVLWETDRW+Q +C+  TSK D+D+ V  D  +K +S SG G P
Sbjct  788  RESIMHVLWETDRWLQNYCLNGTSKTDSDSVV--DTGNKTLSTSGGGAP  834



>ref|XP_002467980.1| hypothetical protein SORBIDRAFT_01g037483 [Sorghum bicolor]
 gb|EER94978.1| hypothetical protein SORBIDRAFT_01g037483 [Sorghum bicolor]
Length=943

 Score =   302 bits (774),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  760  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  819

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  820  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  879

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV  TSKVD+ ++   D E+K +SASG 
Sbjct  880  RESIMHVLWETDRWLQNYCVNGTSKVDSVSEA--DSENKTLSASGG  923



>ref|XP_004494425.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=957

 Score =   302 bits (774),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 156/182 (86%), Gaps = 10/182 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  761  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  820

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGAL RLVILP+ESHGY+A
Sbjct  821  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALSRLVILPYESHGYSA  880

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--DTDT--------KVTEDPESKAVSASGAGVPE  376
            RESIMHVLWET RW+ K+CV NTS    D DT        K T D ESK V+ASG G  E
Sbjct  881  RESIMHVLWETGRWLHKYCVSNTSDAGEDNDTGTVKENISKGTTDAESKVVAASGGGSKE  940

Query  375  LA  370
            ++
Sbjct  941  VS  942



>ref|XP_004494424.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=960

 Score =   302 bits (774),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 156/182 (86%), Gaps = 10/182 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  764  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  823

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGAL RLVILP+ESHGY+A
Sbjct  824  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALSRLVILPYESHGYSA  883

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV--DTDT--------KVTEDPESKAVSASGAGVPE  376
            RESIMHVLWET RW+ K+CV NTS    D DT        K T D ESK V+ASG G  E
Sbjct  884  RESIMHVLWETGRWLHKYCVSNTSDAGEDNDTGTVKENISKGTTDAESKVVAASGGGSKE  943

Query  375  LA  370
            ++
Sbjct  944  VS  945



>ref|XP_006840458.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Amborella 
trichopoda]
Length=957

 Score =   302 bits (773),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 9/180 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNE+RTLWEAT+ YVE
Sbjct  764  KIAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEERTLWEATNIYVE  823

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF++ANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLV+LPFESHGY+A
Sbjct  824  MSPFIAANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYSA  883

Query  525  RESIMHVLWETDRWVQKHCVP--------NTSKVDTDTKVTEDPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+QK C+         NTSKVD   KV +D E + VSA+G G  E A
Sbjct  884  RESIMHVLWETDRWLQKFCINAPDTVSDINTSKVDESQKV-DDSEVEVVSATGGGESETA  942



>ref|XP_007163177.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
 gb|ESW35171.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
Length=951

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 157/189 (83%), Gaps = 10/189 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  755  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  814

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGAL RLVILP ESHGYTA
Sbjct  815  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALSRLVILPHESHGYTA  874

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWETDRW+ KHCV NTS  + D          +K T + E+K V+ SG G  E
Sbjct  875  RESIMHVLWETDRWLHKHCVSNTSVAEEDHETATVKEDVSKETTNAENKVVATSGGGSRE  934

Query  375  LASDSNDTF  349
            ++    + F
Sbjct  935  VSELEYEEF  943



>ref|XP_007163178.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
 gb|ESW35172.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
Length=953

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 157/189 (83%), Gaps = 10/189 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  755  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  814

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGAL RLVILP ESHGYTA
Sbjct  815  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALSRLVILPHESHGYTA  874

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWETDRW+ KHCV NTS  + D          +K T + E+K V+ SG G  E
Sbjct  875  RESIMHVLWETDRWLHKHCVSNTSVAEEDHETATVKEDVSKETTNAENKVVATSGGGSRE  934

Query  375  LASDSNDTF  349
            ++    + F
Sbjct  935  VSELEYEEF  943



>gb|KCW58332.1| hypothetical protein EUGRSUZ_H01015 [Eucalyptus grandis]
Length=971

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 154/187 (82%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K A+GGHSYGAFMTANLLAHAPHLF CG+ARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  773  KIAIGGHSYGAFMTANLLAHAPHLFCCGVARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSA+KIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLV+LPFESHGY A
Sbjct  833  MSPFMSAHKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYAA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA--------VSASGAGVPELA  370
            RESIMHVLWETDRW+QK+ V   S V TD    +D ESK         V ASG G PELA
Sbjct  893  RESIMHVLWETDRWLQKYSVSAASDVTTDVNSCKDAESKGVVGSEVKVVGASGGGNPELA  952

Query  369  SDSNDTF  349
                D  
Sbjct  953  DFDQDQL  959



>gb|KCW58331.1| hypothetical protein EUGRSUZ_H01015 [Eucalyptus grandis]
Length=967

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 154/187 (82%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K A+GGHSYGAFMTANLLAHAPHLF CG+ARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  773  KIAIGGHSYGAFMTANLLAHAPHLFCCGVARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSA+KIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLV+LPFESHGY A
Sbjct  833  MSPFMSAHKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYAA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA--------VSASGAGVPELA  370
            RESIMHVLWETDRW+QK+ V   S V TD    +D ESK         V ASG G PELA
Sbjct  893  RESIMHVLWETDRWLQKYSVSAASDVTTDVNSCKDAESKGVVGSEVKVVGASGGGNPELA  952

Query  369  SDSNDTF  349
                D  
Sbjct  953  DFDQDQL  959



>ref|XP_010069839.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Eucalyptus 
grandis]
Length=968

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 154/187 (82%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K A+GGHSYGAFMTANLLAHAPHLF CG+ARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  774  KIAIGGHSYGAFMTANLLAHAPHLFCCGVARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  833

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSA+KIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLV+LPFESHGY A
Sbjct  834  MSPFMSAHKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVVLPFESHGYAA  893

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA--------VSASGAGVPELA  370
            RESIMHVLWETDRW+QK+ V   S V TD    +D ESK         V ASG G PELA
Sbjct  894  RESIMHVLWETDRWLQKYSVSAASDVTTDVNSCKDAESKGVVGSEVKVVGASGGGNPELA  953

Query  369  SDSNDTF  349
                D  
Sbjct  954  DFDQDQL  960



>emb|CDY37804.1| BnaC04g00210D [Brassica napus]
Length=174

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = -2

Query  849  MTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKIKK  670
            MTANLLAH PHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YVEMSPFMSA+KIKK
Sbjct  1    MTANLLAHTPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATNVYVEMSPFMSADKIKK  60

Query  669  PILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTARESIMHVLWETD  490
            PILLI GEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY+ARESIMHVLWETD
Sbjct  61   PILLIRGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYSARESIMHVLWETD  120

Query  489  RWVQKHCVPNTSKVDT---DTKVTEDPESKAVSASGAGVPELASDS  361
            RW+QK+CVPNTS  D+    +K   D   +  +A+G G PE    S
Sbjct  121  RWLQKYCVPNTSDADSSPDQSKERSDSADRVATATGGGNPEFEDHS  166



>gb|KJB49820.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=962

 Score =   301 bits (771),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQ-NEDRTLWEATSTYV  709
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ NEDRTLWEAT+TYV
Sbjct  766  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQVNEDRTLWEATNTYV  825

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSAN+IKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+
Sbjct  826  EMSPFMSANRIKKPILLIHGEEDNNAGTLTMQSDRFFNALKGHGALCRLVILPFESHGYS  885

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS  400
            ARESIMHVLWETDRW+QKHCV NTS+V  D   ++D E K V+
Sbjct  886  ARESIMHVLWETDRWLQKHCVSNTSEVSADIGKSKDGEGKEVT  928



>gb|KHN19214.1| Putative glutamyl endopeptidase, chloroplastic [Glycine soja]
Length=970

 Score =   301 bits (771),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 158/189 (84%), Gaps = 10/189 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  758  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  817

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGYTA
Sbjct  818  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPHESHGYTA  877

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            +ESIMHVLWETDRW+ K+CV N+S+   D          +K T + ESK V+ SG G  E
Sbjct  878  KESIMHVLWETDRWLHKYCVSNSSEAGEDHATDTVKEHVSKGTTNAESKVVAPSGGGSRE  937

Query  375  LASDSNDTF  349
            ++    + F
Sbjct  938  VSDLEYEEF  946



>ref|XP_008813381.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Phoenix dactylifera]
Length=989

 Score =   301 bits (771),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 4/180 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  792  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  851

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKI+KPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  852  MSPFMSANKIRKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  911

Query  525  RESIMHVLWETDRWVQKHCVPNTSK-VDTDTKVTE---DPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV N+ K  D D   TE   D E+KA+SAS  G+ +   D +
Sbjct  912  RESIMHVLWETDSWLQKYCVNNSDKPADVDASNTESLNDIENKALSASRGGLGQEGWDQD  971



>ref|XP_008813382.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Phoenix dactylifera]
Length=981

 Score =   301 bits (770),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 4/180 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  792  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  851

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKI+KPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  852  MSPFMSANKIRKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  911

Query  525  RESIMHVLWETDRWVQKHCVPNTSK-VDTDTKVTE---DPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV N+ K  D D   TE   D E+KA+SAS  G+ +   D +
Sbjct  912  RESIMHVLWETDSWLQKYCVNNSDKPADVDASNTESLNDIENKALSASRGGLGQEGWDQD  971



>gb|KHN43458.1| Putative glutamyl endopeptidase, chloroplastic [Glycine soja]
Length=910

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 155/189 (82%), Gaps = 10/189 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFM ANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  713  KIAVGGHSYGAFMAANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  772

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANK+KKPILLIHGEEDNNPGTLTMQS RFFNALKGHGALCRLVILP ESHGYTA
Sbjct  773  MSPFMSANKVKKPILLIHGEEDNNPGTLTMQSGRFFNALKGHGALCRLVILPHESHGYTA  832

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWETDRW+ KHCV N+S    D          +K T D ESK V+ SG G  E
Sbjct  833  RESIMHVLWETDRWLYKHCVSNSSDAVEDHATGTVKEQVSKGTIDAESKVVATSGGGSGE  892

Query  375  LASDSNDTF  349
            ++    + F
Sbjct  893  VSDLEYEEF  901



>ref|XP_008813383.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X5 [Phoenix dactylifera]
Length=972

 Score =   300 bits (769),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 4/180 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  766  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  825

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKI+KPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  826  MSPFMSANKIRKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  885

Query  525  RESIMHVLWETDRWVQKHCVPNTSK-VDTDTKVTE---DPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV N+ K  D D   TE   D E+KA+SAS  G+ +   D +
Sbjct  886  RESIMHVLWETDSWLQKYCVNNSDKPADVDASNTESLNDIENKALSASRGGLGQEGWDQD  945



>ref|XP_008813380.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=994

 Score =   301 bits (770),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 4/180 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  788  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  847

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKI+KPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  848  MSPFMSANKIRKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  907

Query  525  RESIMHVLWETDRWVQKHCVPNTSK-VDTDTKVTE---DPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV N+ K  D D   TE   D E+KA+SAS  G+ +   D +
Sbjct  908  RESIMHVLWETDSWLQKYCVNNSDKPADVDASNTESLNDIENKALSASRGGLGQEGWDQD  967



>ref|XP_008813379.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=998

 Score =   300 bits (769),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 157/180 (87%), Gaps = 4/180 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  792  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  851

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKI+KPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  852  MSPFMSANKIRKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  911

Query  525  RESIMHVLWETDRWVQKHCVPNTSK-VDTDTKVTE---DPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV N+ K  D D   TE   D E+KA+SAS  G+ +   D +
Sbjct  912  RESIMHVLWETDSWLQKYCVNNSDKPADVDASNTESLNDIENKALSASRGGLGQEGWDQD  971



>ref|XP_006604741.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006604742.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X3 [Glycine max]
Length=948

 Score =   300 bits (767),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 155/189 (82%), Gaps = 10/189 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFM ANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  752  KIAVGGHSYGAFMAANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  811

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANK+KKPILLIHGEEDNNPGTLTMQS RFFNALKGHGALCRLVILP ESHGYTA
Sbjct  812  MSPFMSANKVKKPILLIHGEEDNNPGTLTMQSGRFFNALKGHGALCRLVILPHESHGYTA  871

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWETDRW+ KHCV N+S    D          +K T D ESK V+ SG G  E
Sbjct  872  RESIMHVLWETDRWLYKHCVSNSSDAVEDHATGTVKEQVSKGTIDAESKVVATSGGGSGE  931

Query  375  LASDSNDTF  349
            ++    + F
Sbjct  932  VSDLEYEEF  940



>ref|XP_004135992.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Cucumis 
sativus]
 gb|KGN45015.1| hypothetical protein Csa_7G407680 [Cucumis sativus]
Length=970

 Score =   300 bits (768),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV
Sbjct  776  SKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  835

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPF+SANKIKKPILLIHGEEDNNPGTL MQSDRFFNALKGHGALCRLV+LPFESHGY+
Sbjct  836  EMSPFISANKIKKPILLIHGEEDNNPGTLPMQSDRFFNALKGHGALCRLVVLPFESHGYS  895

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKV--DTDTKVTE-----DPESKAVSASGAGVPELA  370
            +RESIMHVLWETDRW++K+C  N S +  D D    E     D   K V+ SG G  E +
Sbjct  896  SRESIMHVLWETDRWLEKYCSSNASDLGQDGDKNKQEGNGAADSAGKVVAGSGGGDTESS  955

Query  369  SDSNDTF  349
            S  ND F
Sbjct  956  SPDNDGF  962



>ref|XP_006604740.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Glycine max]
Length=949

 Score =   300 bits (767),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 155/189 (82%), Gaps = 10/189 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFM ANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  752  KIAVGGHSYGAFMAANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  811

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANK+KKPILLIHGEEDNNPGTLTMQS RFFNALKGHGALCRLVILP ESHGYTA
Sbjct  812  MSPFMSANKVKKPILLIHGEEDNNPGTLTMQSGRFFNALKGHGALCRLVILPHESHGYTA  871

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWETDRW+ KHCV N+S    D          +K T D ESK V+ SG G  E
Sbjct  872  RESIMHVLWETDRWLYKHCVSNSSDAVEDHATGTVKEQVSKGTIDAESKVVATSGGGSGE  931

Query  375  LASDSNDTF  349
            ++    + F
Sbjct  932  VSDLEYEEF  940



>tpg|DAA45011.1| TPA: hypothetical protein ZEAMMB73_493989 [Zea mays]
Length=850

 Score =   298 bits (762),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  667  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  726

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  727  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  786

