BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig4150

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    333   1e-107   Nicotiana tomentosiformis
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         331   1e-106   Nicotiana sylvestris
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   328   1e-105   Sesamum indicum [beniseed]
emb|CDP07412.1|  unnamed protein product                                325   2e-104   Coffea canephora [robusta coffee]
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   322   2e-103   Solanum tuberosum [potatoes]
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    318   6e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   319   6e-102   Eucalyptus grandis [rose gum]
gb|KHF97947.1|  hypothetical protein F383_10892                         318   2e-101   Gossypium arboreum [tree cotton]
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    317   2e-101   Solanum lycopersicum
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                317   2e-101   Erythranthe guttata [common monkey flower]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         317   4e-101   Gossypium hirsutum [American cotton]
gb|ADU15552.1|  EG                                                      317   5e-101   Gossypium hirsutum [American cotton]
gb|KJB58121.1|  hypothetical protein B456_009G195400                    312   6e-101   Gossypium raimondii
gb|KJB58119.1|  hypothetical protein B456_009G195400                    312   2e-100   Gossypium raimondii
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             315   2e-100   Citrus clementina [clementine]
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   314   3e-100   Citrus sinensis [apfelsine]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   314   3e-100   Citrus sinensis [apfelsine]
gb|KJB58118.1|  hypothetical protein B456_009G195400                    311   4e-99    Gossypium raimondii
gb|KJB58120.1|  hypothetical protein B456_009G195400                    311   4e-99    Gossypium raimondii
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  311   5e-99    Ricinus communis
ref|XP_007017776.1|  EG isoform 2                                       310   1e-98    Theobroma cacao [chocolate]
ref|XP_007017775.1|  EG isoform 1                                       310   2e-98    
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        310   2e-98    Vitis vinifera
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        308   9e-98    Cucumis melo [Oriental melon]
ref|XP_004136389.1|  PREDICTED: endoglucanase 10                        308   1e-97    Cucumis sativus [cucumbers]
ref|XP_010104437.1|  Endoglucanase 24                                   307   2e-97    Morus notabilis
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   305   2e-96    Glycine max [soybeans]
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                         303   4e-96    Populus euphratica
ref|XP_012073819.1|  PREDICTED: endoglucanase 2-like                    303   9e-96    Jatropha curcas
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   303   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         302   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             302   2e-95    Phaseolus vulgaris [French bean]
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        301   4e-95    Glycine max [soybeans]
dbj|BAF42037.1|  cellulase2                                             301   5e-95    Pyrus communis
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   300   1e-94    
gb|KHN45917.1|  Endoglucanase 2                                         301   1e-94    Glycine soja [wild soybean]
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               299   2e-94    Betula luminifera [liang ye hua]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                298   4e-94    Erythranthe guttata [common monkey flower]
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   298   5e-94    Tarenaya hassleriana [spider flower]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    298   7e-94    Populus euphratica
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein         298   8e-94    Populus trichocarpa [western balsam poplar]
gb|KJB14408.1|  hypothetical protein B456_002G123700                    298   8e-94    Gossypium raimondii
gb|AFZ78647.1|  korrigan                                                297   1e-93    Populus tomentosa [Chinese white poplar]
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   296   5e-93    Cicer arietinum [garbanzo]
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   294   4e-92    Prunus mume [ume]
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    293   4e-92    
gb|ERN01786.1|  hypothetical protein AMTR_s00224p00023160               283   4e-92    Amborella trichopoda
gb|EPS64495.1|  hypothetical protein M569_10284                         291   2e-91    Genlisea aurea
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                   291   4e-91    Fragaria vesca subsp. vesca
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     291   5e-91    Medicago truncatula
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         290   5e-91    Malus domestica [apple tree]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                   289   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                   290   2e-90    
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   289   2e-90    Prunus mume [ume]
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    288   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                    289   3e-90    Pyrus x bretschneideri [bai li]
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                   288   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         288   4e-90    
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   287   9e-90    Elaeis guineensis
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        287   1e-89    Tarenaya hassleriana [spider flower]
emb|CDY66396.1|  BnaAnng22170D                                          286   2e-89    Brassica napus [oilseed rape]
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         286   2e-89    Brassica rapa
emb|CDY43425.1|  BnaC07g14920D                                          286   3e-89    Brassica napus [oilseed rape]
ref|XP_003603741.1|  Endoglucanase                                      286   5e-89    
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             286   6e-89    
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   286   6e-89    Citrus sinensis [apfelsine]
ref|XP_007046716.1|  EG                                                 284   1e-88    
ref|NP_173423.1|  glycosyl hydrolase 9B5                                284   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                   284   2e-88    Vitis vinifera
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    284   4e-88    Citrus sinensis [apfelsine]
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   283   4e-88    Phoenix dactylifera
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    283   5e-88    Eucalyptus grandis [rose gum]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     283   6e-88    Eucalyptus grandis [rose gum]
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                   282   7e-88    Elaeis guineensis
gb|KHN00484.1|  Endoglucanase 24                                        281   1e-87    Glycine soja [wild soybean]
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         281   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             281   2e-87    Eutrema salsugineum [saltwater cress]
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   281   4e-87    Glycine max [soybeans]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         280   4e-87    Brassica rapa
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             280   7e-87    Capsella rubella
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                        279   1e-86    Sesamum indicum [beniseed]
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    279   1e-86    Arabis alpina [alpine rockcress]
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                279   1e-86    Arabidopsis lyrata subsp. lyrata
emb|CDY29381.1|  BnaA06g14150D                                          280   1e-86    Brassica napus [oilseed rape]
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                    278   6e-86    Fragaria vesca subsp. vesca
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                        277   8e-86    Phoenix dactylifera
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg             275   1e-85    
gb|AID55379.1|  glycoside hydrolase family 9 B7                         277   1e-85    Gossypium hirsutum [American cotton]
gb|KJB63540.1|  hypothetical protein B456_010G005200                    276   1e-85    Gossypium raimondii
ref|XP_003629333.1|  Endoglucanase                                      276   2e-85    Medicago truncatula
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                   275   4e-85    Citrus sinensis [apfelsine]
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                    274   1e-84    Populus euphratica
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g             273   2e-84    Phaseolus vulgaris [French bean]
gb|KJB43353.1|  hypothetical protein B456_007G195700                    271   2e-83    Gossypium raimondii
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                   270   6e-83    
ref|XP_010113364.1|  Endoglucanase 24                                   270   9e-83    
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   269   9e-83    Cicer arietinum [garbanzo]
ref|XP_012065674.1|  PREDICTED: endoglucanase 24-like                   269   1e-82    Jatropha curcas
emb|CDY44194.1|  BnaC05g15510D                                          278   3e-82    Brassica napus [oilseed rape]
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 268   4e-82    Populus trichocarpa [western balsam poplar]
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             267   5e-82    
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    267   8e-82    Solanum tuberosum [potatoes]
gb|EEC84946.1|  hypothetical protein OsI_32163                          266   1e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_001063771.1|  Os09g0533900                                       266   1e-81    
gb|EEE70113.1|  hypothetical protein OsJ_30126                          266   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990          266   2e-81    Sorghum bicolor [broomcorn]
gb|AFZ78646.1|  korrigan                                                264   8e-81    Populus tomentosa [Chinese white poplar]
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                   262   2e-80    
ref|NP_001145749.1|  hypothetical protein                               263   3e-80    Zea mays [maize]
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        262   5e-80    Brassica rapa
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg             262   5e-80    Eutrema salsugineum [saltwater cress]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   262   5e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   261   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        261   2e-79    Camelina sativa [gold-of-pleasure]
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             260   3e-79    Arabidopsis lyrata subsp. lyrata
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             260   3e-79    Capsella rubella
emb|CDY39048.1|  BnaA02g17370D                                          259   5e-79    Brassica napus [oilseed rape]
gb|EMT32027.1|  Endoglucanase 24                                        258   7e-79    
ref|NP_177697.1|  glycosyl hydrolase 9B7                                259   9e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                       259   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    258   1e-78    Solanum lycopersicum