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV  TSKVD+ ++   D ++K +SASG 
Sbjct  787  RESIMHVLWETDRWLQNYCVNGTSKVDSVSEA--DSKNKTLSASGG  830



>ref|XP_009604951.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=964

 Score =   300 bits (767),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 158/186 (85%), Gaps = 9/186 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLA APHLF CGIARSGAYNRTLTPFGFQNE+RTLWEAT+TYVE
Sbjct  773  KIAVGGHSYGAFMTANLLARAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATNTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKV-------TEDPESKAVSASGAGVPELAS  367
            RESIMHVLWETDRW+QKHC   +S V  D          T D +SKAV A+G GV ELA+
Sbjct  893  RESIMHVLWETDRWLQKHCA-YSSDVKADLNACKDNAQGTVDSQSKAVGAAG-GVQELAN  950

Query  366  DSNDTF  349
              ++ F
Sbjct  951  LDDEKF  956



>ref|XP_010087237.1| putative glutamyl endopeptidase [Morus notabilis]
 gb|EXB28587.1| putative glutamyl endopeptidase [Morus notabilis]
Length=1305

 Score =   302 bits (774),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 160/187 (86%), Gaps = 8/187 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFM+ANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYV+
Sbjct  780  KIAVGGHSYGAFMSANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVD  839

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP ESHGY A
Sbjct  840  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPSESHGYAA  899

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTE--------DPESKAVSASGAGVPELA  370
            RESIMHVLWETDRW+Q++CV N S V+ D   ++        D E+K V+ASG G  E++
Sbjct  900  RESIMHVLWETDRWLQRYCVSNASDVNVDADGSKESSGAGATDSETKTVAASGGGGAEMS  959

Query  369  SDSNDTF  349
            +  ++ +
Sbjct  960  NFDDEGY  966



>ref|XP_009604950.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=976

 Score =   299 bits (766),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 158/186 (85%), Gaps = 9/186 (5%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLA APHLF CGIARSGAYNRTLTPFGFQNE+RTLWEAT+TYVE
Sbjct  773  KIAVGGHSYGAFMTANLLARAPHLFCCGIARSGAYNRTLTPFGFQNEERTLWEATNTYVE  832

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP+ESHGY A
Sbjct  833  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPYESHGYGA  892

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKV-------TEDPESKAVSASGAGVPELAS  367
            RESIMHVLWETDRW+QKHC   +S V  D          T D +SKAV A+G GV ELA+
Sbjct  893  RESIMHVLWETDRWLQKHCA-YSSDVKADLNACKDNAQGTVDSQSKAVGAAG-GVQELAN  950

Query  366  DSNDTF  349
              ++ F
Sbjct  951  LDDEKF  956



>ref|XP_008654909.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Zea mays]
Length=871

 Score =   297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  687  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  746

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  747  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  806

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV  TSKVD+ ++   D ++K +SASG 
Sbjct  807  RESIMHVLWETDRWLQNYCVNGTSKVDSVSEA--DSKNKTLSASGG  850



>ref|XP_008654905.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Zea mays]
Length=945

 Score =   298 bits (762),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  762  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  821

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  822  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  881

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV  TSKVD+ ++   D ++K +SASG 
Sbjct  882  RESIMHVLWETDRWLQNYCVNGTSKVDSVSEA--DSKNKTLSASGG  925



>ref|XP_008654901.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Zea mays]
Length=946

 Score =   297 bits (761),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  762  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  821

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  822  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  881

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV  TSKVD+ ++   D ++K +SASG 
Sbjct  882  RESIMHVLWETDRWLQNYCVNGTSKVDSVSEA--DSKNKTLSASGG  925



>ref|XP_010228712.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Brachypodium distachyon]
 ref|XP_010228713.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Brachypodium distachyon]
Length=931

 Score =   297 bits (760),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  748  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  807

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHG   RLVILPFESHGY+A
Sbjct  808  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGVQSRLVILPFESHGYSA  867

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAG  385
            RESIMHVLWE+DRW+QK+CV +TSK D+D+    D +++ +SASG G
Sbjct  868  RESIMHVLWESDRWLQKYCVNSTSKADSDS--VSDCKNETLSASGGG  912



>ref|XP_003558080.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Brachypodium distachyon]
Length=927

 Score =   296 bits (759),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  748  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  807

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHG   RLVILPFESHGY+A
Sbjct  808  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGVQSRLVILPFESHGYSA  867

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAG  385
            RESIMHVLWE+DRW+QK+CV +TSK D+D+    D +++ +SASG G
Sbjct  868  RESIMHVLWESDRWLQKYCVNSTSKADSDS--VSDCKNETLSASGGG  912



>ref|XP_010228711.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Brachypodium distachyon]
Length=943

 Score =   296 bits (758),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  748  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  807

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHG   RLVILPFESHGY+A
Sbjct  808  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGVQSRLVILPFESHGYSA  867

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAG  385
            RESIMHVLWE+DRW+QK+CV +TSK D+D+    D +++ +SASG G
Sbjct  868  RESIMHVLWESDRWLQKYCVNSTSKADSDS--VSDCKNETLSASGGG  912



>ref|XP_004984623.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=943

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHA HLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  760  KIAVGGHSYGAFMTANLLAHASHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  819

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  820  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  879

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV   SK D+++    D E+K +SASG 
Sbjct  880  RESIMHVLWETDRWLQNYCVNGASKADSNS--VTDSENKTLSASGG  923



>ref|XP_004984622.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=944

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHA HLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  760  KIAVGGHSYGAFMTANLLAHASHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  819

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+DNN GTLTMQSDRFFNALKGHGAL RLVILPFESHGY+A
Sbjct  820  MSPFMSANKIKKPILLIHGEQDNNSGTLTMQSDRFFNALKGHGALSRLVILPFESHGYSA  879

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGA  388
            RESIMHVLWETDRW+Q +CV   SK D+++    D E+K +SASG 
Sbjct  880  RESIMHVLWETDRWLQNYCVNGASKADSNS--VTDSENKTLSASGG  923



>gb|KEH24432.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=962

 Score =   296 bits (757),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 10/180 (6%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  766  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  825

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILP+ESHGY+A
Sbjct  826  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPYESHGYSA  885

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWET RW+ K+CV NTS    D          +K   D ESK V+ASG G  E
Sbjct  886  RESIMHVLWETGRWLHKYCVSNTSDAGEDHDTGTVKENISKGIADAESKVVAASGGGSKE  945



>gb|EYU46808.1| hypothetical protein MIMGU_mgv1a000875mg [Erythranthe guttata]
Length=953

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 7/175 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAP+LFSCGIARSGAYNRTLTPFGFQ+EDRTLWEA +TYVE
Sbjct  762  KIAVGGHSYGAFMTANLLAHAPNLFSCGIARSGAYNRTLTPFGFQSEDRTLWEAVNTYVE  821

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF+SANKIKKPILLIHGEEDNNPGTLTMQSDRF+NALKGHGALCRLVILPFESHGY A
Sbjct  822  MSPFISANKIKKPILLIHGEEDNNPGTLTMQSDRFYNALKGHGALCRLVILPFESHGYAA  881

Query  525  RESIMHVLWETDRWVQKHCVPNTS-----KVDTDTKVTEDPESKAVSASGAGVPE  376
            RES+MHVLWETDRW+QKHCV N+S     + + +T +T D E+KAV  +G GV E
Sbjct  882  RESVMHVLWETDRWLQKHCVDNSSDPIAPEENANTGIT-DAENKAVGVAG-GVAE  934



>gb|KEH24431.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=959

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 10/180 (6%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  763  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  822

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILP+ESHGY+A
Sbjct  823  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPYESHGYSA  882

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWET RW+ K+CV NTS    D          +K   D ESK V+ASG G  E
Sbjct  883  RESIMHVLWETGRWLHKYCVSNTSDAGEDHDTGTVKENISKGIADAESKVVAASGGGSKE  942



>ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
 gb|AES82188.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=962

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 10/180 (6%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  766  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  825

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILP+ESHGY+A
Sbjct  826  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPYESHGYSA  885

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWET RW+ K+CV NTS    D          +K   D ESK V+ASG G  E
Sbjct  886  RESIMHVLWETGRWLHKYCVSNTSDAGEDHDTGTVKENISKGIADAESKVVAASGGGSKE  945



>gb|KEH24430.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=959

 Score =   295 bits (756),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 151/180 (84%), Gaps = 10/180 (6%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  763  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATNTYVE  822

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGAL RLVILP+ESHGY+A
Sbjct  823  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALSRLVILPYESHGYSA  882

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTD----------TKVTEDPESKAVSASGAGVPE  376
            RESIMHVLWET RW+ K+CV NTS    D          +K   D ESK V+ASG G  E
Sbjct  883  RESIMHVLWETGRWLHKYCVSNTSDAGEDHDTGTVKENISKGIADAESKVVAASGGGSKE  942



>emb|CDP17069.1| unnamed protein product [Coffea canephora]
Length=916

 Score =   294 bits (753),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 155/184 (84%), Gaps = 7/184 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K A+GGHSYGAFM ANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+TYVE
Sbjct  717  KIAIGGHSYGAFMAANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATTTYVE  776

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGAL RLVILPFESHGY A
Sbjct  777  MSPFMSAHKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALSRLVILPFESHGYAA  836

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDT-----KVTEDPESKAVSASGAGVPELASDS  361
            RESIMHVLWETDRW+Q++CV N+S VD+ T     K TE  ESK V  +  GV EL    
Sbjct  837  RESIMHVLWETDRWLQRYCVLNSS-VDSTTCTDNIKGTEGSESKVVD-TAEGVRELEDQQ  894

Query  360  NDTF  349
              T 
Sbjct  895  KITL  898



>gb|EMS47754.1| putative glutamyl endopeptidase, chloroplastic [Triticum urartu]
Length=867

 Score =   290 bits (743),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 157/197 (80%), Gaps = 19/197 (10%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQ---------------  751
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ               
Sbjct  668  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQVLVFQSFLTACIVLQ  727

Query  750  NEDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGAL  571
            NEDRTLWEAT+TYVEMSPFMSANKIK+PILLIHGE+DNN GTLTMQSDRFFNALKGHG  
Sbjct  728  NEDRTLWEATNTYVEMSPFMSANKIKRPILLIHGEQDNNSGTLTMQSDRFFNALKGHGVQ  787

Query  570  CRLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASG  391
             RLVILPFESHGY+ARESIMHVLWE+DRW+QK+CV  TSK D++T    D ESK ++ASG
Sbjct  788  SRLVILPFESHGYSARESIMHVLWESDRWLQKYCVNGTSKADSETAA--DGESKKLAASG  845

Query  390  AGVPE--LASDSNDTFP  346
             G     L+SD   + P
Sbjct  846  GGAASEGLSSDGFSSIP  862



>ref|XP_009414913.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X5 [Musa acuminata subsp. malaccensis]
Length=960

 Score =   292 bits (747),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 5/183 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGI+RSGAYNRTLTPFGFQNEDRTLWEAT+TY+E
Sbjct  771  KIAVGGHSYGAFMTANLLAHAPHLFCCGISRSGAYNRTLTPFGFQNEDRTLWEATNTYIE  830

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  831  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  890

Query  525  RESIMHVLWETDRWVQKHCVPNTSK----VDTDTKVTEDPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV ++ +      +  +     E+KA+SA+G+ VP+  S   
Sbjct  891  RESIMHVLWETDMWLQKYCVESSDQSSDLYSSSGESPNSSENKAISATGS-VPDHESTQE  949

Query  357  DTF  349
            D F
Sbjct  950  DGF  952



>ref|XP_009414908.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009414909.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=964

 Score =   292 bits (747),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 5/183 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGI+RSGAYNRTLTPFGFQNEDRTLWEAT+TY+E
Sbjct  775  KIAVGGHSYGAFMTANLLAHAPHLFCCGISRSGAYNRTLTPFGFQNEDRTLWEATNTYIE  834

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  835  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  894

Query  525  RESIMHVLWETDRWVQKHCVPNTSK----VDTDTKVTEDPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV ++ +      +  +     E+KA+SA+G+ VP+  S   
Sbjct  895  RESIMHVLWETDMWLQKYCVESSDQSSDLYSSSGESPNSSENKAISATGS-VPDHESTQE  953

Query  357  DTF  349
            D F
Sbjct  954  DGF  956



>ref|XP_009414911.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414912.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   292 bits (747),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 5/183 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGI+RSGAYNRTLTPFGFQNEDRTLWEAT+TY+E
Sbjct  775  KIAVGGHSYGAFMTANLLAHAPHLFCCGISRSGAYNRTLTPFGFQNEDRTLWEATNTYIE  834

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGY+A
Sbjct  835  MSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYSA  894

Query  525  RESIMHVLWETDRWVQKHCVPNTSK----VDTDTKVTEDPESKAVSASGAGVPELASDSN  358
            RESIMHVLWETD W+QK+CV ++ +      +  +     E+KA+SA+G+ VP+  S   
Sbjct  895  RESIMHVLWETDMWLQKYCVESSDQSSDLYSSSGESPNSSENKAISATGS-VPDHESTQE  953

Query  357  DTF  349
            D F
Sbjct  954  DGF  956



>ref|XP_008451481.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Cucumis 
melo]
Length=967

 Score =   292 bits (747),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE
Sbjct  774  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  833

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF+SANKIKKPILLIHGEEDNNPGTL MQSDRFFNALKGHGALCRLV+LPFESHGY++
Sbjct  834  MSPFISANKIKKPILLIHGEEDNNPGTLPMQSDRFFNALKGHGALCRLVVLPFESHGYSS  893

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGV  382
            RESIMHVLWETDRW++K+C  N S +  D    ++  + A  ++G  V
Sbjct  894  RESIMHVLWETDRWLEKYCSSNASDLGQDGDKNKEEGNAAADSAGKVV  941



>ref|XP_011079552.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Sesamum 
indicum]
Length=955

 Score =   288 bits (738),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 147/177 (83%), Gaps = 11/177 (6%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEA  TYVE
Sbjct  762  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEAVDTYVE  821

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF+SANKIKKPILLIHGEEDNNPGTLTMQSDRF+NALKGHGALCRLVILPFESHGY A
Sbjct  822  MSPFISANKIKKPILLIHGEEDNNPGTLTMQSDRFYNALKGHGALCRLVILPFESHGYAA  881

Query  525  RESIMHVLWETDRWVQKHCV----------PNTSKVDTDTKVTEDPESKAVSASGAG  385
            RES+MHVLWETDRW+Q +CV          PN  + D    ++ D ESK  +A G  
Sbjct  882  RESVMHVLWETDRWLQNYCVTANSSDAGEDPNEHEEDASCSIS-DGESKVGAAGGVA  937



>ref|XP_010069840.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Eucalyptus grandis]
Length=916

 Score =   283 bits (723),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 148/180 (82%), Gaps = 8/180 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K A+ GHSYGAFMTANLLAHAP LF CG+ARSGAYNRTLTPFGFQNE+RTLWEAT TYVE
Sbjct  708  KIAISGHSYGAFMTANLLAHAPQLFCCGVARSGAYNRTLTPFGFQNEERTLWEATDTYVE  767

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MS FMS +KIKKPILLIHGEED+N GTL MQS+RFFNALKGHGALCRLV+LPFESHGY A
Sbjct  768  MSAFMSVHKIKKPILLIHGEEDDNSGTLPMQSERFFNALKGHGALCRLVVLPFESHGYAA  827

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKA--------VSASGAGVPELA  370
            RES+MHVLWETDRW+ K+CV N S+V  D    +D ESK         V+ASG G  ELA
Sbjct  828  RESVMHVLWETDRWLHKYCVSNASEVTADLNSCKDDESKGAMGSEXKVVAASGGGNLELA  887



>gb|EPS61481.1| hypothetical protein M569_13316, partial [Genlisea aurea]
Length=487

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ EDRTLWEA  TYV 
Sbjct  344  RIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQTEDRTLWEAVETYVN  403

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF++ANKIKKPILL+HGEEDNNPGTLTMQSDRF++ALKG G LCRLV+LP ESHGY A
Sbjct  404  MSPFIAANKIKKPILLVHGEEDNNPGTLTMQSDRFYDALKGQGVLCRLVVLPLESHGYAA  463

Query  525  RESIMHVLWETDRWVQKHCVPNTS  454
            RES+MH+LWETDRW+Q++CV N+S
Sbjct  464  RESVMHLLWETDRWLQRYCVANSS  487



>gb|KCW58328.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
 gb|KCW58329.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
Length=874

 Score =   278 bits (712),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K A+ GHSYGAFMTANLLAHAP LF CG+ARSGAYNRTLTPFGFQNE+RTLWEAT TYVE
Sbjct  708  KIAISGHSYGAFMTANLLAHAPQLFCCGVARSGAYNRTLTPFGFQNEERTLWEATDTYVE  767

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MS FMS +KIKKPILLIHGEED+N GTL MQS+RFFNALKGHGALCRLV+LPFESHGY A
Sbjct  768  MSAFMSVHKIKKPILLIHGEEDDNSGTLPMQSERFFNALKGHGALCRLVVLPFESHGYAA  827

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSAS  394
            RES+MHVLWETDRW+ K+CV N S+V  D    +D ESK    S
Sbjct  828  RESVMHVLWETDRWLHKYCVSNASEVTADLNSCKDDESKGAMGS  871



>ref|XP_002990171.1| hypothetical protein SELMODRAFT_131182, partial [Selaginella 
moellendorffii]
 gb|EFJ08731.1| hypothetical protein SELMODRAFT_131182, partial [Selaginella 
moellendorffii]
Length=837

 Score =   260 bits (665),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFM ANLLAHAPHLF CGIAR+GAYNRTLTPFGFQ+EDRTLWEA  TY++
Sbjct  669  RIAVGGHSYGAFMAANLLAHAPHLFCCGIARAGAYNRTLTPFGFQSEDRTLWEAPKTYID  728

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM ANK++ PILLIHGE+DNN GTLTMQS+RF++ALKGHG +CRLV+LPFESHGY A
Sbjct  729  MSPFMLANKMQNPILLIHGEDDNNSGTLTMQSERFYDALKGHGVVCRLVLLPFESHGYVA  788

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVP  379
            RES+MH LWE++RW+ K CV  TS     T + E+ E     AS A  P
Sbjct  789  RESVMHTLWESERWLDKFCVAATST----TGMAEESEDSEKDASTAAAP  833



>ref|XP_002992516.1| hypothetical protein SELMODRAFT_135368, partial [Selaginella 
moellendorffii]
 gb|EFJ06454.1| hypothetical protein SELMODRAFT_135368, partial [Selaginella 
moellendorffii]
Length=837

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFM ANLLAHAPHLF CGIAR+GAYNRTLTPFGFQ+EDRTLWEA  TY++
Sbjct  669  RIAVGGHSYGAFMAANLLAHAPHLFCCGIARAGAYNRTLTPFGFQSEDRTLWEAPKTYID  728

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM ANK++KPILLIHGE+DNN GTLTMQS+RF++ALKGHG +CRLV+LPFESHGY A
Sbjct  729  MSPFMLANKMQKPILLIHGEDDNNSGTLTMQSERFYDALKGHGVVCRLVLLPFESHGYVA  788

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVP  379
            R+S+MH LWE++RW+ K CV  TS     T V E  E     AS    P
Sbjct  789  RDSVMHTLWESERWLDKFCVAATST----TGVAEKSEDSEKDASTTAAP  833



>ref|XP_001754620.1| predicted protein [Physcomitrella patens]
 gb|EDQ80590.1| predicted protein [Physcomitrella patens]
Length=850

 Score =   258 bits (660),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLL HAP+LF CGI+RSGAYNRTLTPFGFQ+E+RTLWEA  TY+E
Sbjct  688  KIAVGGHSYGAFMTANLLIHAPNLFCCGISRSGAYNRTLTPFGFQSEERTLWEAQKTYIE  747

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM A+K+KKPILLIHGEEDNN GTLTMQS+RF+ ALKG+GALCRLV+LP ESHGY+ 
Sbjct  748  MSPFMLADKVKKPILLIHGEEDNNAGTLTMQSERFYAALKGNGALCRLVLLPLESHGYSG  807

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED  421
            RES+MH LWE DRW+QK+CV  ++K      +  D
Sbjct  808  RESVMHCLWEMDRWLQKYCVQASNKASLGQSLNGD  842



>ref|XP_001761707.1| predicted protein [Physcomitrella patens]
 gb|EDQ73463.1| predicted protein [Physcomitrella patens]
Length=930

 Score =   256 bits (655),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLL HAPHLF CGI+RSGAYNRTLTPFGFQ+E+RT+WEA  TY+E
Sbjct  786  KIAVGGHSYGAFMTANLLIHAPHLFCCGISRSGAYNRTLTPFGFQSEERTIWEAQKTYIE  845

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM ANK+KKPILLIHGEEDNN GT+TMQS+RF+ ALKG+G LCRLV+LP ESHGY+ 
Sbjct  846  MSPFMLANKLKKPILLIHGEEDNNAGTVTMQSERFYAALKGNGTLCRLVLLPLESHGYSG  905

Query  525  RESIMHVLWETDRWVQKHCV  466
            RES+MH LWE DRW+QK+CV
Sbjct  906  RESVMHCLWEMDRWLQKYCV  925



>ref|XP_001772878.1| predicted protein [Physcomitrella patens]
 gb|EDQ62280.1| predicted protein [Physcomitrella patens]
Length=886

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLL HA  LF+CGIARSGAYNRTLTPFGFQ E+RTLWEA  TY+E
Sbjct  699  KIAVGGHSYGAFMTANLLIHASDLFACGIARSGAYNRTLTPFGFQAEERTLWEAQKTYIE  758

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSP+M AN++KKP+LLIHG+EDNN GT+TMQS+RFF+ALKGHGAL RLV+LP ESHGY  
Sbjct  759  MSPYMYANRVKKPLLLIHGDEDNNSGTMTMQSERFFSALKGHGALTRLVLLPLESHGYQG  818

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVPELASDSNDTF  349
            RES+MH LWE DRW+Q HCV  T           +P   AV++SGA V E A++ ND F
Sbjct  819  RESVMHCLWEMDRWLQLHCVNATGNASASDNAEANP---AVTSSGA-VGESANE-NDPF  872



>ref|XP_004958766.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Setaria italica]
Length=933

 Score =   249 bits (636),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ E RTLWEAT TY++
Sbjct  735  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQKEMRTLWEATDTYIK  794

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+D+   T  MQS +F++ALKGHG  CRLVILPFE H Y A
Sbjct  795  MSPFMSANKIKKPILLIHGEDDSK-VTTAMQSSQFYDALKGHGVPCRLVILPFERHQYAA  853

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV-DTDTKV  430
            RESIMH++WETDRW+QK+C  N   + D +T V
Sbjct  854  RESIMHIIWETDRWLQKYCATNPGNIKDMETNV  886



>gb|EMS61523.1| putative glutamyl endopeptidase, chloroplastic [Triticum urartu]
Length=792

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ E RTLWEAT TY++
Sbjct  626  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQKEVRTLWEATDTYIK  685

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM ANKIKKPILLIHGEED+   T  MQS +F++ALKGHG  CRLVILPFE H Y A
Sbjct  686  MSPFMIANKIKKPILLIHGEEDSK-VTTAMQSSQFYDALKGHGVPCRLVILPFEGHRYAA  744

Query  525  RESIMHVLWETDRWVQKHCVPNTS  454
            RES+MHV+WETDRW+QK+C  N+S
Sbjct  745  RESVMHVIWETDRWLQKYCASNSS  768



>gb|KDO41282.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=494

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++ AVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E RTLWEAT+ Y+
Sbjct  344  SRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYI  403

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LPFE H Y 
Sbjct  404  EMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYA  463

Query  528  ARESIMHVLWETDRWVQKHCVPNTS  454
            ARE++MHV+WETDRW+QK+C+ NTS
Sbjct  464  ARENVMHVIWETDRWLQKYCLSNTS  488



>emb|CDY68614.1| BnaC04g52020D [Brassica napus]
Length=197

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 131/176 (74%), Gaps = 14/176 (8%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            +K AVGGHSYGAFMTANLLAHAPHLFSCGIAR GAYNRTLTPFGFQNEDRTLWEAT+ YV
Sbjct  28   SKTAVGGHSYGAFMTANLLAHAPHLFSCGIARFGAYNRTLTPFGFQNEDRTLWEATNVYV  87

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSPFMSA+KIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVI        +
Sbjct  88   EMSPFMSADKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVIYS------S  141

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVSASGAGVPELASDS  361
            +RE    VL     +      P+ SK  +D+        +  +A+G G PE    S
Sbjct  142  SREPW--VLSTGKHYAHADSSPDQSKERSDSA------DRVGTATGGGNPEFEDHS  189



>gb|EEE67855.1| hypothetical protein OsJ_25660 [Oryza sativa Japonica Group]
Length=916

 Score =   244 bits (623),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ E RTLWEAT TY++
Sbjct  726  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQKEVRTLWEATDTYIK  785

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+D+   T  MQS +F++ALKG+G  CRLVILPFE H Y A
Sbjct  786  MSPFMSANKIKKPILLIHGEDDSK-VTTAMQSSQFYDALKGNGVPCRLVILPFERHHYVA  844

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDT  442
            RES+MHV+WETDRW++ +CV N+  +  
Sbjct  845  RESVMHVIWETDRWLEMYCVSNSRNIQV  872



>gb|EEC82725.1| hypothetical protein OsI_27416 [Oryza sativa Indica Group]
Length=916

 Score =   244 bits (623),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQ E RTLWEAT TY++
Sbjct  726  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQKEVRTLWEATDTYIK  785

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFMSANKIKKPILLIHGE+D+   T  MQS +F++ALKG+G  CRLVILPFE H Y A
Sbjct  786  MSPFMSANKIKKPILLIHGEDDSK-VTTAMQSSQFYDALKGNGVPCRLVILPFERHHYVA  844

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDT  442
            RES+MHV+WETDRW++ +CV N+  +  
Sbjct  845  RESVMHVIWETDRWLEMYCVSNSRNIQV  872



>gb|KDO41278.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=751

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++ AVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E RTLWEAT+ Y+
Sbjct  601  SRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYI  660

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LPFE H Y 
Sbjct  661  EMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYA  720

Query  528  ARESIMHVLWETDRWVQKHCVPNTS  454
            ARE++MHV+WETDRW+QK+C+ NTS
Sbjct  721  ARENVMHVIWETDRWLQKYCLSNTS  745



>gb|KDO41277.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=744

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++ AVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E RTLWEAT+ Y+
Sbjct  594  SRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYI  653

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LPFE H Y 
Sbjct  654  EMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYA  713

Query  528  ARESIMHVLWETDRWVQKHCVPNTS  454
            ARE++MHV+WETDRW+QK+C+ NTS
Sbjct  714  ARENVMHVIWETDRWLQKYCLSNTS  738



>gb|KDO41275.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=752

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++ AVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E RTLWEAT+ Y+
Sbjct  602  SRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYI  661

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LPFE H Y 
Sbjct  662  EMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYA  721

Query  528  ARESIMHVLWETDRWVQKHCVPNTS  454
            ARE++MHV+WETDRW+QK+C+ NTS
Sbjct  722  ARENVMHVIWETDRWLQKYCLSNTS  746



>gb|EMT02117.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=822

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLLAHAPHLF CGIARSGAYNRT TPFGFQ E RTLWEAT TY++
Sbjct  633  KIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTPTPFGFQKEVRTLWEATDTYIK  692

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM ANKIKKPILLIHGEED+   T  MQS +F++ALKGHG  CRLV+LPFE H Y A
Sbjct  693  MSPFMIANKIKKPILLIHGEEDSK-VTTAMQSSQFYDALKGHGVPCRLVVLPFEGHRYAA  751

Query  525  RESIMHVLWETDRWVQKHC  469
            RES+MHV+WETDRW+QK+C
Sbjct  752  RESVMHVIWETDRWLQKYC  770



>ref|XP_006442099.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55339.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=829

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 130/158 (82%), Gaps = 6/158 (4%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE + R      ++ AVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ 
Sbjct  666  AVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQT  725

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            E RTLWEAT+ Y EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL 
Sbjct  726  EFRTLWEATNVYTEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALS  785

Query  567  RLVILPFESHGYTARESIMHVLWETDRWVQKHCVPNTS  454
            RLV+LPFE H Y ARE++MHV+WETDRW+QK+C+ NTS
Sbjct  786  RLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTS  823



>ref|XP_005847852.1| hypothetical protein CHLNCDRAFT_31155 [Chlorella variabilis]
 gb|EFN55750.1| hypothetical protein CHLNCDRAFT_31155 [Chlorella variabilis]
Length=754

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 124/149 (83%), Gaps = 6/149 (4%)
 Frame = -2

Query  909  AVEWLTR------AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQN  748
            AVE L R      ++ AVGGHSYGAFMTANLLAHA  LF+CGIARSGA+NRTLTPFGFQ 
Sbjct  593  AVEELQRRGVADPSRIAVGGHSYGAFMTANLLAHAGDLFACGIARSGAFNRTLTPFGFQA  652