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    258   1e-78    Nicotiana tomentosiformis
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                   258   1e-78    Setaria italica
dbj|BAJ93299.1|  predicted protein                                      258   1e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                        257   5e-78    Brachypodium distachyon [annual false brome]
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    255   3e-77    Nicotiana sylvestris
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                    252   2e-76    
ref|XP_002530743.1|  endo-1,4-beta-glucanase, putative                  249   3e-76    
emb|CDY47506.1|  BnaAnng09040D                                          249   2e-75    Brassica napus [oilseed rape]
gb|ABK24648.1|  unknown                                                 250   2e-75    Picea sitchensis
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                   246   4e-74    Brachypodium distachyon [annual false brome]
gb|EAZ38281.1|  hypothetical protein OsJ_22659                          246   5e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                   246   7e-74    Brassica rapa
ref|NP_001058583.1|  Os06g0715300                                       246   8e-74    
gb|EAZ02358.1|  hypothetical protein OsI_24462                          246   8e-74    Oryza sativa Indica Group [Indian rice]
emb|CDX73186.1|  BnaC06g36340D                                          246   8e-74    
dbj|BAK04397.1|  predicted protein                                      241   6e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                   240   1e-71    Oryza brachyantha
gb|EMS54236.1|  Endoglucanase 18                                        239   2e-71    Triticum urartu
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140          238   1e-70    Sorghum bicolor [broomcorn]
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                   236   4e-70    Setaria italica
ref|NP_001066668.2|  Os12g0428200                                       230   3e-68    
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor     229   2e-67    Zea mays [maize]
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612              228   8e-67    
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888              228   9e-67    
gb|ABA97969.1|  Glycosyl hydrolase family 9 protein, expressed          229   5e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ20312.1|  hypothetical protein OsJ_35923                          220   3e-65    Oryza sativa Japonica Group [Japonica rice]
emb|CDP04111.1|  unnamed protein product                                206   3e-63    Coffea canephora [robusta coffee]
ref|XP_001763275.1|  predicted protein                                  213   7e-62    
ref|XP_001781646.1|  predicted protein                                  209   3e-60    
gb|KHN34290.1|  Endoglucanase 24                                        207   4e-59    Glycine soja [wild soybean]
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066             204   1e-58    
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952             204   7e-58    Selaginella moellendorffii
gb|AFN16945.1|  cellulase-like protein                                  175   2e-51    Panicum virgatum
gb|AFN16938.1|  cellulase-like protein                                  174   4e-51    Panicum virgatum
gb|AFN16859.1|  cellulase-like protein                                  174   7e-51    Panicum amarum [bitter panic grass]
gb|AFN16888.1|  cellulase-like protein                                  174   7e-51    Panicum chloroleucum
gb|AFN16911.1|  cellulase-like protein                                  173   8e-51    Panicum racemosum
gb|AFN16906.1|  cellulase-like protein                                  173   8e-51    Panicum mystasipum
gb|AFN16885.1|  cellulase-like protein                                  173   8e-51    Panicum chloroleucum
gb|AFN16884.1|  cellulase-like protein                                  172   2e-50    Panicum cervicatum
gb|AFN16894.1|  cellulase-like protein                                  172   3e-50    Panicum chloroleucum
gb|AFN16886.1|  cellulase-like protein                                  172   3e-50    Panicum chloroleucum
gb|AFN16879.1|  cellulase-like protein                                  171   5e-50    Panicum aquaticum
gb|AFN16877.1|  cellulase-like protein                                  171   5e-50    Panicum amarum var. amarulum [coastal panic grass]
gb|AFN16946.1|  cellulase-like protein                                  171   7e-50    Panicum virgatum
gb|AFN16932.1|  cellulase-like protein                                  171   1e-49    Urochloa plantaginea
gb|AFN16904.1|  cellulase-like protein                                  171   1e-49    Panicum miliaceum [broom millet]
gb|AFN16944.1|  cellulase-like protein                                  171   1e-49    Panicum virgatum
gb|AFN16891.1|  cellulase-like protein                                  171   1e-49    Panicum chloroleucum
gb|AFN16920.1|  cellulase-like protein                                  171   1e-49    Setaria palmifolia [highland pitpit]
gb|AFN16881.1|  cellulase-like protein                                  171   1e-49    Panicum bergii
gb|AFN16880.1|  cellulase-like protein                                  171   1e-49    Panicum aquaticum
gb|AFN16917.1|  cellulase-like protein                                  170   2e-49    Panicum racemosum
gb|AFN16922.1|  cellulase-like protein                                  170   2e-49    Panicum stramineum
gb|AFN16900.1|  cellulase-like protein                                  169   6e-49    Panicum elephantipes
gb|AFN16902.1|  cellulase-like protein                                  168   1e-48    Panicum gouinii
gb|AFN16943.1|  cellulase-like protein                                  168   1e-48    Panicum virgatum
gb|EAY82930.1|  hypothetical protein OsI_38148                          164   2e-44    Oryza sativa Indica Group [Indian rice]
gb|EPS65630.1|  hypothetical protein M569_09145                         164   3e-43    Genlisea aurea
ref|XP_008385953.1|  PREDICTED: endoglucanase 11-like                   157   2e-42    
gb|ERN09448.1|  hypothetical protein AMTR_s00029p00087270               163   2e-42    Amborella trichopoda
ref|XP_009334150.1|  PREDICTED: endoglucanase 11-like                   162   3e-42    Pyrus x bretschneideri [bai li]
ref|XP_011624647.1|  PREDICTED: endoglucanase 5                         162   3e-42    
ref|XP_003616918.1|  Endoglucanase                                      161   4e-42    Medicago truncatula
gb|KJB13746.1|  hypothetical protein B456_002G092400                    160   4e-42    Gossypium raimondii
ref|XP_010252537.1|  PREDICTED: endoglucanase 11-like                   161   4e-42    Nelumbo nucifera [Indian lotus]
gb|AFK38997.1|  unknown                                                 161   4e-42    Medicago truncatula
ref|XP_010110634.1|  Endoglucanase 11                                   161   6e-42    
ref|XP_011047209.1|  PREDICTED: endoglucanase 11-like                   161   6e-42    Populus euphratica
gb|KJB13747.1|  hypothetical protein B456_002G092400                    160   7e-42    Gossypium raimondii
gb|AID55385.1|  glycoside hydrolase family 9 B8                         160   8e-42    Gossypium hirsutum [American cotton]
ref|XP_003519454.1|  PREDICTED: endoglucanase 11                        160   1e-41    
gb|KHN38485.1|  Endoglucanase 11                                        160   1e-41    Glycine soja [wild soybean]
ref|XP_008366459.1|  PREDICTED: endoglucanase 11-like                   157   1e-41    
ref|XP_002321149.2|  hypothetical protein POPTR_0014s15590g             159   2e-41    Populus trichocarpa [western balsam poplar]
ref|XP_012071240.1|  PREDICTED: endoglucanase 11-like                   159   2e-41    Jatropha curcas
ref|XP_012080633.1|  PREDICTED: endoglucanase 11-like                   159   3e-41    Jatropha curcas
ref|XP_011046752.1|  PREDICTED: endoglucanase 11-like                   158   4e-41    Populus euphratica
ref|XP_007215908.1|  hypothetical protein PRUPE_ppa004172mg             159   4e-41    Prunus persica
ref|XP_008364782.1|  PREDICTED: endoglucanase 11-like                   158   5e-41    
gb|KCW73256.1|  hypothetical protein EUGRSUZ_E01717                     157   5e-41    Eucalyptus grandis [rose gum]
ref|XP_010058568.1|  PREDICTED: endoglucanase 14-like                   158   6e-41    Eucalyptus grandis [rose gum]
ref|XP_008230008.1|  PREDICTED: endoglucanase 11                        158   6e-41    Prunus mume [ume]
gb|AFZ78643.1|  korrigan                                                158   6e-41    Populus tomentosa [Chinese white poplar]
gb|AFZ78645.1|  korrigan                                                158   7e-41    Populus tomentosa [Chinese white poplar]
ref|XP_002300328.1|  hypothetical protein POPTR_0001s36600g             158   7e-41    
ref|XP_002529469.1|  endo-1,4-beta-glucanase, putative                  158   7e-41    
gb|AEO97204.1|  endo-1,4-beta-glucanase                                 158   8e-41    Populus trichocarpa [western balsam poplar]
gb|AEO97205.1|  endo-1,4-beta-glucanase                                 157   9e-41    Populus trichocarpa [western balsam poplar]
ref|XP_007212600.1|  hypothetical protein PRUPE_ppa016852mg             157   1e-40    Prunus persica
gb|EYU29517.1|  hypothetical protein MIMGU_mgv1a003302mg                158   1e-40    Erythranthe guttata [common monkey flower]
gb|KHM99090.1|  Endoglucanase 11                                        157   1e-40    Glycine soja [wild soybean]
ref|XP_004304093.1|  PREDICTED: endoglucanase 11                        157   1e-40    Fragaria vesca subsp. vesca
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1         155   1e-40    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2         155   1e-40    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510937.1|  endo-1,4-beta-glucanase, putative                  156   2e-40    Ricinus communis
ref|XP_008227038.1|  PREDICTED: endoglucanase 11-like                   156   2e-40    Prunus mume [ume]
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                   155   3e-40    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010536683.1|  PREDICTED: endoglucanase 11-like                   155   3e-40    Tarenaya hassleriana [spider flower]
ref|XP_012086616.1|  PREDICTED: endoglucanase 1-like                    155   4e-40    Jatropha curcas
ref|XP_008342129.1|  PREDICTED: endoglucanase 11-like                   155   4e-40    
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                   156   4e-40    Nelumbo nucifera [Indian lotus]
gb|ERN05290.1|  hypothetical protein AMTR_s00007p00145080               149   5e-40    Amborella trichopoda
ref|XP_004500768.1|  PREDICTED: endoglucanase 24-like isoform X3        152   5e-40    
ref|XP_010244161.1|  PREDICTED: endoglucanase 11-like                   155   5e-40    Nelumbo nucifera [Indian lotus]
ref|XP_006596588.1|  PREDICTED: endoglucanase 11-like                   155   6e-40    
ref|XP_007131338.1|  hypothetical protein PHAVU_011G005500g             154   6e-40    Phaseolus vulgaris [French bean]
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg                154   6e-40    Erythranthe guttata [common monkey flower]
ref|XP_008805594.1|  PREDICTED: endoglucanase 11-like                   154   6e-40    
emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     149   7e-40    Pisum sativum [garden pea]
ref|XP_006283596.1|  hypothetical protein CARUB_v10004652mg             155   8e-40    Capsella rubella
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg                154   9e-40    Erythranthe guttata [common monkey flower]
gb|KHN38252.1|  Endoglucanase 11                                        155   9e-40    Glycine soja [wild soybean]