Query  747  EDRTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALC  568
            E+RTLW+A  TY +MSPFM+A+KI+KP+LLIHGE DNN GT  MQS+RF+ ALKGHG   
Sbjct  653  EERTLWQAPETYSKMSPFMNADKIQKPLLLIHGEADNNTGTFPMQSERFYQALKGHGGTT  712

Query  567  RLVILPFESHGYTARESIMHVLWETDRWV  481
            RLV+LP ESHGY+ARESIMHVL+E DRW+
Sbjct  713  RLVLLPHESHGYSARESIMHVLYEMDRWM  741



>ref|WP_029944704.1| hypothetical protein [Cloacimonetes bacterium JGI 0000014-K11]
Length=284

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = -2

Query  921  EKLFAVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNED  742
            +KL  +E     + A+GGHSYGAFM ANLLAH+  LF+ G+A++GAYNRTLTPFGFQ+ED
Sbjct  129  DKLVGLEIADSNRIAIGGHSYGAFMAANLLAHS-DLFAAGVAKTGAYNRTLTPFGFQSED  187

Query  741  RTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRL  562
            R LWEA  TY++MSPFM ANKI +PILL+HG+ D N GT  MQS+RF++ALKG+GA  RL
Sbjct  188  RLLWEAQDTYIKMSPFMYANKINEPILLVHGKSDRNSGTFPMQSERFYHALKGNGATARL  247

Query  561  VILPFESHGYTARESIMHVLWETDRWVQKHC  469
            V+LP+E H Y ARES++HVLWE +RW+ K+ 
Sbjct  248  VMLPYEGHSYRARESVLHVLWEMNRWLNKYV  278



>ref|XP_005642798.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE18254.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
Length=824

 Score =   226 bits (577),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++ AVGGHSYGAFM ANLLAHAP LF+CGIA+SGAYNRTLTPFGFQ E+RT+W+A   Y 
Sbjct  675  SRIAVGGHSYGAFMAANLLAHAPELFACGIAKSGAYNRTLTPFGFQAEERTIWQAPDVYA  734

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
             MSPF+ A+K+K+P+LL+HGE+DNN GT  MQS+RF++ALKGHGA  RLV+LP ESHGY+
Sbjct  735  AMSPFLQADKVKRPLLLVHGEDDNNTGTFPMQSERFYSALKGHGATTRLVLLPHESHGYS  794

Query  528  ARESIMHVLWETDRWVQKHC  469
            ARES+MHVL E D W++++C
Sbjct  795  ARESVMHVLAEMDGWLRRYC  814



>emb|CEN48224.1| Uncharacterized peptidase yuxL (fragment) [Capnocytophaga canimorsus]
Length=167

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++   + AVGGHSYGAFMTANLL H+  LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  21   ALGYIDTKRVAVGGHSYGAFMTANLLTHSD-LFACGIARSGAYNRTLTPFGFQREQRNYW  79

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            +A   Y  MSPFM+A+K+KKP+LLIHG  DNNPGT T+Q++R+F ALK  GA  R+V+LP
Sbjct  80   DAPEVYNTMSPFMNAHKMKKPLLLIHGAADNNPGTFTLQTERYFQALKNLGAPVRMVLLP  139

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
            FESHGY A+ESI+H LWE D++++KH 
Sbjct  140  FESHGYQAKESILHTLWEQDQFLEKHL  166



>ref|XP_001419477.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97770.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=835

 Score =   225 bits (573),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFM ANLLAHAP LF+C IARSGAYNRTLTPFGFQ E+RTLWEA  TY  
Sbjct  690  RIAVGGHSYGAFMAANLLAHAPDLFACAIARSGAYNRTLTPFGFQAEERTLWEAPETYNA  749

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM+A+KIKKPILLIHGEED N GT  MQS+RFF+ALKG+GA  +LVILP ESHGY A
Sbjct  750  MSPFMNAHKIKKPILLIHGEEDQNSGTHLMQSERFFSALKGNGAEVKLVILPHESHGYRA  809

Query  525  RESIMHVLWETDRWVQKHCVPNTSKV  448
            +ESI H+L ET  W+  HC P   K 
Sbjct  810  KESINHMLAETSDWLDAHCAPGAKKA  835



>ref|XP_003081027.1| Dipeptidyl aminopeptidases/acylaminoacyl-peptidases (ISS) [Ostreococcus 
tauri]
Length=783

 Score =   224 bits (571),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFM ANLLAHAP LF+C IARSGAYNRTLTPFGFQ E+RTLWEA  TY  
Sbjct  616  RIAVGGHSYGAFMAANLLAHAPDLFACAIARSGAYNRTLTPFGFQAEERTLWEAPETYEA  675

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM+A+KIKKPILLIHGEED N GT  MQS+RFF ALKG+GA  +LVILP ESHGY A
Sbjct  676  MSPFMNAHKIKKPILLIHGEEDTNSGTHLMQSERFFAALKGNGAEVKLVILPHESHGYRA  735

Query  525  RESIMHVLWETDRWVQKHCVPNTSK  451
            +ESI H+L ET  W+  HC P   K
Sbjct  736  KESINHMLAETSDWLDTHCAPGAKK  760



>emb|CEF98925.1| Peptidase S9, prolyl oligopeptidase, catalytic domain [Ostreococcus 
tauri]
Length=917

 Score =   224 bits (571),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFM ANLLAHAP LF+C IARSGAYNRTLTPFGFQ E+RTLWEA  TY  
Sbjct  750  RIAVGGHSYGAFMAANLLAHAPDLFACAIARSGAYNRTLTPFGFQAEERTLWEAPETYEA  809

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM+A+KIKKPILLIHGEED N GT  MQS+RFF ALKG+GA  +LVILP ESHGY A
Sbjct  810  MSPFMNAHKIKKPILLIHGEEDTNSGTHLMQSERFFAALKGNGAEVKLVILPHESHGYRA  869

Query  525  RESIMHVLWETDRWVQKHCVPNTSK  451
            +ESI H+L ET  W+  HC P   K
Sbjct  870  KESINHMLAETSDWLDTHCAPGAKK  894



>ref|XP_002954276.1| hypothetical protein VOLCADRAFT_106292 [Volvox carteri f. nagariensis]
 gb|EFJ44700.1| hypothetical protein VOLCADRAFT_106292 [Volvox carteri f. nagariensis]
Length=998

 Score =   224 bits (570),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            AK +VGGHSYGAFMTANL+AHAP LF+ GIAR+ AYNRTLTPFGFQ+E+RTLW+A   Y+
Sbjct  803  AKVSVGGHSYGAFMTANLVAHAPDLFAAGIARTXAYNRTLTPFGFQSEERTLWQAPDVYL  862

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
             MSPFM A+KI KP+LLIHGE+DNNPGT  +QS+RF+ ALKGHGA CRLV+LP E HGY 
Sbjct  863  RMSPFMMADKISKPLLLIHGEDDNNPGTFPLQSERFYQALKGHGATCRLVLLPHEGHGYR  922

Query  528  ARESIMHVLWETDRWVQKHC  469
            A ES+MH L+E D+W++++ 
Sbjct  923  AYESVMHTLYEQDQWIERYA  942



>ref|WP_023574169.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
enshiense]
 gb|ESU22225.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
enshiense DK69]
 gb|KGO97238.1| aminoacyl peptidase [Flavobacterium enshiense DK69]
Length=804

 Score =   219 bits (559),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+CGIARSGAYNRTLTPFGFQNE R  WEA+
Sbjct  660  YINRKKVAVGGHSYGAFMTANLLSHS-NLFACGIARSGAYNRTLTPFGFQNEQRNYWEAS  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y EMSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R++ILP ES
Sbjct  719  NIYNEMSPFMNAEKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMLILPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I H+LWE D++++K+ 
Sbjct  779  HGYAAKENIFHLLWEQDQFLEKYL  802



>ref|WP_034921484.1| aminoacyl peptidase [Gillisia sp. CAL575]
Length=818

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 126/156 (81%), Gaps = 2/156 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  659  YIDRNRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLVILP ES
Sbjct  718  EVYNNMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVILPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTK  433
            HGY+A+ES++HVLWE D+W++K+ V N  K +   K
Sbjct  778  HGYSAKESVLHVLWEQDQWLEKY-VKNRVKTEISQK  812



>ref|XP_005534945.1| probable dipeptidyl aminopeptidase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80338.1| probable dipeptidyl aminopeptidase [Cyanidioschyzon merolae strain 
10D]
Length=1037

 Score =   220 bits (561),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + A+GGHSYGAFM ANLL HAP LF CGIARSGAYNRTLTPFGFQNE RTLW+A   YV 
Sbjct  846  RIAIGGHSYGAFMAANLLCHAPDLFRCGIARSGAYNRTLTPFGFQNEQRTLWQARDVYVR  905

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSP++ AN+I+ P+LLIHGE+D+NPGT  +QS+RFF ALKG G + RLV+LP ESH Y A
Sbjct  906  MSPYLYANQIQAPLLLIHGEDDDNPGTYPLQSERFFQALKGQGKIARLVLLPLESHSYQA  965

Query  525  RESIMHVLWETDRWVQKHCVPNTS  454
            RES++HVL E D W+++ C P  S
Sbjct  966  RESVLHVLAEMDAWLKRWCAPAAS  989



>ref|WP_029038563.1| aminoacyl peptidase [Salinimicrobium xinjiangense]
Length=821

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 129/161 (80%), Gaps = 2/161 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  657  AMGYIDRDRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP
Sbjct  716  EAPEVYYNMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVT  427
             ESHGY+A+ES++HVLWE D+W++K+ V N  + + + + T
Sbjct  776  KESHGYSAKESVLHVLWEQDQWLEKY-VKNREQTEANIQQT  815



>ref|WP_026981266.1| aminoacyl peptidase [Flavobacterium suncheonense]
 gb|KGO90281.1| aminoacyl peptidase [Flavobacterium suncheonense GH29-5 = DSM 
17707]
Length=804

 Score =   218 bits (556),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WEA 
Sbjct  660  YINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEAQ  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y EMSPFMSA K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+V+LP ES
Sbjct  719  NVYNEMSPFMSAEKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVLLPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I H+LWE D++++K+ 
Sbjct  779  HGYAAKENIFHLLWEQDQFLEKYL  802



>ref|WP_028890983.1| aminoacyl peptidase [Tenacibaculum sp. 47A_GOM-205m]
Length=806

 Score =   218 bits (556),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  658  YIDRNKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  717  EVYYNMSPFMHADKMKTPLLLIHGEADNNSGTYPLQSERYFNALKGLGAPVRLVMLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE D+W++KH 
Sbjct  777  HGYRAKESIMHMLWEQDQWLEKHV  800



>ref|WP_023580461.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
limnosediminis]
 gb|ESU26428.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
limnosediminis JC2902]
Length=805

 Score =   218 bits (555),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WEA+
Sbjct  660  YINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEAS  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            S Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  719  SIYNGMSPFMTAEKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHCVPN  460
            HGY A+E+I H+LWE D++++K+   N
Sbjct  779  HGYAAKENIFHLLWEQDQFLEKYLKTN  805



>ref|WP_008464492.1| hypothetical protein [Flavobacterium sp. F52]
 gb|EJG01953.1| hypothetical protein FF52_08094 [Flavobacterium sp. F52]
Length=803

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WEA 
Sbjct  659  YINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEAP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A K+K PILL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  718  EVYNAMSPFMNAEKMKTPILLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  778  HGYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_024982364.1| aminoacyl peptidase [Flavobacterium succinicans]
Length=802

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W
Sbjct  655  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYW  713

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F A+KG G   R+VILP
Sbjct  714  ETPEVYTAMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYFQAIKGLGGPARMVILP  773

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I+H+LWE D++++KH 
Sbjct  774  KESHGYAAKENILHLLWEQDQFLEKHL  800



>emb|CEN47830.1| putative glutamyl endopeptidase, chloroplastic (fragment) [Capnocytophaga 
canimorsus]
Length=448

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++   + AVGGHSYGAFMTANLL H+  LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  302  ALGYIDTKRVAVGGHSYGAFMTANLLTHS-DLFACGIARSGAYNRTLTPFGFQREQRNYW  360

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            +A   Y  MSPFM+A+K+KKP+LLIHG  DNNPGT T+Q++R+F ALK  GA  R+V+LP
Sbjct  361  DAPEVYNTMSPFMNAHKMKKPLLLIHGAADNNPGTFTLQTERYFQALKNLGAPVRMVLLP  420

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
            FESHGY A+ESI+H LWE D++++KH 
Sbjct  421  FESHGYQAKESILHTLWEQDQFLEKHL  447



>ref|WP_035619417.1| aminoacyl peptidase [Flavobacterium hydatis]
 gb|KFF18197.1| aminoacyl peptidase [Flavobacterium hydatis]
Length=803

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPDIYNTMSPFMHADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY ARE+I+H+LWE D++++K+ 
Sbjct  775  KESHGYVARENILHLLWEQDQFLEKYL  801



>ref|WP_037319528.1| aminoacyl peptidase [Salegentibacter sp. Hel_I_6]
Length=819

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  660  YVDRDRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  719  EVYYNMSPFMHAEKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+A+ES++HVLWE D+W++K+ 
Sbjct  779  HGYSAKESVLHVLWEQDQWLEKYV  802



>ref|WP_035682291.1| aminoacyl peptidase [Flavobacterium reichenbachii]
 gb|KFF05160.1| aminoacyl peptidase [Flavobacterium reichenbachii]
Length=803

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPQVYNTMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+HGY A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHGYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_017733953.1| hypothetical protein [Nafulsella turpanensis]
Length=820

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFMTANLLAH+  LF+ GIARSGAYNRTLTPFGFQNE RT WEA   Y  
Sbjct  676  RTAVGGHSYGAFMTANLLAHS-DLFAAGIARSGAYNRTLTPFGFQNEQRTYWEAPEIYNA  734

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM A+K+ +P+LLIHGE DNN GT  +QS+R++NALKGHGA+ RLV LP ESHGY A
Sbjct  735  MSPFMHADKVNEPLLLIHGEADNNSGTFPIQSERYYNALKGHGAVSRLVFLPAESHGYQA  794

Query  525  RESIMHVLWETDRWVQKHC  469
            +ESIMH+LWE DRW+  + 
Sbjct  795  KESIMHMLWEMDRWLDMYV  813



>ref|WP_029034950.1| aminoacyl peptidase [Salinimicrobium terrae]
Length=821

 Score =   216 bits (551),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  660  FIDRDRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  719  EVYYNMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+A+ES++HVLWE D+W++++ 
Sbjct  779  HGYSAKESVLHVLWEQDQWLEQYV  802



>ref|WP_026897909.1| aminoacyl peptidase [Pedobacter oryzae]
Length=805

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            A+ AVGGHSYGAFMTANLLAH   LF+ GIARSGAYNRTLTPFGFQ E+RT WEA   Y 
Sbjct  657  ARIAVGGHSYGAFMTANLLAHT-DLFAAGIARSGAYNRTLTPFGFQAEERTYWEAPEVYN  715

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            +MSPF  A+KIK+P+LLIHGE DNN GT  MQS+RF+NALKGHGA  RLVILP E+HGY 
Sbjct  716  KMSPFSYADKIKEPLLLIHGEADNNSGTFPMQSERFYNALKGHGATTRLVILPAEAHGYQ  775

Query  528  ARESIMHVLWETDRWVQKHC  469
             RES++H++WE D W++K+ 
Sbjct  776  GRESVLHMMWEMDNWLEKYV  795



>ref|WP_007803898.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
sp. CF136]
 gb|EJL66814.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
sp. CF136]
Length=803

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM+A+K+K PILL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EAPEVYNTMSPFMNADKMKTPILLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+H Y A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHSYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_015755577.1| hypothetical protein [Robiginitalea biformata]
 gb|EAR14141.1| hypothetical protein RB2501_01905 [Robiginitalea biformata HTCC2501]
Length=811

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  658  YIDRDRVAVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  717  EVYYTMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATVRLVMLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNT  457
            HGY +RESI+H+LWE DRW++K+  P +
Sbjct  777  HGYRSRESILHLLWEQDRWLEKYLKPES  804



>ref|WP_039111629.1| MULTISPECIES: aminoacyl peptidase [Flavobacterium]
 gb|KIA99751.1| aminoacyl peptidase [Flavobacterium sp. KMS]
 gb|KIC00554.1| aminoacyl peptidase [Flavobacterium sp. JRM]
Length=803

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPDVYNTMSPFMHADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I+H+LWE D++++K+ 
Sbjct  775  KESHGYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_031455942.1| aminoacyl peptidase [Flavobacterium chungangense]
Length=803

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E  S Y  MSPFM+A+K+K PILL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPSVYNTMSPFMNADKMKTPILLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+H Y A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHSYVAKENILHLLWEQDQFLEKYL  801



>ref|XP_011401392.1| putative glutamyl endopeptidase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM28377.1| putative glutamyl endopeptidase, chloroplastic [Auxenochlorella 
protothecoides]
Length=841

 Score =   216 bits (550),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  879  AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMS  700
            A+ GHSYGAFM ANLLAHAP LF+CG+ RSGAYNRTLTPF FQ E RTLWE   TY++MS
Sbjct  661  AIAGHSYGAFMAANLLAHAPDLFACGVGRSGAYNRTLTPFSFQQEQRTLWEVPETYLKMS  720

Query  699  PFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTARE  520
            PFM A+K+++P+LLIHG +DNN GT T+QS+RF+ ALKGHG + RLV+LP ESHGY ARE
Sbjct  721  PFMHADKVRRPLLLIHGADDNNTGTFTLQSERFYAALKGHGCVTRLVVLPHESHGYRARE  780

Query  519  SIMHVLWETDRWVQKHC  469
            S+MH L+E + W+ + C
Sbjct  781  SVMHALYEMNAWLDRFC  797



>gb|EPB65502.1| peptidase, S9A/B/C family, catalytic domain protein [Ancylostoma 
ceylanicum]
Length=231

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNR+LTPFGFQ E+R  WEA 
Sbjct  84   YIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRSLTPFGFQGEERNYWEAK  142

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y +MSPF  A+K+K P+LLIHG +DNN GT  +QS+R+F ALKG GA  R V+LP ES
Sbjct  143  EVYDKMSPFNYADKMKTPMLLIHGADDNNSGTFPIQSERYFQALKGFGAPVRYVVLPKES  202

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESI+H+LWE D+W+++H 
Sbjct  203  HGYAAKESILHLLWEQDQWLEEHV  226



>ref|WP_026628138.1| aminoacyl peptidase [Dysgonomonas capnocytophagoides]
Length=805

 Score =   216 bits (549),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEAT
Sbjct  659  YIDRRKVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAT  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K PILLIHG  DNN GT T+QS+R+F ALKG GA  RLVILP ES
Sbjct  718  DVYNAMSPFMHADKMKTPILLIHGGNDNNSGTFTLQSERYFAALKGLGAPARLVILPLES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESI+H LWE D+W++K+ 
Sbjct  778  HGYAAKESILHTLWEQDQWLEKYV  801



>ref|WP_026839309.1| aminoacyl peptidase [Gillisia sp. JM1]
Length=818

 Score =   216 bits (549),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  659  YIDRNRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLVILP ES
Sbjct  718  EVYNAMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVILPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTK  433
            HGY+A+ES++HVLWE  +W++K+ V N  K +   K
Sbjct  778  HGYSAKESVLHVLWEQHQWLEKY-VKNRVKTEISQK  812



>ref|WP_007648506.1| hypothetical protein [Formosa sp. AK20]
 gb|EMQ95420.1| hypothetical protein D778_02514 [Formosa sp. AK20]
Length=810

 Score =   216 bits (549),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  654  ALGYIDRHKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYW  712

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+ +K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP
Sbjct  713  EAPEIYYNMSPFMHADTMKTPLLLIHGEADNNSGTYPLQSERYFNALKGLGAPVRLVMLP  772

Query  549  FESHGYTARESIMHVLWETDRWVQKHCVPNT  457
             ESHGY A+ESI+H+LWE D+W++ H   NT
Sbjct  773  KESHGYAAKESILHMLWEQDKWLEDHVKNNT  803



>ref|WP_008239252.1| prolyl oligopeptidase [Imtechella halotolerans]
 gb|EID74702.1| prolyl oligopeptidase [Imtechella halotolerans K1]
Length=805

 Score =   215 bits (548),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  656  ALGYIDRNRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP
Sbjct  715  EAPDVYNTMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGFGAPARLVMLP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A ES+MHVLWE D+W++ H 
Sbjct  775  KESHGYAAWESVMHVLWEQDQWLETHV  801



>ref|WP_026711422.1| aminoacyl peptidase [Flavobacterium filum]
Length=800

 Score =   215 bits (548),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R+K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W+  
Sbjct  657  YINRSKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWDVP  715

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+ANK+K P+LL HGE DNNPGT T+Q++R+F ALK  GA  R+VILP ES
Sbjct  716  EVYNTMSPFMNANKMKTPLLLTHGEADNNPGTFTLQTERYFQALKNLGAPVRMVILPKES  775

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++KH 
Sbjct  776  HGYVAKENILHLLWEQDQFLEKHL  799



>ref|WP_027077948.1| aminoacyl peptidase [Maribacter antarcticus]
Length=818

 Score =   215 bits (548),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 124/161 (77%), Gaps = 6/161 (4%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFM ANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  659  YIDRKKVAVGGHSYGAFMVANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K++ P+LL+HGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  718  EVYYTMSPFMHADKMRTPLLLVHGEADNNSGTYPMQSERYFNALKGLGATVRLVMLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDP  418
            HGY A+ES++H+LWE D+W+ KH      K + +T V  +P
Sbjct  778  HGYRAKESVLHLLWEQDQWLNKHV-----KQEENTIVNPEP  813



>ref|WP_007094759.1| 50S ribosomal protein L33 [Kordia algicida]
 gb|EDP95454.1| 50S ribosomal protein L33 [Kordia algicida OT-1]
Length=808

 Score =   215 bits (548),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTP+GFQ+E+R  WEA 
Sbjct  658  YIDRTKVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPYGFQSEERNYWEAP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  717  EVYYNMSPFMHADKMKTPLLLIHGEADNNSGTYPLQSERYFNALKGMGAPVRLVMLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY +RESI+H+LWE DRW++ H 
Sbjct  777  HGYRSRESILHLLWEQDRWLEMHL  800



>ref|WP_033370130.1| aminoacyl peptidase [Hymenobacter norwichensis]
Length=817

 Score =   215 bits (547),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++ AV GHSYGAFMTANLLAH+ +LF  GIARSGAYNRTLTPFGFQ E+RT W+A   Y 
Sbjct  659  SRVAVMGHSYGAFMTANLLAHS-NLFRAGIARSGAYNRTLTPFGFQGEERTYWQAPEVYN  717

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
             MSPF  A+KIK PILLIHGE DNN GT  +QS+RF+NALKGHGA  R V+LP ESHGY 
Sbjct  718  TMSPFNYADKIKTPILLIHGEADNNSGTFPIQSERFYNALKGHGATVRYVVLPAESHGYA  777

Query  528  ARESIMHVLWETDRWVQKHCVPNTSKVDTDT  436
            ARESIMH+LWE + W+ KH V N + VDT +
Sbjct  778  ARESIMHMLWEMNTWLDKH-VKNPTAVDTSS  807



>ref|WP_045802485.1| aminoacyl peptidase [Muricauda lutaonensis]
 gb|AKA35886.1| aminoacyl peptidase [Muricauda lutaonensis]
Length=815

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  657  YIDRDRVAVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  715

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  716  KVYYTMSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATVRLVMLPKES  775

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESI+H+LWE DRW++K+ 
Sbjct  776  HGYRAKESILHLLWEQDRWLEKYV  799



>ref|WP_009780757.1| hypothetical protein [Leeuwenhoekiella blandensis]
 gb|EAQ49568.1| hypothetical protein MED217_11954 [Leeuwenhoekiella blandensis 
MED217]
Length=816

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ W
Sbjct  655  ALGYIDRDRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYW  713

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y EMSPFM A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP
Sbjct  714  EAPEIYYEMSPFMHADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGATARLVMLP  773

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+ESI+H+LWE D+W++++ 
Sbjct  774  KESHGYAAKESILHMLWEQDQWLEQYV  800



>ref|WP_006987956.1| hypothetical protein [Gillisia limnaea]
 gb|EHQ01634.1| hypothetical protein Gilli_0948 [Gillisia limnaea DSM 15749]
Length=818

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  659  FIDRDRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM  +K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  718  EVYNAMSPFMHVDKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+A+ES++HVLWE D+W++K+ 
Sbjct  778  HGYSAKESVLHVLWEQDQWLEKYV  801



>gb|KDD76957.1| hypothetical protein H632_c56p2 [Helicosporidium sp. ATCC 50920]
Length=883

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  879  AVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMS  700
            AVGGHSYGAFM ANLL HAP LF+CGI RSGAYNRTLTPF FQ E RTLW+A  TY++MS
Sbjct  732  AVGGHSYGAFMAANLLVHAPELFACGIGRSGAYNRTLTPFSFQQEQRTLWQAPDTYLKMS  791

Query  699  PFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTARE  520
            PFM A+++++P L+IHG EDNN GT TMQS+R + ALKGHGA+ RLV+LP ESHGY A E
Sbjct  792  PFMHADRMRRPFLIIHGAEDNNTGTFTMQSERLYAALKGHGAVTRLVLLPHESHGYRALE  851

Query  519  SIMHVLWETDRWVQKHC  469
            S+MH L E D W+ ++C
Sbjct  852  SVMHTLREQDDWLSRYC  868



>ref|WP_026933879.1| aminoacyl peptidase [Gramella echinicola]
Length=821

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  660  YVDRNRVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM  +K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  719  EVYNTMSPFMHTDKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC--VPNTSKVDTDTK  433
            HGY+A+ES++HVLWE D+W++K+     N  +V+ ++K
Sbjct  779  HGYSAKESVLHVLWEQDQWLEKYVKNSKNEEEVEDNSK  816



>ref|WP_029952658.1| MULTISPECIES: aminoacyl peptidase [unclassified Cloacimonetes]
Length=819

 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = -2

Query  921  EKLFAVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNED  742
            +KL  +E     + A+GGHSYGAFM ANLLAH+  LF+ G+A++GAYNRTLTPFGFQ+ED
Sbjct  664  DKLVGLEIADSNRIAIGGHSYGAFMAANLLAHS-DLFAAGVAKTGAYNRTLTPFGFQSED  722

Query  741  RTLWEATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRL  562
            R LWEA  TY++MSPFM ANKI +PILL+HG+ D N GT  MQS+RF++ALKG+GA  RL
Sbjct  723  RLLWEAQDTYIKMSPFMYANKINEPILLVHGKSDRNSGTFPMQSERFYHALKGNGATARL  782

Query  561  VILPFESHGYTARESIMHVLWETDRWVQKHC  469
            V+LP+E H Y ARES++HVLWE +RW+ K+ 
Sbjct  783  VMLPYEGHSYRARESVLHVLWEMNRWLNKYV  813



>gb|EMY82435.1| dipeptidyl aminopeptidase/acylaminoacyl-peptidase family protein 
[Psychroflexus gondwanensis ACAM 44]
Length=796

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WE+ 
Sbjct  647  YIDRNKVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWESP  705

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A+K+K P+LLIHG+ DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  706  EVYNTMSPFMNAHKMKTPLLLIHGQADNNSGTYPMQSERYFNALKGLGAPARLVMLPKES  765

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE D+W++K+ 
Sbjct  766  HGYAAKESIMHMLWEQDQWLEKYV  789



>ref|WP_035650219.1| aminoacyl peptidase [Flavobacterium sp. Fl]
Length=803

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K PILL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPQVYNTMSPFMNADKMKTPILLVHGEADNNPGTFTLQTERYFQALKGLGANARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+H Y A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHSYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_038527796.1| aminoacyl peptidase [Formosa agariphila]
 emb|CDF78512.1| peptidase, family S9, prolyl oligopeptidase [Formosa agariphila 
KMM 3901]
Length=809

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLLAH+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  657  YIDRERVAVGGHSYGAFMTANLLAHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  715

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  716  EIYNSMSPFMHADKMKTPLLLIHGEADNNSGTYPLQSERYFNALKGLGAPVRLVMLPRES  775

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+A+ESI+H+LWE D+W++ H 
Sbjct  776  HGYSAKESILHMLWEQDQWLEDHV  799



>ref|WP_026727763.1| aminoacyl peptidase [Flavobacterium denitrificans]
Length=803

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K PILL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPQVYNTMSPFMNADKMKTPILLVHGEADNNPGTFTLQTERYFQALKGLGANARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+H Y A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHSYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_040555677.1| aminoacyl peptidase [Psychroflexus gondwanensis]
Length=807

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WE+ 
Sbjct  658  YIDRNKVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWESP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A+K+K P+LLIHG+ DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  717  EVYNTMSPFMNAHKMKTPLLLIHGQADNNSGTYPMQSERYFNALKGLGAPARLVMLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE D+W++K+ 
Sbjct  777  HGYAAKESIMHMLWEQDQWLEKYV  800



>ref|WP_023570215.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
cauense]
 gb|ESU20743.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
cauense R2A-7]
 gb|KGO82887.1| aminoacyl peptidase [Flavobacterium cauense R2A-7]
Length=804