ref|XP_003518530.1|  PREDICTED: endoglucanase 11-like                   155   9e-40    Glycine max [soybeans]
ref|XP_009361039.1|  PREDICTED: endoglucanase 11-like                   154   1e-39    Pyrus x bretschneideri [bai li]
ref|XP_010688721.1|  PREDICTED: endoglucanase 5                         155   1e-39    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006452448.1|  hypothetical protein CICLE_v10007984mg             154   1e-39    Citrus clementina [clementine]
ref|XP_007142327.1|  hypothetical protein PHAVU_008G270900g             154   2e-39    Phaseolus vulgaris [French bean]
gb|KEH29369.1|  glycosyl hydrolase family 9 protein                     153   2e-39    Medicago truncatula
ref|XP_004491466.1|  PREDICTED: endoglucanase 11-like                   154   2e-39    Cicer arietinum [garbanzo]
ref|XP_006447630.1|  hypothetical protein CICLE_v10014884mg             154   2e-39    Citrus clementina [clementine]
ref|XP_004491112.1|  PREDICTED: endoglucanase 11-like                   154   2e-39    Cicer arietinum [garbanzo]
ref|XP_003526224.2|  PREDICTED: endoglucanase 8-like                    153   2e-39    Glycine max [soybeans]
ref|XP_008460200.1|  PREDICTED: endoglucanase 13-like                   153   2e-39    Cucumis melo [Oriental melon]
ref|XP_008449473.1|  PREDICTED: endoglucanase 11                        154   2e-39    
ref|XP_009351718.1|  PREDICTED: endoglucanase 5                         154   3e-39    Pyrus x bretschneideri [bai li]
ref|XP_003579470.1|  PREDICTED: endoglucanase 13                        154   3e-39    
gb|AET00580.2|  glycosyl hydrolase family 9 protein                     153   3e-39    Medicago truncatula
gb|KGN50329.1|  hypothetical protein Csa_5G167210                       152   3e-39    Cucumis sativus [cucumbers]
ref|XP_004295846.1|  PREDICTED: endoglucanase 11-like                   153   3e-39    Fragaria vesca subsp. vesca
ref|XP_004516730.1|  PREDICTED: uncharacterized protein LOC101505775    156   4e-39    
ref|XP_003617621.1|  Endoglucanase                                      153   4e-39    
ref|XP_008379665.1|  PREDICTED: endoglucanase 11-like isoform X1        153   4e-39    Malus domestica [apple tree]
ref|XP_006359861.1|  PREDICTED: endoglucanase 17-like                   153   4e-39    Solanum tuberosum [potatoes]
ref|XP_009365103.1|  PREDICTED: endoglucanase 11 isoform X1             153   4e-39    Pyrus x bretschneideri [bai li]
ref|XP_011072104.1|  PREDICTED: endoglucanase 5-like                    153   5e-39    
ref|XP_007131339.1|  hypothetical protein PHAVU_011G005600g             151   5e-39    Phaseolus vulgaris [French bean]
gb|KDO62113.1|  hypothetical protein CISIN_1g036785mg                   152   6e-39    Citrus sinensis [apfelsine]
ref|XP_006475127.1|  PREDICTED: endoglucanase 11-like                   152   6e-39    
gb|AES89439.2|  endo-1,4-beta-glucanase                                 153   6e-39    Medicago truncatula
ref|XP_003607242.1|  Glycosyl hydrolase family                          153   6e-39    
ref|NP_001234882.1|  endo-1,4-beta-glucanase precursor                  152   7e-39    Solanum lycopersicum
ref|XP_009804981.1|  PREDICTED: endoglucanase 5                         153   7e-39    Nicotiana sylvestris
ref|XP_006367808.1|  PREDICTED: endoglucanase 8-like                    152   7e-39    Solanum tuberosum [potatoes]
ref|XP_004500767.1|  PREDICTED: endoglucanase 24-like isoform X2        152   7e-39    
ref|XP_003540572.2|  PREDICTED: endoglucanase 8-like                    152   7e-39    
gb|AID55384.1|  glycoside hydrolase family 9 B11                        152   8e-39    Gossypium hirsutum [American cotton]
gb|AAZ08321.1|  putative endo-1,4-beta-glucanase                        151   9e-39    Eucalyptus globulus [blue gum]
ref|XP_003604007.1|  Endo-1 4-beta-glucanase                            151   1e-38    Medicago truncatula
ref|XP_008340449.1|  PREDICTED: endoglucanase 5                         152   1e-38    Malus domestica [apple tree]
emb|CBI27137.3|  unnamed protein product                                152   1e-38    Vitis vinifera
ref|XP_004500766.1|  PREDICTED: endoglucanase 24-like isoform X1        151   1e-38    Cicer arietinum [garbanzo]
gb|AFK45497.1|  unknown                                                 152   1e-38    Lotus japonicus
ref|XP_007131337.1|  hypothetical protein PHAVU_011G005400g             150   1e-38    Phaseolus vulgaris [French bean]
ref|XP_010930836.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    151   1e-38    
gb|AEO97200.1|  endo-1,4-beta-glucanase                                 151   1e-38    Populus trichocarpa [western balsam poplar]
ref|XP_007226370.1|  hypothetical protein PRUPE_ppa022524mg             152   1e-38    
ref|XP_002271094.2|  PREDICTED: endoglucanase 11                        152   1e-38    Vitis vinifera
ref|XP_008805729.1|  PREDICTED: endoglucanase 13                        152   1e-38    
ref|XP_002277177.2|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5    152   1e-38    
ref|XP_003601390.1|  Endoglucanase                                      151   1e-38    
gb|KHN32443.1|  Endoglucanase 8                                         150   1e-38    
ref|XP_011654857.1|  PREDICTED: endoglucanase 4-like                    151   2e-38    
gb|KHG28140.1|  hypothetical protein F383_15365                         151   2e-38    
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    151   2e-38    
ref|XP_010531476.1|  PREDICTED: endoglucanase 23-like                   151   2e-38    
emb|CBG76271.1|  OO_Ba0005L10-OO_Ba0081K17.22                           152   2e-38    
ref|XP_009802592.1|  PREDICTED: endoglucanase 11-like                   151   2e-38    
ref|XP_007043306.1|  Glycosyl hydrolase 9C1 isoform 2                   152   2e-38    
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                151   2e-38    
ref|XP_009414123.1|  PREDICTED: endoglucanase 7-like                    151   2e-38    
ref|XP_007043305.1|  Glycosyl hydrolase 9C1 isoform 1                   152   2e-38    
ref|XP_009589429.1|  PREDICTED: endoglucanase 11-like                   151   2e-38    
gb|KHN39837.1|  Endoglucanase 24                                        150   2e-38    
ref|XP_010935663.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    152   2e-38    
ref|XP_002301487.1|  hypothetical protein POPTR_0002s20350g             151   2e-38    
gb|ACT54548.1|  endo-1,4-beta-glucanase                                 151   2e-38    
gb|KEH29372.1|  glycosyl hydrolase family 9 protein                     150   2e-38    
emb|CDY41954.1|  BnaA01g05260D                                          150   2e-38    
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                    149   2e-38    
emb|CDY19174.1|  BnaA04g19140D                                          151   2e-38    
ref|XP_004502038.1|  PREDICTED: endoglucanase 11-like                   151   2e-38    
ref|XP_007131340.1|  hypothetical protein PHAVU_011G005600g             151   2e-38    
ref|XP_007020721.1|  Glycosyl hydrolase 9B8                             151   2e-38    
ref|XP_009141285.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    151   2e-38    
ref|XP_011079628.1|  PREDICTED: endoglucanase 17                        150   2e-38    
gb|KGN46280.1|  hypothetical protein Csa_6G079740                       150   2e-38    
ref|XP_004301501.1|  PREDICTED: endoglucanase 5                         151   2e-38    
emb|CDY52780.1|  BnaCnng23250D                                          150   2e-38    
gb|KHN33715.1|  Endoglucanase 23                                        149   3e-38    
ref|XP_003537838.1|  PREDICTED: endoglucanase 24 isoform 1              150   3e-38    
ref|XP_004153697.1|  PREDICTED: endoglucanase 13-like                   150   3e-38    
ref|XP_003611061.1|  Cellulase                                          150   3e-38    
gb|AGG19097.1|  cellulase                                               149   3e-38    
gb|ERN00101.1|  hypothetical protein AMTR_s00112p00038750               150   3e-38    
ref|XP_004516729.1|  PREDICTED: endoglucanase 8-like                    150   3e-38    
ref|XP_002277353.2|  PREDICTED: endoglucanase 11-like                   150   4e-38    
ref|XP_009627045.1|  PREDICTED: endoglucanase 11-like                   150   4e-38    
ref|XP_012086818.1|  PREDICTED: endoglucanase-like                      150   4e-38    
ref|XP_010413920.1|  PREDICTED: endoglucanase 11                        150   4e-38    
ref|XP_009144504.1|  PREDICTED: endoglucanase 23                        150   4e-38    
gb|KJB08652.1|  hypothetical protein B456_001G095700                    150   4e-38    
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        150   4e-38    
ref|XP_011621151.1|  PREDICTED: endoglucanase 11                        150   4e-38    
emb|CDY32480.1|  BnaA09g51160D                                          150   4e-38    
emb|CDY37459.1|  BnaC08g45970D                                          150   5e-38    
ref|XP_009618623.1|  PREDICTED: endoglucanase 5                         150   5e-38    
ref|XP_011076830.1|  PREDICTED: endoglucanase 12-like                   149   5e-38    
ref|XP_011087276.1|  PREDICTED: endoglucanase 5-like                    150   5e-38    
gb|KHN32282.1|  Endoglucanase 5                                         150   5e-38    
emb|CDY17123.1|  BnaA05g10650D                                          150   5e-38    
ref|XP_006590804.1|  PREDICTED: endoglucanase 5-like                    150   5e-38    
gb|KFK31096.1|  hypothetical protein AALP_AA6G067600                    150   5e-38    
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                    150   6e-38    
ref|XP_006410437.1|  hypothetical protein EUTSA_v10016495mg             150   6e-38    
ref|XP_010088306.1|  Endoglucanase 17                                   149   6e-38    
dbj|BAA21111.1|  endo-1,4-beta-glucanase                                146   6e-38    
gb|AFZ78644.1|  korrigan                                                150   6e-38    
ref|XP_008437388.1|  PREDICTED: endoglucanase 6-like isoform X1         150   6e-38    
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                               149   6e-38    
emb|CDY19428.1|  BnaC04g11710D                                          149   6e-38    
gb|EYU42228.1|  hypothetical protein MIMGU_mgv1a004926mg                149   6e-38    
gb|KHN23901.1|  Endoglucanase 11                                        150   7e-38    
ref|XP_007201772.1|  hypothetical protein PRUPE_ppa025159mg             149   7e-38    
ref|XP_008236849.1|  PREDICTED: endoglucanase 24-like                   149   8e-38    
ref|XP_006837249.1|  PREDICTED: endoglucanase 11                        149   8e-38    
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                   149   8e-38    
ref|XP_006418304.1|  hypothetical protein EUTSA_v10007402mg             149   8e-38    
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        150   8e-38    
emb|CDP13792.1|  unnamed protein product                                149   8e-38    
gb|EPS60570.1|  hypothetical protein M569_14233                         149   9e-38    
ref|XP_004292399.2|  PREDICTED: endoglucanase 9-like                    149   9e-38    
ref|XP_004516728.1|  PREDICTED: endoglucanase 8-like                    149   9e-38    
ref|XP_012090422.1|  PREDICTED: endoglucanase 8-like                    149   9e-38    
gb|KDP22411.1|  hypothetical protein JCGZ_26242                         149   9e-38    
ref|XP_006843615.2|  PREDICTED: endoglucanase 15                        149   9e-38    
ref|XP_010318000.1|  PREDICTED: endoglucanase 8-like                    149   9e-38    
ref|XP_002862860.1|  predicted protein                                  149   9e-38    
emb|CDY01915.1|  BnaC02g28120D                                          147   9e-38    
ref|XP_003523510.1|  PREDICTED: endoglucanase 24-like                   149   1e-37    