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE  
Sbjct  660  YINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEVP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  719  NIYNGMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I H+LWE D++++K+ 
Sbjct  779  HGYVAKENIFHLLWEQDQFLEKYL  802



>ref|WP_026706913.1| aminoacyl peptidase [Flavobacterium frigidarium]
Length=803

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ + K AVGGHSYGAFMTANLL H+  LF+CGIARSGAYNRTLTPFGFQ+E R  W
Sbjct  656  ALGYINKKKVAVGGHSYGAFMTANLLTHS-DLFACGIARSGAYNRTLTPFGFQSEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM+A ++K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EAPEIYNTMSPFMNAKQMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I+H+LWE D++++K+ 
Sbjct  775  KESHGYAAKENILHLLWEQDQFLEKYL  801



>ref|WP_017494897.1| glutamyl peptidase [Flavobacterium sp. WG21]
Length=803

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K A+GGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  656  ALGYINRKKVAIGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y +MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R++ ALKG GA  R+VILP
Sbjct  715  EVPEVYTKMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYYQALKGLGATARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+H Y A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHSYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_028607040.1| aminoacyl peptidase [Olleya sp. VCSM12]
Length=802

 Score =   214 bits (545),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  656  YIDRNKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  714

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  715  EIYYNMSPFMHADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGAPVRLVMLPKES  774

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE ++W+ KH 
Sbjct  775  HGYRAKESIMHMLWEQEQWLDKHV  798



>ref|WP_028289494.1| aminoacyl peptidase [Olleya sp. VCSA23]
Length=802

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  656  YIDRNKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  714

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  715  EIYYNMSPFMHADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGAPVRLVMLPKES  774

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE ++W+ KH 
Sbjct  775  HGYRAKESIMHMLWEQEQWLDKHV  798



>ref|WP_044399417.1| aminoacyl peptidase [Lacinutrix sp. Hel_I_90]
Length=814

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  657  YINRDKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  715

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+ +K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  716  EIYYNMSPFMHADTMKTPLLLIHGEADNNSGTYPLQSERYFNALKGLGAPVRLVMLPKES  775

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ES+MH+LWE D+W++K+ 
Sbjct  776  HGYRAKESVMHLLWEQDQWLEKYL  799



>ref|WP_041519915.1| aminoacyl peptidase [Flavobacterium hibernum]
 gb|KIO51109.1| aminoacyl peptidase [Flavobacterium hibernum]
Length=803

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ E R  WE  
Sbjct  659  YINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQTEQRNYWEVP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFMSA+K+K P+LL+HGE DNNPGT T+Q++R++ ALKG GA  R+VILP E+
Sbjct  718  EVYTTMSPFMSADKMKTPLLLVHGEADNNPGTFTLQTERYYQALKGLGATARMVILPKEA  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            H Y A+E+I+H+LWE D++++K+ 
Sbjct  778  HSYVAKENILHLLWEQDQFLEKYL  801



>ref|WP_035654801.1| aminoacyl peptidase [Flavobacterium saliperosum]
Length=804

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE  
Sbjct  660  YINRKKVAVGGHSYGAFMTANLLSHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEVP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  719  NIYNGMSPFMNAEKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I H+LWE D++++K+ 
Sbjct  779  HGYAAKENIFHLLWEQDQFLEKYL  802



>ref|WP_026724532.1| aminoacyl peptidase [Flavobacterium sasangense]
Length=803

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K A+GGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W+  
Sbjct  659  YINRKKVAIGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWDVP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A K+K P+LL+HGE DNNPGT T+QS+R+F ALKG G   RLVILP ES
Sbjct  718  EVYNTMSPFMNAEKMKTPLLLVHGEADNNPGTFTLQSERYFQALKGLGGPARLVILPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  778  HGYVAKENILHLLWEQDQFLEKYL  801



>emb|CAG27629.1| unknown protein [Populus deltoides x Populus maximowiczii]
Length=139

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 103/131 (79%), Gaps = 8/131 (6%)
 Frame = -2

Query  717  TYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESH  538
            TYVEMSPFMSANKIKKPILLIHGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESH
Sbjct  1    TYVEMSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESH  60

Query  537  GYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTEDPESKAVS--------ASGAGV  382
            GY ARESI+HVLWETDRW+QKHCVPN+S    +     D  SK V+        ASG G 
Sbjct  61   GYAARESILHVLWETDRWLQKHCVPNSSDASAELDACRDEVSKGVTDSDNQTVVASGGGG  120

Query  381  PELASDSNDTF  349
            PELA   ++ F
Sbjct  121  PELADFEHEGF  131



>gb|ESU23872.1| hypothetical protein FSS13T_21770 [Flavobacterium saliperosum 
S13]
Length=833

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE  
Sbjct  689  YINRKKVAVGGHSYGAFMTANLLSHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEVP  747

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  748  NIYNGMSPFMNAEKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKES  807

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I H+LWE D++++K+ 
Sbjct  808  HGYAAKENIFHLLWEQDQFLEKYL  831



>ref|WP_026915443.1| aminoacyl peptidase [Gramella portivictoriae]
Length=818

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  660  YVDRDRVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A K+  P+L+IHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  719  EIYNTMSPFMHAEKMDTPLLMIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTE  424
            HGY+A+ES++HVLWE D+W++K+      ++++ T++ E
Sbjct  779  HGYSAKESVLHVLWEQDQWLEKYV--KNKEIESKTEIQE  815



>ref|WP_026451707.1| aminoacyl peptidase [Aequorivita capsosiphonis]
Length=806

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R +  VGGHSYGAFM ANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ W++ 
Sbjct  659  YIDRNRVGVGGHSYGAFMVANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWDSP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
             TY  MSPFM+A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  718  ITYNTMSPFMNADKMKSPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+A+ES++HVLWE D+W+ K+ 
Sbjct  778  HGYSAKESVLHVLWEQDQWLDKYV  801



>ref|WP_025607761.1| aminoacyl peptidase [Pontibacter actiniarum]
Length=821

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFMT NLLAH+  LF+ GIARSGAYNRTLTPFGFQ E+RT W+A   Y +
Sbjct  678  RVAVGGHSYGAFMTGNLLAHS-DLFAAGIARSGAYNRTLTPFGFQAEERTYWDAPEVYFQ  736

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF  ANK+ +PILLIHGE DNN GT  +QS+RF+NALKGHGA  RLV LP ESHGY A
Sbjct  737  MSPFSFANKVNEPILLIHGEADNNSGTFPIQSERFYNALKGHGATARLVFLPAESHGYRA  796

Query  525  RESIMHVLWETDRWVQKHC  469
            +ESI+H+LWE D+W+ K+ 
Sbjct  797  KESILHMLWEMDQWLDKYV  815



>ref|WP_013598252.1| prolyl oligopeptidase [Weeksella virosa]
 gb|ADX67862.1| prolyl oligopeptidase [Weeksella virosa DSM 16922]
Length=815

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R +  VGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  661  YIDRTRVGVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  719

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPF +ANK+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  R V+LP ES
Sbjct  720  EVYNTMSPFQNANKMKTPLLLIHGEADNNSGTFPMQSERYFNALKGLGATARYVVLPKES  779

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+ARES++H+LWE D+W++K+ 
Sbjct  780  HGYSARESVLHMLWEQDQWLEKYV  803



>ref|WP_009581987.1| hypothetical protein [Fulvivirga imtechensis]
 gb|ELR69609.1| hypothetical protein C900_04834 [Fulvivirga imtechensis AK7]
Length=816

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++   K AVGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WE+ 
Sbjct  659  YIDTEKVAVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWESP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
             TY +MSPFM A+K+K P+LLIHG EDNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  718  ETYYDMSPFMHADKMKAPLLLIHGLEDNNSGTYPLQSERYFNALKGLGATARLVMLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTE  424
            HGY ARESI+H+LWE D+W+ K+      ++ ++   TE
Sbjct  778  HGYRARESILHILWEQDQWLDKYVKNKNKEIISEAGGTE  816



>ref|WP_019038477.1| hypothetical protein [Psychroflexus tropicus]
Length=806

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  658  YIDRNRVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A K+K P+LLIHG+ DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  717  EVYNTMSPFMNAEKMKTPLLLIHGQADNNSGTYPMQSERYFNALKGLGAPARLVMLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE D W++K+ 
Sbjct  777  HGYAAKESIMHMLWEQDEWLEKYV  800



>ref|WP_045028808.1| aminoacyl peptidase [Draconibacterium sp. JN14CK-3]
 gb|KJF45023.1| aminoacyl peptidase [Draconibacterium sp. JN14CK-3]
Length=805

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+RT WEA 
Sbjct  659  YIDRDRVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERTYWEAP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHG  DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  718  EVYYTMSPFMHADKMKTPLLLIHGMADNNSGTYPMQSERYFNALKGLGAPVRLVMLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+ARESI H+LWE D+W++K+ 
Sbjct  778  HGYSARESISHMLWEQDQWLEKYV  801



>ref|WP_011710208.1| hypothetical protein [Gramella forsetii]
 emb|CAL67305.1| conserved hypothetical protein [Gramella forsetii KT0803]
Length=822

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  660  YVDRDRVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  718

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM  +K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  719  EVYNTMSPFMHTDKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKES  778

Query  540  HGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTK  433
            HGY+A+ES++HVLWE ++W++K+ V N +  D D +
Sbjct  779  HGYSAKESVLHVLWEQNQWLEKY-VKNRNLEDEDQE  813



>ref|WP_013445337.1| hypothetical protein [Paludibacter propionicigenes]
 gb|ADQ79968.1| hypothetical protein Palpr_1829 [Paludibacter propionicigenes 
WB4]
Length=804

 Score =   213 bits (541),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ RAK AVGGHSYGAFMTANLL H  +LF+CGIARSGAYNRTLTPFGFQ+E R  W+A 
Sbjct  661  YINRAKVAVGGHSYGAFMTANLLTHC-NLFACGIARSGAYNRTLTPFGFQSEQRNYWDAP  719

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPF +A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP E 
Sbjct  720  EVYNAMSPFQNADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKEQ  779

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            H Y ARE+I+H+LWE DR+++K+ 
Sbjct  780  HSYVARENILHLLWEQDRFLEKYL  803



>ref|WP_041496510.1| aminoacyl peptidase [Nonlabens marinus]
 dbj|BAO56008.1| hypothetical protein NMS_1999 [Nonlabens marinus S1-08]
Length=823

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R +  VGGHSYGAFMTANLLAH+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  662  YIDRNRVGVGGHSYGAFMTANLLAHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  720

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A K+ +PILLIHG+ DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  721  EIYNTMSPFMNAEKVDEPILLIHGQADNNSGTYPLQSERYFNALKGLGATARLVMLPKES  780

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESI+HVLWE D+W+ K+ 
Sbjct  781  HGYAAKESILHVLWEQDQWLDKYV  804



>ref|WP_027880108.1| aminoacyl peptidase [Mesoflavibacter zeaxanthinifaciens]
Length=800

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA   Y  
Sbjct  659  KVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAPEIYNT  717

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM+A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP ESHGY A
Sbjct  718  MSPFMNADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGAPVRLVMLPKESHGYRA  777

Query  525  RESIMHVLWETDRWVQKHC  469
            +ESIMH+LWE D+W++KH 
Sbjct  778  KESIMHMLWEQDQWLEKHV  796



>ref|WP_009036124.1| prolyl oligopeptidase family protein [Indibacter alkaliphilus]
 gb|EOZ96138.1| hypothetical protein A33Q_2731 [Indibacter alkaliphilus LW1]
Length=807

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R K AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ E RT WEA   Y
Sbjct  664  RNKIAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQYEQRTYWEAPDVY  722

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
              MSPFM+ANK+K PILLIHGE DNN GT  +QS+R++NALKGHGA  RLV LP ESHGY
Sbjct  723  NTMSPFMNANKVKTPILLIHGEADNNSGTFPIQSERYYNALKGHGATTRLVFLPHESHGY  782

Query  531  TARESIMHVLWETDRWVQKHC  469
            +A+ESI+H L+E   W++K+ 
Sbjct  783  SAKESILHTLYEQHEWLEKYV  803



>ref|WP_026704194.1| aminoacyl peptidase [Flavobacterium soli]
Length=803

 Score =   213 bits (541),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++   K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE+ 
Sbjct  659  YINPKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWESP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A+K+K P+LL HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  718  EVYNTMSPFMNADKMKTPLLLTHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++KH 
Sbjct  778  HGYVAKENILHLLWEQDQFLEKHL  801



>ref|WP_026717986.1| aminoacyl peptidase [Flavobacterium gelidilacus]
Length=802

 Score =   213 bits (541),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ +AK AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W+  
Sbjct  658  YINKAKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWDVP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+V+LP ES
Sbjct  717  AIYNTMSPFMNAQKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVLLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I H+LWE D++++K+ 
Sbjct  777  HGYVAQENIFHLLWEQDQFLEKYL  800



>ref|WP_028374744.1| aminoacyl peptidase [Leeuwenhoekiella sp. Hel_I_48]
Length=816

 Score =   213 bits (541),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  655  ALGYIDRNKVAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYW  713

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP
Sbjct  714  EAPEVYNTMSPFMHADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGATARLVMLP  773

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+ESI+H+LWE D+W++K+ 
Sbjct  774  KESHGYAAKESILHMLWEQDQWLEKYV  800



>ref|WP_022826900.1| glutamyl peptidase [Flavobacterium antarcticum]
Length=802

 Score =   212 bits (540),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++   K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE  
Sbjct  658  YINPKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEVP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y EMSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+V+LP ES
Sbjct  717  QIYNEMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVLLPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  777  HGYAAKENILHLLWEQDQFLEKYL  800



>ref|WP_041913606.1| aminoacyl peptidase [Capnocytophaga canimorsus]
Length=791

 Score =   212 bits (540),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++   + AVGGHSYGAFMTANLL H+  LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  645  ALGYIDTKRVAVGGHSYGAFMTANLLTHS-DLFACGIARSGAYNRTLTPFGFQREQRNYW  703

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            +A   Y  MSPFM+A+K+KKP+LLIHG  DNNPGT T+Q++R+F ALK  GA  R+V+LP
Sbjct  704  DAPEVYNTMSPFMNAHKMKKPLLLIHGAADNNPGTFTLQTERYFQALKNLGAPVRMVLLP  763

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
            FESHGY A+ESI+H LWE D++++KH 
Sbjct  764  FESHGYQAKESILHTLWEQDQFLEKHL  790



>gb|AEK23470.1| Uncharacterized peptidase yuxL [Capnocytophaga canimorsus Cc5]
Length=798

 Score =   212 bits (540),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++   + AVGGHSYGAFMTANLL H+  LF+CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  652  ALGYIDTKRVAVGGHSYGAFMTANLLTHS-DLFACGIARSGAYNRTLTPFGFQREQRNYW  710

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            +A   Y  MSPFM+A+K+KKP+LLIHG  DNNPGT T+Q++R+F ALK  GA  R+V+LP
Sbjct  711  DAPEVYNTMSPFMNAHKMKKPLLLIHGAADNNPGTFTLQTERYFQALKNLGAPVRMVLLP  770

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
            FESHGY A+ESI+H LWE D++++KH 
Sbjct  771  FESHGYQAKESILHTLWEQDQFLEKHL  797



>ref|WP_016989226.1| glutamyl peptidase [Flavobacterium sp. ACAM 123]
Length=803

 Score =   212 bits (540),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFM ANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE  
Sbjct  659  YIDRNKVAVGGHSYGAFMVANLLTHS-NLFTCGIARSGAYNRTLTPFGFQSEQRNYWEVP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP E+
Sbjct  718  GVYNTMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILPKEA  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  778  HGYAAKENILHLLWEQDQFLEKYL  801



>ref|WP_028872772.1| aminoacyl peptidase [Psychroserpens burtonensis]
Length=814

 Score =   212 bits (540),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA 
Sbjct  654  YIDRNKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAP  712

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  713  EIYDNMSPFMHADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGAPVRLVMLPKES  772

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+ESIMH+LWE D+W+  H 
Sbjct  773  HGYRAKESIMHMLWEQDQWLDTHV  796



>ref|WP_008272448.1| hypothetical protein [Flavobacteriales bacterium ALC-1]
 gb|EDP69479.1| hypothetical protein FBALC1_05288 [Flavobacteriales bacterium 
ALC-1]
Length=814

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ W
Sbjct  651  ALGYINRKKVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYW  709

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+K+K P+LLIHG  DNN GT  +QS+R+FNALKG GA  RLV+LP
Sbjct  710  EAPEIYYNMSPFMHADKMKTPLLLIHGVADNNSGTYPLQSERYFNALKGLGAPVRLVMLP  769

Query  549  FESHGYTARESIMHVLWETDRWV  481
             ESHGY A+ESIMH+LWE D+W+
Sbjct  770  KESHGYRAKESIMHMLWEQDQWL  792



>ref|WP_045972581.1| aminoacyl peptidase [Flavobacterium sp. 316]
 gb|KIX19738.1| aminoacyl peptidase [Flavobacterium sp. 316]
Length=803

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R+K  VGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W+  
Sbjct  659  YINRSKVGVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWDVP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+V+LP ES
Sbjct  718  EIYNTMSPFMNASKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVLLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A E+I+H+LWE D++++KH 
Sbjct  778  HGYVAEENILHLLWEQDQFLEKHL  801



>ref|WP_035125871.1| aminoacyl peptidase [Flavobacterium aquatile]
 gb|KGD68205.1| aminoacyl peptidase [Flavobacterium aquatile LMG 4008]
Length=802

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W+  
Sbjct  658  YINRKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWDVP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
            + Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALK  GA  R+VILP ES
Sbjct  717  AIYNGMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKNLGAPTRMVILPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  777  HGYAAKENILHLLWEQDQFLEKYL  800



>ref|WP_040443844.1| aminoacyl peptidase [Eudoraea adriatica]
Length=814

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R++ AVGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  655  AMGYIDRSRVAVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYW  713

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+K+K P+L+ HGE DNN GT  MQS R+FNALKG GA  RLV+LP
Sbjct  714  EAPEVYYTMSPFMHADKMKTPLLMTHGEADNNSGTYPMQSIRYFNALKGLGAQVRLVMLP  773

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+ESI+H+LWE D+W++K+ 
Sbjct  774  NESHGYRAKESILHLLWEQDQWLEKYV  800



>ref|WP_032131229.1| aminoacyl peptidase [Weeksella sp. FF8]
Length=815

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R +  VGGHSYGAFMTANLL ++  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA 
Sbjct  661  YIDRTRVGVGGHSYGAFMTANLLTYS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAP  719

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPF +ANK+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  R V+LP ES
Sbjct  720  EVYNTMSPFQNANKMKTPLLLIHGEADNNSGTFPMQSERYFNALKGLGATARYVVLPKES  779

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+ARES++H+LWE D+W++K+ 
Sbjct  780  HGYSARESVLHMLWEQDQWLEKYV  803



>ref|WP_035084383.1| aminoacyl peptidase [Aquimarina latercula]
Length=810

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  897  LTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATS  718
            + R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R+ WEA  
Sbjct  657  IDRNRVAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERSYWEAPE  715

Query  717  TYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESH  538
             Y  MSPFM A+K+K P+LLIHG+ DNN GT  +QS+R+FNALKG GA  RL++LP ESH
Sbjct  716  VYNTMSPFMHADKMKTPLLLIHGKADNNSGTYPLQSERYFNALKGLGATARLIMLPKESH  775

Query  537  GYTARESIMHVLWETDRWVQKHC  469
            GY A+ESI+H+LWE D+W++K+ 
Sbjct  776  GYRAKESILHLLWEQDQWLEKYV  798



>ref|WP_044014202.1| aminoacyl peptidase [Hymenobacter sp. APR13]
 gb|AII51349.1| hypothetical protein N008_05040 [Hymenobacter sp. APR13]
Length=817

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AV GHSYGAFMTANLLAH+ +LF  GIARSGAYNRTLTPFGFQ E+RT W+A   Y  
Sbjct  660  RVAVMGHSYGAFMTANLLAHS-NLFRAGIARSGAYNRTLTPFGFQGEERTYWQAPEVYNA  718

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF  ANKIK PILLIHGE DNN GT  +QS+RF+NALKGHGA  R V+LP ESHGY A
Sbjct  719  MSPFNYANKIKTPILLIHGEADNNSGTFPIQSERFYNALKGHGATVRYVVLPAESHGYAA  778

Query  525  RESIMHVLWETDRWVQKHC  469
            RESIMH+LWE + W+ K+ 
Sbjct  779  RESIMHMLWEMNSWLNKYV  797



>ref|WP_007136399.1| hypothetical protein [Flavobacterium frigoris]
 gb|EIA10482.1| hypothetical protein HJ01_00222 [Flavobacterium frigoris PS1]
Length=803

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 119/147 (81%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ + K A+GGHSYGAFM ANLL H+  LF+CGIARSGAYNRTLTPFGFQ+E R  W
Sbjct  656  ALGYINKEKVAIGGHSYGAFMVANLLTHS-KLFACGIARSGAYNRTLTPFGFQSEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPEVYNTMSPFMNADKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPARMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             E+HGY A+E+I+H+LWE D++++K+ 
Sbjct  775  KEAHGYAAKENILHLLWEQDQFLEKYL  801



>ref|WP_038334706.1| aminoacyl peptidase [Empedobacter falsenii]
Length=814

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R + AVGGHSYGAFMTANLL H+ +LF+ GIARSGAYNRTLTPFGFQ+E R  WEA 
Sbjct  662  YIDRERVAVGGHSYGAFMTANLLTHS-NLFAAGIARSGAYNRTLTPFGFQSEQRNYWEAP  720

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  M+PF +A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  721  DVYNTMAPFQNADKMKTPLLLIHGEADNNTGTFPMQSERYFNALKGLGATTRLVLLPQES  780

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY ARE+I+H+LWE ++W++K+ 
Sbjct  781  HGYAARENILHMLWEQNQWLEKYV  804



>ref|WP_008628244.1| hypothetical protein [Mariniradius saccharolyticus]
 gb|EMS32898.1| hypothetical protein C943_00905 [Mariniradius saccharolyticus 
AK6]
Length=807

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ E R+ WEA   Y
Sbjct  664  RNRIAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQYEQRSYWEAPDVY  722

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
              MSPFM+ANK+K PILLIHGE DNN GT  +QS+R++NALKGHGA  RLV LP ESHGY
Sbjct  723  NVMSPFMNANKVKTPILLIHGEADNNSGTFPIQSERYYNALKGHGATTRLVFLPHESHGY  782

Query  531  TARESIMHVLWETDRWVQK  475
             A+ESI+H LWE  +W++K
Sbjct  783  AAKESILHTLWEQHQWLEK  801



>ref|WP_019975615.1| hypothetical protein [Empedobacter brevis]
Length=814

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R K AVGGHSYGAFMTANLL H+ +LF+ GIARSGAYNRTLTPFGFQ+E R  WEA 
Sbjct  662  FIDREKVAVGGHSYGAFMTANLLTHS-NLFAAGIARSGAYNRTLTPFGFQSEQRNYWEAP  720

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  M+PF +ANK+K P+LLIHG+ DNN GT  MQS+R+FNALKG GA  RLV+LP ES
Sbjct  721  DVYNIMAPFQNANKMKTPLLLIHGDADNNTGTFPMQSERYFNALKGLGATTRLVLLPKES  780

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+++H+LWE D+W++K+ 
Sbjct  781  HGYAAKENVLHMLWEQDQWLEKYV  804



>ref|WP_013070685.1| prolyl oligopeptidase [Zunongwangia profunda]
 gb|ADF51533.1| prolyl oligopeptidase [Zunongwangia profunda SM-A87]
Length=820

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R  WEA   Y  
Sbjct  666  RVAVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYWEAPEVYYT  724

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM A+K+K P+LLIHGE DNN GT  MQS+R+FNALKG GA  RLV+LP ESHGY+A
Sbjct  725  MSPFMHADKMKTPLLLIHGEADNNSGTYPMQSERYFNALKGLGATARLVMLPKESHGYSA  784

Query  525  RESIMHVLWETDRWVQKHC  469
            +ES++HVLWE D W++K+ 
Sbjct  785  KESVLHVLWEQDEWLEKYV  803



>ref|WP_026952618.1| aminoacyl peptidase [Algoriphagus mannitolivorans]
Length=804

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R + AVGGHSYGAFMTANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ E RT WEA   Y
Sbjct  661  RNRIAVGGHSYGAFMTANLLSHS-NLFAAGIARSGAYNRTLTPFGFQYEQRTYWEAPEVY  719

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
              MSPF  A+++K PILLIHGE DNN GT  +QS+R++NALKGHGA  RLV LP ESHGY
Sbjct  720  FNMSPFSFAHQVKTPILLIHGEADNNSGTFPIQSERYYNALKGHGATTRLVFLPHESHGY  779

Query  531  TARESIMHVLWETDRWVQKHC  469
             A+ESI+H LWE D W++K+ 
Sbjct  780  AAKESILHTLWEMDSWLEKYV  800



>ref|WP_015265145.1| prolyl oligopeptidase family protein [Echinicola vietnamensis]
 gb|AGA77581.1| prolyl oligopeptidase family protein [Echinicola vietnamensis 
DSM 17526]
Length=810

 Score =   211 bits (537),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R + AVGGHSYGAFMTANLL+H+  LF+ GIARSGAYNRTLTPFGFQ E RT WEA   Y
Sbjct  666  RDRIAVGGHSYGAFMTANLLSHS-DLFAAGIARSGAYNRTLTPFGFQYEQRTYWEAPDVY  724

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
              MSPFM ANK+K PILLIHGE DNN GT  +QS+R++NALKGHGA  RLV LP ESHGY
Sbjct  725  FNMSPFMHANKVKTPILLIHGEADNNSGTFPIQSERYYNALKGHGATARLVFLPNESHGY  784

Query  531  TARESIMHVLWETDRWVQK  475
             A ESIMH L+E + W++K
Sbjct  785  AAEESIMHTLYEMNEWLEK  803



>ref|WP_026976430.1| aminoacyl peptidase [Flavobacterium tegetincola]
Length=802

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++   K AVGGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  WE  
Sbjct  658  YINPKKVAVGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYWEVP  716

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP ES
Sbjct  717  EVYNTMSPFMNAGKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILPKES  776

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  777  HGYAAKENILHLLWEQDQFLEKYL  800



>ref|WP_018479746.1| glutamyl peptidase [Pontibacter roseus]
Length=823

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R + AVGGHSYGAFMT NLLAH+  LF+ GIARSGAYNRTLTPFGFQ E+RT W+A   Y
Sbjct  678  RKRIAVGGHSYGAFMTGNLLAHS-DLFAAGIARSGAYNRTLTPFGFQQEERTYWQAPEVY  736

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
              MSPF +A+K+K PILL+HGE DNN GT  +QS+RF+NALKGHGA  RLV LP ESHGY
Sbjct  737  NRMSPFSAAHKVKTPILLLHGEADNNSGTFPVQSERFYNALKGHGATTRLVFLPHESHGY  796

Query  531  TARESIMHVLWETDRWVQKHC  469
            +A+ESI+H+LWE D W+  + 
Sbjct  797  SAKESILHMLWEMDTWLNTYV  817



>ref|WP_007653415.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Pontibacter sp. BAB1700]
 gb|EJF11239.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Pontibacter sp. BAB1700]
Length=823

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFMT NLLAH+  LF+ GIARSGAYNRTLTPFGFQ E+RT W+A   Y  
Sbjct  680  RIAVGGHSYGAFMTGNLLAHS-DLFAAGIARSGAYNRTLTPFGFQQEERTYWQAPEVYNR  738

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF +A+K+K PILLIHGE DNN GT  +QS+RF+NALKGHGA  RLV LP ESHGY A
Sbjct  739  MSPFSAAHKVKTPILLIHGEADNNSGTFPIQSERFYNALKGHGATTRLVFLPHESHGYAA  798

Query  525  RESIMHVLWETDRWVQKHC  469
            RESI+H+LWE D W+  + 
Sbjct  799  RESILHMLWEMDIWLNTYV  817



>ref|WP_008637476.1| prolyl oligopeptidase family protein [Bizionia argentinensis]
 gb|EGV43278.1| prolyl oligopeptidase family protein [Bizionia argentinensis 
JUB59]
Length=814

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLLAH+  LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  656  ALGYIDRDRVAVGGHSYGAFMTANLLAHS-DLFAAGIARSGAYNRTLTPFGFQSEERNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A+ +K P+LLIHG+ DNN GT  +QS+R+FNALKG GA  RLV+LP
Sbjct  715  EAPEVYNTMSPFMHAHTMKTPLLLIHGQADNNSGTYPLQSERYFNALKGLGAPVRLVMLP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTK  433
             ESHGY+A ESI+H+LWE D W++ +      + DT +K
Sbjct  775  RESHGYSAEESILHMLWEQDEWLETYVKNKVKETDTSSK  813



>ref|WP_018108058.1| hypothetical protein [Bacteroides propionicifaciens]
Length=809