ref|XP_011010934.1|  PREDICTED: endoglucanase 8-like                    149   1e-37    
ref|XP_012082812.1|  PREDICTED: endoglucanase 17                        149   1e-37    
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                            149   1e-37    
ref|XP_010094075.1|  Endoglucanase 5                                    149   1e-37    
ref|XP_011041733.1|  PREDICTED: endoglucanase 8-like                    149   1e-37    
ref|XP_007049160.1|  Glycosyl hydrolase 9B8                             149   1e-37    
gb|KEH27425.1|  endo-1,4-beta-glucanase                                 146   1e-37    
ref|XP_010264196.1|  PREDICTED: endoglucanase 8-like                    149   1e-37    
ref|XP_009118744.1|  PREDICTED: endoglucanase 1 isoform X1              149   1e-37    
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       149   1e-37    
emb|CDY22043.1|  BnaA09g00720D                                          149   1e-37    
ref|XP_006411695.1|  hypothetical protein EUTSA_v10025010mg             149   1e-37    
gb|KHN05445.1|  Endoglucanase 5                                         149   1e-37    
emb|CDY22400.1|  BnaA06g37220D                                          148   1e-37    
gb|KHN20032.1|  Endoglucanase 23                                        147   1e-37    
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                   149   1e-37    
ref|XP_002879427.1|  glycosyl hydrolase family 9 protein                149   1e-37    
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   149   1e-37    
ref|XP_011620979.1|  PREDICTED: endoglucanase 9                         147   1e-37    
ref|XP_002527135.1|  endo-1,4-beta-glucanase, putative                  149   1e-37    
ref|XP_007040506.1|  Glycosyl hydrolase 9C2                             149   1e-37    
gb|AIM44119.1|  putative cellulase                                      139   1e-37    
ref|XP_004143869.1|  PREDICTED: endoglucanase 6-like                    149   1e-37    
ref|XP_009143907.1|  PREDICTED: endoglucanase 11                        149   1e-37    
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                   148   2e-37    
ref|XP_003540637.2|  PREDICTED: endoglucanase 5                         149   2e-37    
ref|NP_001234090.1|  endo-1,4-beta-glucanase precursor                  148   2e-37    
gb|AIM44146.1|  putative cellulase                                      139   2e-37    
ref|XP_010509938.1|  PREDICTED: endoglucanase 11-like isoform X3        148   2e-37    
ref|NP_001051192.1|  Os03g0736300                                       149   2e-37    
gb|KCW66948.1|  hypothetical protein EUGRSUZ_F00710                     148   2e-37    
ref|XP_010060286.1|  PREDICTED: endoglucanase 11-like                   148   2e-37    
ref|XP_010541571.1|  PREDICTED: endoglucanase 19                        149   2e-37    
gb|AIM44120.1|  putative cellulase                                      139   2e-37    
ref|XP_010509936.1|  PREDICTED: endoglucanase 11-like isoform X1        148   2e-37    
ref|XP_002310080.1|  endo-1 family protein                              149   2e-37    
dbj|BAD95336.1|  cellulase homolog OR16pep precursor                    143   2e-37    
ref|XP_006357959.1|  PREDICTED: endoglucanase 11-like                   148   2e-37    
ref|XP_004505716.1|  PREDICTED: endoglucanase 5-like                    149   2e-37    
ref|XP_004146136.1|  PREDICTED: endoglucanase 1                         148   2e-37    
emb|CDY23776.1|  BnaC04g43460D                                          148   2e-37    
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   149   2e-37    
ref|XP_009101916.1|  PREDICTED: endoglucanase 22-like                   148   2e-37    
ref|XP_004503629.1|  PREDICTED: endoglucanase 6-like                    149   2e-37    
gb|ERN10851.1|  hypothetical protein AMTR_s00027p00246860               148   2e-37    
ref|XP_011625192.1|  PREDICTED: endoglucanase 23                        148   2e-37    
ref|XP_008354206.1|  PREDICTED: endoglucanase 8-like isoform X3         147   2e-37    
ref|XP_010522359.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    148   2e-37    
ref|XP_008354205.1|  PREDICTED: endoglucanase 4-like isoform X2         148   2e-37    
ref|XP_006293986.1|  hypothetical protein CARUB_v10022977mg             148   3e-37    
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                   147   3e-37    
emb|CAN81074.1|  hypothetical protein VITISV_024504                     148   3e-37    
ref|XP_002973718.1|  hypothetical protein SELMODRAFT_99802              148   3e-37    
ref|XP_010096109.1|  Endoglucanase 11                                   147   3e-37    
ref|XP_008354204.1|  PREDICTED: endoglucanase 4-like isoform X1         147   3e-37    
ref|XP_003527614.1|  PREDICTED: endoglucanase 24-like                   147   3e-37    
ref|XP_010681760.1|  PREDICTED: endoglucanase 11-like                   147   3e-37    
gb|ABR16291.1|  unknown                                                 148   3e-37    
ref|XP_011010933.1|  PREDICTED: endoglucanase 4-like                    147   3e-37    
ref|XP_011041734.1|  PREDICTED: endoglucanase 4-like                    147   3e-37    
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  148   3e-37    
ref|XP_007135921.1|  hypothetical protein PHAVU_009G003200g             147   3e-37    
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   148   3e-37    
ref|XP_010913407.1|  PREDICTED: endoglucanase 11                        147   3e-37    
ref|XP_012084447.1|  PREDICTED: endoglucanase 24-like                   147   3e-37    
ref|XP_006388089.1|  hypothetical protein POPTR_0347s002202g            141   3e-37    
ref|XP_002990479.1|  hypothetical protein SELMODRAFT_131698             147   4e-37    
ref|XP_008448558.1|  PREDICTED: endoglucanase CX-like                   147   4e-37    
ref|XP_010035530.1|  PREDICTED: endoglucanase 11                        147   4e-37    
ref|XP_008221053.1|  PREDICTED: endoglucanase 5                         148   4e-37    
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 145   4e-37    
ref|XP_002983774.1|  hypothetical protein SELMODRAFT_234337             147   4e-37    
ref|XP_009412845.1|  PREDICTED: endoglucanase 3-like                    146   4e-37    
ref|NP_001142480.1|  uncharacterized protein LOC100274698               141   4e-37    
ref|XP_010549156.1|  PREDICTED: endoglucanase 5                         148   4e-37    
gb|ERM99696.1|  hypothetical protein AMTR_s00099p00071120               147   4e-37    
ref|XP_003594425.1|  Endoglucanase                                      148   4e-37    
ref|XP_009134219.1|  PREDICTED: endoglucanase 19 isoform X2             148   4e-37    
ref|XP_009134218.1|  PREDICTED: endoglucanase 19 isoform X1             148   4e-37    
gb|AEO97196.1|  endo-1,4-beta-glucanase                                 147   4e-37    
gb|KJB31835.1|  hypothetical protein B456_005G210200                    147   4e-37    
ref|NP_180858.1|  glycosyl hydrolase 9B8                                147   4e-37    
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                147   4e-37    
ref|XP_002321834.2|  cellulase family protein                           147   5e-37    
emb|CDX90780.1|  BnaA03g24600D                                          148   5e-37    
gb|KHG02199.1|  hypothetical protein F383_00334                         147   5e-37    
ref|XP_004499712.1|  PREDICTED: endoglucanase 9-like                    147   5e-37    
gb|AID55393.1|  glycoside hydrolase family 9 C1                         147   5e-37    
gb|ABK28672.1|  unknown                                                 147   5e-37    
emb|CDY05130.1|  BnaC03g29280D                                          147   5e-37    
gb|AFL65037.1|  endoglucanase                                           146   5e-37    
gb|KCW51302.1|  hypothetical protein EUGRSUZ_J00862                     147   5e-37    
ref|XP_009625038.1|  PREDICTED: endoglucanase 1-like                    147   5e-37    
ref|XP_004511554.1|  PREDICTED: endoglucanase-like                      147   5e-37    
ref|NP_195611.1|  glycosyl hydrolase 9B17                               147   5e-37    
ref|XP_006396437.1|  hypothetical protein EUTSA_v10028585mg             147   5e-37    
ref|XP_008461371.1|  PREDICTED: endoglucanase 5                         147   5e-37    
ref|XP_002525326.1|  endo-1,4-beta-glucanase, putative                  147   5e-37    
ref|XP_010446419.1|  PREDICTED: endoglucanase 23                        147   5e-37    
gb|ABR15471.1|  endoglucanase                                           147   5e-37    
ref|XP_003611058.1|  Endo-1 4-beta-glucanase                            145   5e-37    
ref|XP_008234387.1|  PREDICTED: endoglucanase 8-like                    147   5e-37    
ref|XP_009610441.1|  PREDICTED: endoglucanase 17-like                   147   5e-37    
ref|XP_009340599.1|  PREDICTED: endoglucanase 8-like isoform X4         146   5e-37    
ref|XP_010031904.1|  PREDICTED: endoglucanase 5                         147   6e-37    
ref|XP_002321833.1|  cellulase family protein                           147   6e-37    
ref|XP_006653871.1|  PREDICTED: endoglucanase 13-like                   147   6e-37    
ref|XP_009787485.1|  PREDICTED: endoglucanase 11-like                   147   6e-37    
emb|CAB59900.1|  endo-beta-1,4-glucanase                                147   6e-37    
emb|CAA65828.1|  endo-beta-1,4-glucanase                                147   6e-37    
emb|CBI36884.3|  unnamed protein product                                146   6e-37    
ref|XP_004140117.1|  PREDICTED: endoglucanase 11                        147   7e-37    
ref|XP_009340597.1|  PREDICTED: endoglucanase 4-like isoform X2         146   7e-37    
ref|XP_009340596.1|  PREDICTED: endoglucanase 4-like isoform X1         146   7e-37    
gb|KHG21954.1|  hypothetical protein F383_28246                         147   7e-37    
ref|XP_009784759.1|  PREDICTED: endoglucanase CX-like                   146   7e-37    
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   147   7e-37    
ref|XP_009340598.1|  PREDICTED: endoglucanase 4-like isoform X3         146   7e-37    
gb|AIM44133.1|  putative cellulase                                      137   8e-37    
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   147   8e-37    
gb|KJB31836.1|  hypothetical protein B456_005G210200                    147   8e-37    
ref|XP_011069683.1|  PREDICTED: endoglucanase 1-like                    146   8e-37    
gb|EPS68604.1|  endo-1,4-beta-glucanase                                 145   8e-37    
emb|CAC94006.1|  endo-beta-1,4-glucanase                                147   8e-37    
ref|XP_004298897.1|  PREDICTED: endoglucanase 6                         147   8e-37    
ref|XP_010436996.1|  PREDICTED: endoglucanase 23-like                   146   8e-37    
gb|AAC78298.2|  cellulase                                               147   8e-37    
ref|XP_010457267.1|  PREDICTED: endoglucanase 1-like                    139   8e-37    
ref|XP_010259197.1|  PREDICTED: endoglucanase 8-like                    146   9e-37    
emb|CDP12150.1|  unnamed protein product                                147   9e-37    
emb|CDY59895.1|  BnaC06g40900D                                          146   9e-37    
ref|XP_002874671.1|  hypothetical protein ARALYDRAFT_489943             147   1e-36    
gb|AIM44136.1|  putative cellulase                                      137   1e-36    
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   147   1e-36    
gb|KJB41903.1|  hypothetical protein B456_007G126900                    146   1e-36    
gb|KDO52762.1|  hypothetical protein CISIN_1g043219mg                   147   1e-36    
gb|AID55375.1|  glycoside hydrolase family 9 C3                         146   1e-36    
ref|XP_002271736.1|  PREDICTED: endoglucanase 17                        146   1e-36    
ref|XP_009144579.1|  PREDICTED: endoglucanase 17                        146   1e-36    



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRTDSGL+WIS+WNALQHPVASAFLAV+YSDYML+SRTAKITC+G
Sbjct  341  AVMCGLLPKSPTATSSRTDSGLIWISEWNALQHPVASAFLAVLYSDYMLTSRTAKITCNG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTPSDLRKFA+SQADYVLGDNP KMSYLVGYGDNYP+YVHHRGASIP DA TGCKDG+
Sbjct  401  DAYTPSDLRKFAISQADYVLGDNPSKMSYLVGYGDNYPQYVHHRGASIPKDADTGCKDGW  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+ST+PNPNVA G LVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLSGL
Sbjct  461  KWLDSTEPNPNVATGALVGGPFLNETYIDSRNNSMQAEPTTYNSAVIVGLLSGL  514



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRTDSGL+WIS+WNALQHPVASAFLAV+YSDYML+SRTAKITC+G
Sbjct  341  AVMCGLLPKSPTATSSRTDSGLIWISEWNALQHPVASAFLAVLYSDYMLTSRTAKITCNG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTPSDLRKFA+SQADYVLGDNP KMSYLVGYGDNYP+YVHHRGASIP DA T CKDG+
Sbjct  401  DAYTPSDLRKFAISQADYVLGDNPSKMSYLVGYGDNYPQYVHHRGASIPEDADTSCKDGW  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+ST+PNPNVA G LVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLSGL
Sbjct  461  KWLDSTEPNPNVATGALVGGPFLNETYIDSRNNSMQAEPTTYNSAVIVGLLSGL  514



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRTDSGLVW+SQWNALQHPVASA LAV+YSDYML+SRTAKI+CDG
Sbjct  341  AVMCGLLPKSPTATSSRTDSGLVWVSQWNALQHPVASALLAVIYSDYMLTSRTAKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
             Y+ PSDLRKFAMSQADYVLGDNPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDGF
Sbjct  401  HYFRPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+S +PNPN+A+G LVGGPFLNE+++DSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  461  QWLKSDKPNPNIAMGALVGGPFLNESFVDSRNNSMQTEPSTYNSAVIVGLLSSL  514



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRTDSGL+WIS+WNALQHPVASAFLAVVYSDYMLSSRTA+I+CD 
Sbjct  342  AVMCGLLPKSPTATSSRTDSGLIWISEWNALQHPVASAFLAVVYSDYMLSSRTAEISCDS  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              +TP+DLRKFAMSQADYVLG+NP K+SYLVGYGDNYPK+VHHRGASIP DA TGCKDGF
Sbjct  402  DSFTPADLRKFAMSQADYVLGNNPAKLSYLVGYGDNYPKFVHHRGASIPMDAKTGCKDGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+S +PNPNVAVG LVGGPF+NETYIDSRNNSMQAEP+TYNSA+IV LLSGL
Sbjct  462  QWLDSDKPNPNVAVGALVGGPFMNETYIDSRNNSMQAEPSTYNSAVIVALLSGL  515



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRTDSGL+WI+QWNALQHPVASAFLAVVYSDYML+S+T K+TCDG
Sbjct  335  AVMCGLLPKSPTATSSRTDSGLIWITQWNALQHPVASAFLAVVYSDYMLTSKTGKMTCDG  394

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTPSDLRKFAMSQA+YVLGDNP KMSYLVGYGD YP+YVHHRGASIPTDA T CK+G+
Sbjct  395  NEYTPSDLRKFAMSQANYVLGDNPAKMSYLVGYGDKYPQYVHHRGASIPTDADTNCKEGW  454

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+L+ST+PNPNVA G LVGGPFLNETYIDSRNNS+Q EPTTYNSA+IVGLLSGL
Sbjct  455  KYLDSTEPNPNVATGALVGGPFLNETYIDSRNNSIQGEPTTYNSAVIVGLLSGL  508



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   318 bits (816),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+PKSPTATSSRTD GL+W+S+WNALQHPVASAFLAVVYSDYMLSSRTA+I+C+G
Sbjct  339  AVMCGLIPKSPTATSSRTDGGLIWVSEWNALQHPVASAFLAVVYSDYMLSSRTARISCNG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PS+LRKFA+SQADYVLG+NPMKMS+LVGYGD YP++VHHRGASIP DA TGC DGF
Sbjct  399  NSYKPSELRKFALSQADYVLGNNPMKMSFLVGYGDKYPQFVHHRGASIPADAKTGCDDGF  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL ST+PNPNVAVG LVGGPFLNET+ID RNNSMQ EPTTYN+A++VGLLSGL
Sbjct  459  KWLNSTEPNPNVAVGALVGGPFLNETFIDDRNNSMQTEPTTYNNALVVGLLSGL  512



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL PKSPTAT+SRTDSGL+W+S+WN+LQHPVASAFLA +YSDYML+SRTAKI+C G
Sbjct  344  AVMCGLFPKSPTATTSRTDSGLIWVSEWNSLQHPVASAFLATIYSDYMLTSRTAKISCSG  403

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + Y PSDLRKFA SQADYVLGDNP+KMSYLVGYGDNYP+YVHHRGASIP +A TGC DGF
Sbjct  404  QTYRPSDLRKFAQSQADYVLGDNPIKMSYLVGYGDNYPQYVHHRGASIPVNAKTGCTDGF  463

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL ST PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  464  KWLNSTDPNPNVATGALVGGPFLNETYIDSRNNSMQTEPSTYNSALIVGLLSGL  517



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  343  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  403  SFKPSDLRKFAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+STQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  463  WLDSTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRTDSGL+WI++WNALQHPVASAFLAV+YSDYML+S+T K+TCDG
Sbjct  335  AVMCGLLPKSPTATSSRTDSGLIWITEWNALQHPVASAFLAVLYSDYMLTSKTDKMTCDG  394

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTPSDLRKFAMSQA+YVLGDNP KMSYLVGYGD YP+YVHHRGASIPTDA T CK+G+
Sbjct  395  NEYTPSDLRKFAMSQANYVLGDNPAKMSYLVGYGDKYPQYVHHRGASIPTDANTNCKEGW  454

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+L+ST+PNPNVA G LVGGPFLNETYIDSRNNS+Q EPTTYNSA++V LLSGL
Sbjct  455  KYLDSTEPNPNVATGALVGGPFLNETYIDSRNNSVQGEPTTYNSAVVVALLSGL  508



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTATSSRT +GLVWISQWNALQHPVASAFLAV+YSDYMLSSRTA+I+C+G
Sbjct  341  AVMCGLLPKSPTATSSRTKNGLVWISQWNALQHPVASAFLAVIYSDYMLSSRTARISCNG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA+SQADYVLGDNPMKMSYLVGYGD YP+YVHHRGASIP D  + CK+GF
Sbjct  401  NNFRPSDLRKFAISQADYVLGDNPMKMSYLVGYGDKYPQYVHHRGASIPADDKSDCKEGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S +PNPNVA+G LVGGPFLNE+++DSRNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  461  KWLDSKEPNPNVAIGALVGGPFLNESFVDSRNNSMQTEPSTYNSAVIVGLLSGL  514



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  343  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  403  SFKPSDLRKFAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  463  WLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  343  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  403  SFKPSDLRKFAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA+IVGLLS L
Sbjct  463  WLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSALIVGLLSSL  515



>gb|KJB58121.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=393

 Score =   312 bits (799),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  210  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  269

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  270  SFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  329

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  330  WLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  382



>gb|KJB58119.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=424

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  241  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  300

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  301  SFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  360

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  361  WLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  413



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+SGL+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG
Sbjct  340  AVMCGLLPKSPTATTSRTESGLIWVSEWNSLQHPVASAFLATVYSDYMLTSRTAELTCDG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLR FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGF
Sbjct  400  HSFKPSDLRDFAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S +PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  460  KWLDSKKPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+SGL+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG
Sbjct  340  AVMCGLLPKSPTATTSRTESGLIWVSEWNSLQHPVASAFLAAVYSDYMLTSRTAELTCDG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLR FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGF
Sbjct  400  HSFKPSDLRDFAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S +PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  460  KWLDSKKPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+SGL+W+S+WN+LQHPVASAFLA VYSDYML+SRTA++TCDG
Sbjct  340  AVMCGLLPKSPTATTSRTESGLIWVSEWNSLQHPVASAFLAAVYSDYMLTSRTAELTCDG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLR FA  QADY+LG+NP+KMS+LVGYG  YP+YVHHRGASIP DATTGC+DGF
Sbjct  400  HSFKPSDLRDFAKDQADYILGNNPLKMSFLVGYGKKYPQYVHHRGASIPADATTGCRDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S +PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEP+TYN A+IVGLLS L
Sbjct  460  KWLDSKKPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPSTYNGAVIVGLLSSL  513



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  343  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  403  SFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  463  WLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  515



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GLVWIS+WNALQHPVASAFLA +YSDYML+S+TAKITC   
Sbjct  339  VMCGLLPKSPSATSSRTDGGLVWISEWNALQHPVASAFLAALYSDYMLTSQTAKITCGDH  398

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRK A SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGC DGFK
Sbjct  399  SFKPSDLRKLAKSQADYVLGKNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCTDGFK  458

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVAVGGLVGGPFLNETYIDSRNNS QAEPTTYNSA+IVGLLS L
Sbjct  459  WLDSTEPNPNVAVGGLVGGPFLNETYIDSRNNSKQAEPTTYNSALIVGLLSSL  511



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTATSSRTD GL+W+S+WNALQHPVASAFLA +YSDYML+SRTAK++CDG
Sbjct  339  AVMCGLLPDSPTATSSRTDGGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTAKLSCDG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADYVLG NPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDG+
Sbjct  399  TSFKPSDLRKFAKSQADYVLGKNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGW  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL++ +PNPNVA G  VGGPFLNE+Y+DSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  459  KWLDAEEPNPNVAYGAFVGGPFLNESYVDSRNNSMQGEPSTYNSAVIVGLLSSL  512