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+ +LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  659  AMGYIDRDRVAVGGHSYGAFMTANLLTHS-NLFAAGIARSGAYNRTLTPFGFQAEQRNYW  717

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            +    Y  MSPFM A+K+K P+LLIHG +DNNPGT TMQS+R+FNALKG GA  RLV+LP
Sbjct  718  DVPQVYNAMSPFMHADKMKTPMLLIHGADDNNPGTHTMQSERYFNALKGFGAPARLVLLP  777

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+ES++HVLWE D W++ + 
Sbjct  778  KESHGYAAKESVLHVLWEQDCWLENYV  804



>ref|WP_010519922.1| hypothetical protein [Mesoflavibacter zeaxanthinifaciens]
Length=804

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFM ANLL+H+ +LF+ GIARSGAYNRTLTPFGFQ+E+R  W
Sbjct  654  ALGYIDRDRVAVGGHSYGAFMVANLLSHS-NLFAAGIARSGAYNRTLTPFGFQSEERNYW  712

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            EA   Y  MSPFM A K+K P+LL+HG+ DNN GT  MQS+R+FNALKG GA  RLV+ P
Sbjct  713  EAPEVYYTMSPFMHAEKMKTPLLLVHGKADNNSGTYPMQSERYFNALKGLGATVRLVMFP  772

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+ESI+H+LWE D+W+ K+ 
Sbjct  773  KESHGYRAKESILHLLWEQDQWLDKYV  799



>ref|WP_045081693.1| aminoacyl peptidase [Vitellibacter vladivostokensis]
 gb|KJJ37340.1| aminoacyl peptidase [Vitellibacter vladivostokensis]
Length=817

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R +  VGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R+ W++ 
Sbjct  659  YIDRNRVGVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERSYWDSP  717

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
             TY  MSPFM A+K+K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP ES
Sbjct  718  ETYNIMSPFMHADKMKTPLLLIHGEADNNSGTYPLQSERYFNALKGLGATARLVMLPKES  777

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY+A+ESI+HVLWE D+W+ K+ 
Sbjct  778  HGYSAKESILHVLWEQDQWLDKYV  801



>ref|WP_015806071.1| hypothetical protein [Flavobacteriaceae bacterium 3519-10]
 gb|ACU07786.1| hypothetical protein FIC_01338 [Flavobacteriaceae bacterium 3519-10]
Length=800

 Score =   210 bits (535),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R K AVGGHSYGAFMTANLL+H+   ++CGIARSGAYNRTLTPFGFQ E R  W
Sbjct  653  ALGYIDRKKVAVGGHSYGAFMTANLLSHSKD-YACGIARSGAYNRTLTPFGFQAEQRNYW  711

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            +    Y  MSPFM+A+K+K P+LLIHGE DNNPGT T+Q++R+F ALK  GA  R+V+LP
Sbjct  712  DVPEIYNTMSPFMNADKMKTPMLLIHGEADNNPGTFTLQTERYFQALKNLGAPVRMVLLP  771

Query  549  FESHGYTARESIMHVLWETDRWVQKHCV  466
             ESHGY ARE+I+HVLWE D++++K C+
Sbjct  772  LESHGYAARENILHVLWEQDQFLEK-CL  798



>ref|WP_009184839.1| Prolyl oligopeptidase family protein [Cecembia lonarensis]
 gb|EKB49604.1| Prolyl oligopeptidase family protein [Cecembia lonarensis LW9]
Length=807

 Score =   210 bits (535),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  891  RAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTY  712
            R + AVGGHSYGAFMTANLL+H+ +LF+ G+ARSGAYNRTLTPFGFQ E RT WEA   Y
Sbjct  664  RNRIAVGGHSYGAFMTANLLSHS-NLFAAGLARSGAYNRTLTPFGFQYEQRTYWEAPDVY  722

Query  711  VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY  532
              MSPFM+A+K+K PILLIHGE DNN GT  +QS+R++NALKGHGA  RLV LP ESHGY
Sbjct  723  NTMSPFMNAHKVKTPILLIHGEADNNSGTFPIQSERYYNALKGHGATTRLVFLPHESHGY  782

Query  531  TARESIMHVLWETDRWVQKHC  469
             A+ESI+H LWE   W++++ 
Sbjct  783  AAKESILHTLWEQHEWLERYV  803



>ref|WP_035640609.1| aminoacyl peptidase [Flavobacterium sp. EM1308]
 gb|KFC57871.1| dipeptidyl aminopeptidase/acylaminoacyl peptidase [Flavobacterium 
sp. EM1308]
Length=803

 Score =   210 bits (535),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++   K A+GGHSYGAFMTANLL H+ +LF+CGIARSGAYNRTLTPFGFQ+E R  W
Sbjct  656  ALGYINTKKVAIGGHSYGAFMTANLLTHS-NLFACGIARSGAYNRTLTPFGFQSEQRNYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  715  EVPQVYNTMSPFMNAEKMKTPLLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I+H+LWE ++++ K+ 
Sbjct  775  KESHGYVAKENILHLLWEQEQFLDKYL  801



>ref|WP_034259045.1| aminoacyl peptidase [Altibacter lentus]
Length=817

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 127/163 (78%), Gaps = 4/163 (2%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R +  VGGHSYGAFM ANLL+H+  LF+ GIARSGAYNRTLTPFGFQ+E+R+ W
Sbjct  656  AMGYIDRERVGVGGHSYGAFMVANLLSHS-DLFAAGIARSGAYNRTLTPFGFQSEERSYW  714

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            ++  TY  MSPFM A+K+K P+LLIHGE DNN GT  +QS+R+FNALKG GA  RLV+LP
Sbjct  715  DSPETYYNMSPFMHADKMKTPLLLIHGEADNNSGTYPLQSERYFNALKGLGAPARLVMLP  774

Query  549  FESHGYTARESIMHVLWETDRWVQKHCVPNTSKVDTDTKVTED  421
             ESHGY A+ESI+H+LWE D W++ + V N  K   D +V+E+
Sbjct  775  KESHGYRAKESILHLLWEQDTWLETY-VKNRDK--NDLQVSEE  814



>ref|WP_037459572.1| aminoacyl peptidase [Sphingobacterium spiritivorum]
Length=799

 Score =   209 bits (533),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R++  VGGHSYGAFMTANLL H+ +LF+ GIARSGAYNRTLTPFGFQNE R  W+  
Sbjct  655  YIDRSRVGVGGHSYGAFMTANLLTHS-NLFAVGIARSGAYNRTLTPFGFQNEQRNYWDVP  713

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y EMSPFM+ANK+K P+LL+HGE DNNPGT T+Q++R+F ALK  GA  R+++LP ES
Sbjct  714  QVYNEMSPFMNANKMKTPMLLVHGEADNNPGTFTLQTERYFQALKNLGAPVRMLLLPKES  773

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  774  HGYAAKENILHLLWEQDQFLEKYL  797



>ref|WP_044000965.1| aminoacyl peptidase [Hymenobacter swuensis]
 gb|AHJ96186.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Hymenobacter swuensis DY53]
Length=814

 Score =   209 bits (533),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 116/152 (76%), Gaps = 6/152 (4%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AV GHSYGAFMTANLLAH+ +LF  GIARSGAYNRTLTPFGFQ E+RT WEA   Y  
Sbjct  662  RVAVMGHSYGAFMTANLLAHS-NLFKAGIARSGAYNRTLTPFGFQGEERTYWEAPEVYNA  720

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPF  ANKIK PILLIHGE DNN GT  +Q++RF+NALKG+GA  R V+LP E+HGYTA
Sbjct  721  MSPFNYANKIKTPILLIHGEADNNSGTFPIQTERFYNALKGNGATVRYVVLPAEAHGYTA  780

Query  525  RESIMHVLWETDRWVQKHC-----VPNTSKVD  445
            RESIMH+LWE + W+  +       P T+K D
Sbjct  781  RESIMHMLWEMNTWLDTYVKKASTTPETTKAD  812



>ref|WP_026038813.1| aminoacyl peptidase [Myroides injenensis]
Length=805

 Score =   209 bits (533),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R++  VGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  657  ALGYIDRSRVGVGGHSYGAFMTANLLTHS-DLFAVGIARSGAYNRTLTPFGFQTEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNADKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYVAKENIFHLLWEQDQFLEKYL  802



>gb|EFK55894.1| peptidase, S9A/B/C family, catalytic domain protein [Sphingobacterium 
spiritivorum ATCC 33861]
Length=809

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -2

Query  900  WLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEAT  721
            ++ R++  VGGHSYGAFMTANLL H+ +LF+ GIARSGAYNRTLTPFGFQNE R  W+  
Sbjct  665  YIDRSRVGVGGHSYGAFMTANLLTHS-NLFAVGIARSGAYNRTLTPFGFQNEQRNYWDVP  723

Query  720  STYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFES  541
              Y EMSPFM+ANK+K P+LL+HGE DNNPGT T+Q++R+F ALK  GA  R+++LP ES
Sbjct  724  QVYNEMSPFMNANKMKTPMLLVHGEADNNPGTFTLQTERYFQALKNLGAPVRMLLLPKES  783

Query  540  HGYTARESIMHVLWETDRWVQKHC  469
            HGY A+E+I+H+LWE D++++K+ 
Sbjct  784  HGYAAKENILHLLWEQDQFLEKYL  807



>ref|WP_038987733.1| aminoacyl peptidase [Myroides odoratimimus]
Length=806

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ+E R  W
Sbjct  657  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQSEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNAGKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYAAKENIFHLLWEQDQFLEKYV  802



>ref|WP_002986028.1| MULTISPECIES: hypothetical protein [Myroides]
 gb|EHQ41383.1| hypothetical protein Myrod_0547 [Myroides odoratus DSM 2801]
 gb|EKB08746.1| hypothetical protein HMPREF9716_00797 [Myroides [odoratimimus] 
CIP 103059]
Length=804

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R+K  VGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  658  ALGYIDRSKVGVGGHSYGAFMTANLLTHS-DLFAVGIARSGAYNRTLTPFGFQTEQRNYW  716

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  717  EVPQVYNTMSPFMNADKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  776

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESH Y A+E+I+H+LWE D++++K+ 
Sbjct  777  KESHSYVAKENILHLLWEQDQFLEKYL  803



>ref|WP_009197199.1| Poly(3-hydroxybutyrate) depolymerase [Cesiribacter andamanensis]
 gb|EMR01049.1| Poly(3-hydroxybutyrate) depolymerase [Cesiribacter andamanensis 
AMV16]
Length=826

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = -2

Query  885  KXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVE  706
            + AVGGHSYGAFMTANLL H  +LF+ GIARSGAYNRTLTPFGFQ E+RT W+A   Y  
Sbjct  678  RVAVGGHSYGAFMTANLLTHT-NLFAAGIARSGAYNRTLTPFGFQAEERTYWQAPDIYNT  736

Query  705  MSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYTA  526
            MSPFM A+ +K P+LLIHGE DNN GT  +QS+R++NALKGHGA  RLV+LP ESHGY A
Sbjct  737  MSPFMHAHSMKTPLLLIHGEADNNSGTFPIQSERYYNALKGHGATTRLVMLPAESHGYRA  796

Query  525  RESIMHVLWETDRWVQKHCVPNTSKVDTDTK  433
            RES++H+LWET +W+ K+ V N  + D  T+
Sbjct  797  RESVLHMLWETSQWLDKY-VKNRPQEDEGTR  826



>ref|WP_036471158.1| aminoacyl peptidase [Myroides odoratimimus]
Length=806

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  657  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQTEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYAAKENIFHLLWEQDQFLEKNV  802



>ref|WP_020606187.1| glutamyl peptidase [Spirosoma spitsbergense]
Length=831

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -2

Query  888  AKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYV  709
            ++  VGGHSYGAFMTANLL H+ +LF  GIARSGAYNRTLTPFGFQNE R+ W+A   Y 
Sbjct  672  SRVGVGGHSYGAFMTANLLTHS-NLFKAGIARSGAYNRTLTPFGFQNEQRSYWQAADVYN  730

Query  708  EMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYT  529
            +MSPFM+A+K+K P+LL+HGE DNN GT  +QS+R++NALKG GA  RLV LP+ESHGYT
Sbjct  731  KMSPFMNADKMKTPLLLVHGEADNNTGTFPIQSERYYNALKGFGATTRLVFLPYESHGYT  790

Query  528  ARESIMHVLWETDRWVQKHCVPNTS  454
            A+ES++H+LWE + W+ K+    TS
Sbjct  791  AKESLLHMLWEMNGWLDKYVKNPTS  815



>ref|WP_036496613.1| MULTISPECIES: aminoacyl peptidase [Myroides]
Length=806

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  657  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQTEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYAAKENIFHLLWEQDQFLEKNV  802



>gb|EHO12957.1| hypothetical protein HMPREF9712_00104 [Myroides odoratimimus 
CCUG 10230]
 gb|EHO13622.1| hypothetical protein HMPREF9715_01160 [Myroides odoratimimus 
CIP 101113]
Length=833

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  684  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQTEQRNYW  742

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  743  EVPEVYNTMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  802

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  803  KESHGYAAKENIFHLLWEQDQFLEKNV  829



>ref|WP_041889805.1| aminoacyl peptidase [Myroides profundi]
 gb|AJH14192.1| hypothetical protein MPR_1002 [Myroides profundi]
Length=806

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  657  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQTEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYAAKENIFHLLWEQDQFLEKNV  802



>ref|WP_036497222.1| aminoacyl peptidase [Myroides odoratimimus]
Length=806

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  657  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQTEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYAAKENIFHLLWEQDQFLEKNV  802



>ref|WP_036474081.1| aminoacyl peptidase [Myroides odoratimimus]
Length=806

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 1/147 (1%)
 Frame = -2

Query  909  AVEWLTRAKXAVGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPFGFQNEDRTLW  730
            A+ ++ R + AVGGHSYGAFMTANLL H+  LF+ GIARSGAYNRTLTPFGFQ E R  W
Sbjct  657  ALGYIDRKRVAVGGHSYGAFMTANLLTHS-DLFAAGIARSGAYNRTLTPFGFQTEQRNYW  715

Query  729  EATSTYVEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILP  550
            E    Y  MSPFM+A+K+K P+LL+HGE DNNPGT T+Q++R+F ALKG GA  R+VILP
Sbjct  716  EVPEVYNTMSPFMNASKMKTPMLLVHGEADNNPGTFTLQTERYFQALKGLGAPVRMVILP  775

Query  549  FESHGYTARESIMHVLWETDRWVQKHC  469
             ESHGY A+E+I H+LWE D++++K+ 
Sbjct  776  KESHGYAAKENIFHLLWEQDQFLEKNV  802



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2282261823154