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GL+W+S+WNALQHPVASAFLA +YSDYML+SRT K+ C   
Sbjct  343  VMCGLLPKSPSATSSRTDGGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTPKLKCGDD  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGCKDGFK
Sbjct  403  SFKPSDLRKFAKSQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVA+G L+GGPFLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  463  WLDSTKPNPNVAIGALLGGPFLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLPKSP+ATSSRTD GL+W+S+WNALQHPVASAFLA +YSDYML+SRT K+ C   
Sbjct  343  VMCGLLPKSPSATSSRTDGGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTPKLKCGDD  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP DATTGCKDGFK
Sbjct  403  SFKPSDLRKFAKSQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL+ST+PNPNVA+G L+GGPFLNETYIDSRNNSMQAEPTTYN AIIVGLLS L
Sbjct  463  WLDSTKPNPNVAIGALLGGPFLNETYIDSRNNSMQAEPTTYNGAIIVGLLSSL  515



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT SRTDSGL+W+S+WNALQHPVASAFLAV+YSDYMLSSRTAK++CDG
Sbjct  341  AVMCGLLPKSPTATISRTDSGLIWVSEWNALQHPVASAFLAVLYSDYMLSSRTAKLSCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PSDLR FA+SQ +YVLG+NPMKMSYLVGYGD YP+YVHHRGASIP DATTGC DGF
Sbjct  401  DSYKPSDLRHFAISQVNYVLGENPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCSDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S  PNPNVA G LVGGPF NE+++DSRNNSMQ EP+TYN A+IVGLLS L
Sbjct  461  KWLKSKDPNPNVATGALVGGPFKNESFVDSRNNSMQVEPSTYNGAVIVGLLSSL  514



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   308 bits (788),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P+SPTATSSRTD+GL+W+S+WN+LQHPV+SAFLA +YSDYML+SRTAK +C+G
Sbjct  339  AVMCGLIPESPTATSSRTDNGLIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTP+DLRKFA SQADYVLG+NP+KMSYLVGYGD +P+YVHHRGASIP DA T CKDGF
Sbjct  399  DSYTPADLRKFAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKCKDGF  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+ST+PNPN+A G LVGGPFLN+TYIDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  459  KWLDSTEPNPNIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLLSSL  512



>ref|XP_004136389.1| PREDICTED: endoglucanase 10 [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P+SPTATSSRTD+GL+W+S+WN+LQHPV+SAFLA +YSDYML+SRTAK +C+G
Sbjct  339  AVMCGLIPESPTATSSRTDNGLIWVSEWNSLQHPVSSAFLASLYSDYMLTSRTAKFSCNG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTP+DLRKFA SQADYVLG+NP+KMSYLVGYGD +P+YVHHRGASIP DA T CKDGF
Sbjct  399  DTYTPADLRKFAKSQADYVLGNNPLKMSYLVGYGDKFPQYVHHRGASIPADAKTKCKDGF  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+ST+PNPN+A G LVGGPFLN+TYIDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  459  KWLDSTEPNPNIAYGALVGGPFLNDTYIDSRNNSMQGEPSTYNSALVVGLLSSL  512



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SPTAT SRT SGL+W+S+WNALQHPVASAFLA +YSDYML+SRTAK++C G
Sbjct  341  AVICGLLPDSPTATESRTKSGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTAKVSCSG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +TP+D+RKF  SQADYVLG+NPMKMS+LVGYGD YP+YVHHRGASIP DA TGC DGF
Sbjct  401  KSFTPADIRKFVRSQADYVLGENPMKMSFLVGYGDKYPQYVHHRGASIPVDAKTGCTDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+ST+PNPNVA+G LVGGPF NET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  461  KWLDSTEPNPNVAIGALVGGPFQNETFIDSRNNSMQVEPSTYNSAVMVGLLSSL  514



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD GL+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ CD 
Sbjct  345  AVMCGLLPDSPTATKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCDS  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              +TPSDLR FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  405  DSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGF  464

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WLES+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  465  QWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 159/175 (91%), Gaps = 1/175 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTAT SRTD GL+W+S+WNALQHPVASAFLAV+YSDYMLSS TAKI+C+G
Sbjct  338  AVMCGLIPDSPTATKSRTDGGLIWVSEWNALQHPVASAFLAVLYSDYMLSSGTAKISCNG  397

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PSDLRKFA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPTDATTGCKDG+
Sbjct  398  DSYKPSDLRKFAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTDATTGCKDGW  457

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  249
             WL+S +PNPN A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  458  TWLKSKEPNPNEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>ref|XP_012073819.1| PREDICTED: endoglucanase 2-like [Jatropha curcas]
 gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score =   303 bits (775),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTAT++RT+SGL+W+S+WNALQHPVASAFLA +YSDYML+SRT +++C G
Sbjct  338  AVMCGLIPDSPTATTNRTESGLIWVSEWNALQHPVASAFLAALYSDYMLTSRTKELSCSG  397

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + Y PSDLRKFA SQADYVLG NPMKMSYLVGYGD YP+YVHHRGASIP DATTGCKDG+
Sbjct  398  ESYKPSDLRKFAKSQADYVLGKNPMKMSYLVGYGDKYPQYVHHRGASIPADATTGCKDGW  457

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWLES  PNPNVA G LVGGPF NE+++DSRNNS Q EP+TYNSA+IVGLLS L
Sbjct  458  KWLESEDPNPNVATGALVGGPFQNESFVDSRNNSKQGEPSTYNSAVIVGLLSSL  511



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP SP AT SRTD GL+W S+WN+L HPVASAFLAV+YSDYML ++TA ITC G
Sbjct  343  AIMCFLLPDSPRATHSRTDGGLLWFSEWNSLLHPVASAFLAVIYSDYMLMTQTASITCGG  402

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + +TP+DLR FA+SQADYVLGDNP+KMSYLVGYG  YPKYVHHRGASIP DA TGC DGF
Sbjct  403  EAFTPADLRNFAISQADYVLGDNPLKMSYLVGYGSKYPKYVHHRGASIPADADTGCTDGF  462

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S++PNPNVA+GGLVGGPFLNETYIDSRNNSMQ EPTTYNSA+IVGLLSGL
Sbjct  463  KWLSSSKPNPNVAMGGLVGGPFLNETYIDSRNNSMQGEPTTYNSALIVGLLSGL  516



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC L+P SPTAT SRTDSGL+W+S+WNALQHPVASAFLA +YSDYM SS TAK++C+G
Sbjct  339  AVMCSLIPDSPTATQSRTDSGLIWVSEWNALQHPVASAFLASLYSDYMRSSGTAKLSCNG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PSDLRKFA SQADYVLG+NPMKMS+LVGYG+NYP+YVHHRGASIP DA TGCKDG+
Sbjct  399  YSYKPSDLRKFAKSQADYVLGNNPMKMSFLVGYGENYPQYVHHRGASIPADAKTGCKDGW  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             WLE  +PNPNVA G LVGGPFLNET++D RNNSMQAEPTTYN A+IVGLLSGL
Sbjct  459  TWLERKEPNPNVATGALVGGPFLNETFVDDRNNSMQAEPTTYNGAVIVGLLSGL  512



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD GL+W+SQWN+LQ PVASAFLAVVYSDYML+S+T K+ CD 
Sbjct  345  AVMCGLLPDSPTATKSRTDEGLIWVSQWNSLQQPVASAFLAVVYSDYMLTSQTPKLKCDS  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              YTPSDLR FA SQADYVLG NPM MS+LVGYGD +P++VHHRGASIP DA TGCKDGF
Sbjct  405  DSYTPSDLRDFAKSQADYVLGKNPMDMSFLVGYGDKFPQFVHHRGASIPADAKTGCKDGF  464

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  465  KWLDSSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD GL+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ C  
Sbjct  345  AVMCGLLPDSPTATKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCGS  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              +TPSDLR FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  405  DSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGF  464

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WLES+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  465  QWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  518



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score =   301 bits (770),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CG LP SPTAT SRTD+GL+W+S+WNALQ PVA+AFLA +YSDYML+SR+ K+ CDG
Sbjct  342  AVICGFLPSSPTATKSRTDNGLIWVSEWNALQQPVAAAFLAALYSDYMLTSRSTKLECDG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PSD+RKF  SQADYVLGDNPMKMSYLVGYGD YPKYVHHRGASIP +  TGCKDGF
Sbjct  402  DTYKPSDIRKFVRSQADYVLGDNPMKMSYLVGYGDKYPKYVHHRGASIPANQKTGCKDGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+L+ST PNPN+AVG LVGGPFLNETYID+RNNS QAEP+TYNSA+IVGLLS L
Sbjct  462  KYLDSTDPNPNIAVGALVGGPFLNETYIDARNNSKQAEPSTYNSAVIVGLLSSL  515



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SPTAT SRTD+GL+W+S+WNALQHPVA+AFLA +YSDYML+SR+ K+ CDG
Sbjct  342  AVICGLLPSSPTATKSRTDNGLIWVSEWNALQHPVAAAFLAALYSDYMLTSRSTKLECDG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PSD+RKF  SQADYVLGDNPMKMS+LVGYGD YP+YVHHRGASIP +  TGCKDGF
Sbjct  402  DTYKPSDIRKFVRSQADYVLGDNPMKMSFLVGYGDKYPEYVHHRGASIPANQKTGCKDGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+L ST+PNPN+AVG LVGGPFLNETYID RNNS Q EP+TYNSA+IVGLLS L
Sbjct  462  KYLNSTEPNPNIAVGALVGGPFLNETYIDDRNNSKQGEPSTYNSAVIVGLLSSL  515



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD GL+W+SQWN+LQHPVASAFLA VYSDYML+S+T K+ C  
Sbjct  386  AVMCGLLPDSPTATKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCGS  445

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              +TPSDLR FA SQADYVLG NPM MS+LVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  446  DSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAKTGCKDGF  505

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WLES+ PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  506  QWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLLSSL  559



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP SPTATSSRTDSGL+W+S+WN+LQHPVASAFL  ++S+YML+S+TAK++C+G
Sbjct  343  AVMCNLLPHSPTATSSRTDSGLIWVSEWNSLQHPVASAFLVTLFSNYMLTSQTAKLSCNG  402

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K ++ +DL+ FA SQADYVLGDNP+KMS+LVGYGD YP++VHHRGASIP DA T C +GF
Sbjct  403  KSFSAADLQDFAKSQADYVLGDNPLKMSFLVGYGDKYPQFVHHRGASIPIDAKTNCTEGF  462

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+STQPNPNVAVGGLVGGPF NETY+DSRNNSMQ EPTTYN+A++VGLLSGL
Sbjct  463  QWLDSTQPNPNVAVGGLVGGPFQNETYLDSRNNSMQGEPTTYNNAVLVGLLSGL  516



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+PKS +ATSSRT++GL+W+S+WNALQHPVASAFLAVVYSDYML+SRT K++CDG
Sbjct  335  AVMCGLIPKSSSATSSRTENGLIWVSEWNALQHPVASAFLAVVYSDYMLTSRTDKLSCDG  394

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              +  SDLR+FA++QA+YVLG+NPMKMSYLVG+G+ YP+YVHHRGAS+P D   GCKDGF
Sbjct  395  DNFKASDLREFAITQANYVLGNNPMKMSYLVGFGNKYPEYVHHRGASVPGDENPGCKDGF  454

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL+S  PNPNVA G LVGGPFLNE+Y+DSRNNSMQ EPTTYNSA IVGLLSGL
Sbjct  455  KWLDSDDPNPNVATGALVGGPFLNESYVDSRNNSMQGEPTTYNSAFIVGLLSGL  508



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT+SRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+SR  K++C G
Sbjct  340  AVMCGLLPNSPTATASRTDDGLIWVSEWNALQHPVSSAFLAALYSDYMLTSRNVKLSCSG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  SDLRKFA SQA+Y+LG NPM+MS+LVGYGD YP+YVHHRGASIP DATTGCKDGF
Sbjct  400  KTFRASDLRKFAKSQAEYMLGKNPMEMSFLVGYGDKYPQYVHHRGASIPADATTGCKDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S  PNPNVA G LVGGPFLNET+IDSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  460  KWLNSEDPNPNVAYGALVGGPFLNETFIDSRNNSMQNEPSTYNSALVVGLLSSL  513



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC L+P SPTAT SRT+SGL+W+S+WNALQHPVASAFLA +YSDYM SS TAK++C+G
Sbjct  339  AVMCSLIPDSPTATQSRTESGLIWVSEWNALQHPVASAFLASLYSDYMRSSGTAKLSCNG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PSDLRKFA SQADYVLG+NPMKMS+LVGYG+NYP+YVHHRGASIP DA TGCKDG+
Sbjct  399  YSYKPSDLRKFAKSQADYVLGNNPMKMSFLVGYGENYPQYVHHRGASIPADAKTGCKDGW  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             WLE  +PNPNVA G LVGGPF NE ++D RNNSMQAEPTTYN A+IVGLLSGL
Sbjct  459  TWLERKEPNPNVATGALVGGPFFNEKFVDDRNNSMQAEPTTYNGAVIVGLLSGL  512



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTAT SRTD GL+W+SQWNALQHPVASAFLA +YSDYMLSS TAK++C+G
Sbjct  338  AVMCGLIPDSPTATKSRTDGGLIWVSQWNALQHPVASAFLAALYSDYMLSSGTAKLSCNG  397

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PS+LRKFA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPT A TGCKDG+
Sbjct  398  DSYKPSELRKFAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTGAKTGCKDGW  457

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  249
             WLES +PNPN A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  458  TWLESKEPNPNEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLP+SPTATSSRT+SGL+W+S+WN+LQHPVASAFLA +Y DYML+++TAK+TC   
Sbjct  340  VMCGLLPQSPTATSSRTESGLIWVSEWNSLQHPVASAFLAALYGDYMLTTQTAKLTCGDH  399

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA  QADYVLG NP+KMS+LVGYGD YP+YVHHRGASIP +ATTGC DGF+
Sbjct  400  SFEPSDLRKFAKLQADYVLGSNPLKMSFLVGYGDKYPQYVHHRGASIPVNATTGCTDGFQ  459

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL ST+PNPNVAVG LVGGPFLNET+ DSRNN+MQ EPTTYNSA+IVGLLS L
Sbjct  460  WLNSTKPNPNVAVGALVGGPFLNETFFDSRNNTMQTEPTTYNSAVIVGLLSSL  512



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTAT SRTD GL+W+SQWNALQHPVASAFLA +YSDYMLSS TAK++C+G
Sbjct  338  AVMCGLIPDSPTATKSRTDGGLIWVSQWNALQHPVASAFLAALYSDYMLSSGTAKLSCNG  397

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y PS+LRKFA SQADYVLG+NPMKMSYLVGYG+ YP+YVHHRGASIPT A TGCKDG+
Sbjct  398  DSYKPSELRKFAKSQADYVLGNNPMKMSYLVGYGEKYPQYVHHRGASIPTGAKTGCKDGW  457

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYI-DSRNNSMQAEPTTYNSAIIVGLLSGL  249
             WLES +PNPN A G LVGGPFLNET++ + RNNSMQAEP+TYNSA+IVGLLSGL
Sbjct  458  TWLESKEPNPNEATGALVGGPFLNETFVSNDRNNSMQAEPSTYNSALIVGLLSGL  512



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   296 bits (757),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SPTAT SRT+ GL+W+S+WNALQHPVASAFLA VYSDYML+S+T KI CD 
Sbjct  344  AVICGLLPDSPTATKSRTNDGLIWVSEWNALQHPVASAFLAAVYSDYMLTSQTPKIECDS  403

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              +TPSDLR FA SQADYVLG NPM MS+LVGYG  +P++VHHRGASIP DA+TGCKDGF
Sbjct  404  DSFTPSDLRDFARSQADYVLGKNPMHMSFLVGYGKKFPQFVHHRGASIPADASTGCKDGF  463

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+S+ PNPNVA G LVGGPFLNETYIDSRNNS QAEP+TYNSA++VGLLS L
Sbjct  464  QWLDSSDPNPNVATGALVGGPFLNETYIDSRNNSEQAEPSTYNSAVLVGLLSSL  517



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MCGLLP SPTATSSRT SGL+W+ +WN LQH VASAFLAV+YSDYML+S+T  + CDGK+
Sbjct  351  MCGLLPDSPTATSSRTASGLIWVIKWNCLQHAVASAFLAVLYSDYMLTSKTEVLYCDGKF  410

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P+DLR FA+SQ DYVLG+NPM+MSYLVGYG  YP+YVHHRG+SIP DA TGC+DGFKW
Sbjct  411  YKPTDLRNFAISQVDYVLGENPMEMSYLVGYGSKYPQYVHHRGSSIPADAHTGCQDGFKW  470

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L S+ PNPNVAVG LVGGPFLNETYID+RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  471  LNSSNPNPNVAVGALVGGPFLNETYIDNRNNSMQGEPSTYNSALIVALLSGL  522



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CG LP SPTATSSRTD+GL+W+S+WNALQ PVA+AFLA +YSDYML+S + K+ CDG
Sbjct  342  AVICGFLPNSPTATSSRTDNGLIWVSEWNALQQPVAAAFLAALYSDYMLTSGSTKLECDG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + Y PSD+RKF  SQA+YVLGDNPMKMSYLVGYGD YPKYVHHRGASIP +  T CK+GF
Sbjct  402  ETYKPSDIRKFVRSQANYVLGDNPMKMSYLVGYGDKYPKYVHHRGASIPANKKTSCKEGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+L+ST+PNPNVAVG LVGGPFLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  462  KYLDSTKPNPNVAVGALVGGPFLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>gb|ERN01786.1| hypothetical protein AMTR_s00224p00023160 [Amborella trichopoda]
Length=233

 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP SPTAT++RTD GLVWISQWNALQHPVASAFLAVVYSDYML+SRT+ + C+ 
Sbjct  50   AVMCALLPDSPTATTNRTDGGLVWISQWNALQHPVASAFLAVVYSDYMLTSRTSTMYCNN  109

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K  +P DLR FA+SQADYVLGDNP K+S+LVGYG NYPK VHHRGASIP +A TGCK GF
Sbjct  110  KANSPIDLRTFAISQADYVLGDNPTKLSFLVGYGTNYPKQVHHRGASIPVNANTGCK-GF  168

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+ T  NPNVAVG LVGGPF N++YID RNNSMQ EP+TYNSA+IVGLLSGL
Sbjct  169  QWLDLTADNPNVAVGALVGGPFQNDSYIDFRNNSMQGEPSTYNSAVIVGLLSGL  222



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 156/181 (86%), Gaps = 3/181 (2%)
 Frame = -2

Query  782  ALQXAVMCGLLPKSPTATSSRTDSG-LVWISQWNALQHPVASAFLAVVYSDYMLSSRTAK  606
            A   AVMCGLLPKSPTAT+SRT+ G L+W+SQW+ALQHP ASAFLA +YSDYML+SRT K
Sbjct  340  ATAEAVMCGLLPKSPTATTSRTEDGSLIWVSQWDALQHPTASAFLAAIYSDYMLTSRTPK  399

Query  605  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA--T  432
            ++CD + + PSDLRKFA SQADYVLG NPMKMSYLVGYGD+YP+YVHHRGASIP  A   
Sbjct  400  LSCDARDFAPSDLRKFAASQADYVLGSNPMKMSYLVGYGDSYPQYVHHRGASIPVGAKNN  459

Query  431  TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSG  252
            TGCKDGF WL S QPNPNVA GGLVGGPFLN +++D+RNNSMQ EPTTYNSA+++GLLS 
Sbjct  460  TGCKDGFAWLTSAQPNPNVAAGGLVGGPFLNGSFVDTRNNSMQNEPTTYNSALVIGLLSA  519

Query  251  L  249
            L
Sbjct  520  L  520



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT  GL+WIS+WNALQHPVAS+FLAVVYSDYML+S+TAK+TC+G
Sbjct  340  AVMCGLLPKSPTATTSRTKDGLIWISEWNALQHPVASSFLAVVYSDYMLTSKTAKLTCNG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + P+D+RKFA+SQ +YVLG+NPMKMSYLVGYGDNYPKYVHHRGASIP DA   C DGF
Sbjct  400  DSFKPADIRKFAISQIEYVLGNNPMKMSYLVGYGDNYPKYVHHRGASIPADAKPSCSDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+ +S+ PNPNVA G LVGGPFLNETY D R+N+ Q EP+TYNSA++VGLLS L
Sbjct  460  KYFKSSDPNPNVATGALVGGPFLNETYHDIRDNARQGEPSTYNSAVLVGLLSSL  513



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD+GL+W+S+WNALQHPVASAFLA VYSDYML+++T  I CD 
Sbjct  345  AVMCGLLPDSPTATKSRTDNGLIWVSEWNALQHPVASAFLASVYSDYMLTTQTPNIKCDS  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLR FA SQADYVLG NP  MS+LVGYG N+P++VHHRGASIP +A TGCKDG+
Sbjct  405  DSFKPSDLRDFARSQADYVLGKNPQHMSFLVGYGKNFPQFVHHRGASIPANAKTGCKDGW  464

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+S+ PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  465  QWLDSSDPNPNVATGALVGGPFLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  518



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score =   290 bits (743),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CG LP SPTATSSRT++GL+W+S+WNALQ PVA+AFLA +YSDYML+S + K+ CDG
Sbjct  342  AVICGFLPNSPTATSSRTENGLIWVSEWNALQQPVAAAFLAALYSDYMLTSGSTKLECDG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + Y PSD+RKF  SQA+YVLGDNPMKMSYLVGYGD YP+YVHHRGASIP +  T CK+GF
Sbjct  402  ETYKPSDIRKFVRSQANYVLGDNPMKMSYLVGYGDKYPEYVHHRGASIPANKKTSCKEGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            K+L+ST+PNPNVAVG LVGGPFLNETYID+RNNS Q EP+TYNSA++VGLLS L
Sbjct  462  KYLDSTKPNPNVAVGALVGGPFLNETYIDARNNSRQGEPSTYNSAVVVGLLSSL  515



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTATSSRTD GLVWI +W+ALQHPVA++FLAVVYSDYML+SRT++I C G
Sbjct  341  AVMCGLLPDSPTATSSRTDGGLVWIDEWDALQHPVAASFLAVVYSDYMLTSRTSEIDCSG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +TPSDLR FA SQADY+LG+NPMK+SYLVGYG +YP+ VHHRGASIP +A TGC +GF
Sbjct  401  KTFTPSDLRDFATSQADYILGNNPMKLSYLVGYGSSYPQQVHHRGASIPANAKTGC-NGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL ST PNPNVA+G LVGGPF N++YIDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  460  QWLSSTDPNPNVAMGALVGGPFQNDSYIDSRNNSMQGEPSTYNSAVLVGLLSGL  513



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC LLP SPTATSSRT SGL+W+ +WN LQH VASAFLA++YSDYML+S+T  + CDGK 
Sbjct  355  MCSLLPDSPTATSSRTSSGLIWVIKWNCLQHAVASAFLAILYSDYMLTSKTEILYCDGKS  414

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P DLRKFA+SQADYVLG+NPM+MSYLVGYG +YP+YVHHRGASIP  A TGC DGFKW
Sbjct  415  YNPVDLRKFAISQADYVLGENPMRMSYLVGYGSSYPQYVHHRGASIPVGAETGCIDGFKW  474

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L+S  PNPNVAVG LVGGPF+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  475  LDSPNPNPNVAVGALVGGPFMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT+SRT++GL+W+S+WNALQHPV+SAFLA +YSDYML+SRT+K+ CDG
Sbjct  342  AVMCGLLPNSPTATNSRTENGLIWVSEWNALQHPVSSAFLAALYSDYMLTSRTSKLECDG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y  SD+RKFA SQA+YVLG+NP+KMSYLVGYGD YPKYVHHRGASIP +    C++GF
Sbjct  402  DSYKASDIRKFARSQANYVLGENPLKMSYLVGYGDKYPKYVHHRGASIPANKKPNCREGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L +  PNPNVAVG LVGGPFLNETY+D+RNNS Q EP+TYNSA+IVGLLSGL
Sbjct  462  EYLNTKDPNPNVAVGALVGGPFLNETYVDARNNSRQGEPSTYNSALIVGLLSGL  515



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GLVW+S+WNALQHPV+SAFLA +YSDYML+S   +++CD 
Sbjct  334  AVMCGLIPSSPTATSSRTDGGLVWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDD  393

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + + PSDLR FA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGF
Sbjct  394  QSFKPSDLRTFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGF  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  454  KWLNSDEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC LLP SP ATSSRT SGL+W+ +WN LQ+ VASAFLA++YSDYML+S+T  + CDGK 
Sbjct  355  MCSLLPDSPMATSSRTSSGLIWVIKWNCLQYAVASAFLAILYSDYMLTSKTEMLYCDGKS  414

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P DLRKFA+SQADYVLG+NPM+MSYLVGYG +YP+YVHHRGASIP DA TGC DGFKW
Sbjct  415  YNPVDLRKFAISQADYVLGENPMRMSYLVGYGSSYPQYVHHRGASIPVDAETGCSDGFKW  474

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L+S  PNPNVAVG LVGGPF+NETYIDSRNNSMQ EP+TYNSA+IV LLSGL
Sbjct  475  LDSPNPNPNVAVGALVGGPFMNETYIDSRNNSMQGEPSTYNSALIVALLSGL  526



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 153/174 (88%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTATSSRTD GLVWI +WNALQHPVA++FLAVVYSDYML+SRT +I C G
Sbjct  340  AVMCGLLPDSPTATSSRTDGGLVWIDEWNALQHPVAASFLAVVYSDYMLTSRTPEIRCSG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +TP+DLR FA SQADY+LG+NPMK+SYLVGYG +YP+ VHHRGASIP +  TGCK GF
Sbjct  400  KSFTPTDLRNFATSQADYILGNNPMKLSYLVGYGSSYPQQVHHRGASIPANLDTGCK-GF  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S  PNPNVA GGLVGGPF N+++IDSRNNSMQ EP+TYNSA++VGLLSGL
Sbjct  459  KWLTSIAPNPNVATGGLVGGPFKNDSFIDSRNNSMQTEPSTYNSAVLVGLLSGL  512



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++CD 
Sbjct  334  AVMCGLIPSSPTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDD  393

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGF
Sbjct  394  QSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGF  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLL  258
            KWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLL
Sbjct  454  KWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLL  504



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD GL+WI QWN+LQHPVA++FLAVVYSDYML+SRT+++ C+G
Sbjct  341  AVMCGLLPDSPTATKSRTDGGLIWIDQWNSLQHPVAASFLAVVYSDYMLTSRTSEVQCNG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + YTP DLRKFAMSQADY+LGDNPMKMSYLVGYG +YP+ VHHRGASIP +A TGCK G+
Sbjct  401  ETYTPLDLRKFAMSQADYILGDNPMKMSYLVGYGSSYPQQVHHRGASIPANANTGCK-GW  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL S  PNPN+A G LVGGPF N++YID RNNSMQ+EP+TYNSA +VGLLSGL
Sbjct  460  QWLSSPNPNPNIATGALVGGPFQNDSYIDLRNNSMQSEPSTYNSASLVGLLSGL  513



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTATSSRT  GL+W+S+WN+LQHPV+SAFLA +YSDYML+SR  K++C G
Sbjct  340  AVMCGLLPNSPTATSSRTHGGLIWVSEWNSLQHPVSSAFLATLYSDYMLTSRIGKLSCSG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  SDLRKFA SQADY+LG NP  MS+LVG+G+ YPK +HHRGASIP DATTGCKDGF
Sbjct  400  KTFRASDLRKFAKSQADYMLGKNPTGMSFLVGFGEKYPKNIHHRGASIPADATTGCKDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S  PNPN+A G LVGGPFLNET++DSRNNSMQ EP+TYNSA++VGLLS L
Sbjct  460  KWLTSEDPNPNIAYGALVGGPFLNETFVDSRNNSMQNEPSTYNSALVVGLLSSL  513



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+++WNALQHPV+SAFLA +YSDYML+S   K++C  
Sbjct  349  AVMCGLIPDSPTATSSRTDGGLIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGD  408

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  409  TSFKPSDLRKFARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGF  468

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  469  KWLNSEEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+++WNALQHPV+SAFLA +YSDYML+S   K++C  
Sbjct  349  AVMCGLIPDSPTATSSRTDGGLIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGD  408

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  409  TSFKPSDLRKFARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGF  468

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  469  KWLNSEEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+++WNALQHPV+SAFLA +YSDYML+S   K++C  
Sbjct  349  AVMCGLIPDSPTATSSRTDGGLIWVAEWNALQHPVSSAFLATLYSDYMLTSGVDKLSCGD  408

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADY+LG NP  MSYLVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  409  TSFKPSDLRKFARSQADYMLGKNPETMSYLVGYGDKYPEFVHHRGASIPGDANTGCKDGF  468

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWL S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  469  KWLNSDEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVGLLSSL  522



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 151/180 (84%), Gaps = 6/180 (3%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDS------GLVWISQWNALQHPVASAFLAVVYSDYMLSSRTA  609
            AVMCGLLP SPTAT SRTDS      GL+W+S+WNALQHPVASAFLA VYSDYML+++T 
Sbjct  345  AVMCGLLPDSPTATKSRTDSNVLLEYGLIWVSEWNALQHPVASAFLASVYSDYMLTTQTP  404

Query  608  KITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT  429
             I CD   + PSDLR FA SQADYVLG NP  MS+LVGYG N+P++VHHRGASIP +A T
Sbjct  405  NIKCDSDSFKPSDLRDFARSQADYVLGKNPQHMSFLVGYGKNFPQFVHHRGASIPANAKT  464

Query  428  GCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GCKDG++WL+S+ PNPNVA G LVGGPFLNETYIDSRNNSMQ EP+TYNSA+IVGLLS L
Sbjct  465  GCKDGWQWLDSSDPNPNVATGALVGGPFLNETYIDSRNNSMQGEPSTYNSAVIVGLLSSL  524



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            ++MCGLLP SPTATSSRTDSGL+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C G
Sbjct  366  SIMCGLLPDSPTATSSRTDSGLIWIVKWNSLQHPVASAFLAVLYSDYMIASGTETLYCSG  425

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y P DLRKFA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP DA TGC DGF
Sbjct  426  KSYQPHDLRKFAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTGCTDGF  485

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KWLES  PNPNVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  486  KWLESESPNPNVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  530



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            ++MCGLLP SPTATSSRTDSGL+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C G
Sbjct  366  SIMCGLLPDSPTATSSRTDSGLIWIVKWNSLQHPVASAFLAVLYSDYMIASGTETLYCSG  425

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y P DLRKFA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP DA TGC DGF
Sbjct  426  KSYQPHDLRKFAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPADANTGCTDGF  485

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KWLES  PNPNVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  486  KWLESESPNPNVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  530



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MCGLLP SPTATS RTD GL+WI++WN+LQHP+ASAFLA++YSDYML+S+T  + C G
Sbjct  343  AIMCGLLPDSPTATSRRTDGGLIWITEWNSLQHPMASAFLAIIYSDYMLTSQTETLYCSG  402

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y P DLRKFAMSQADYVLG NPMK+SYLVGYG +YP+YVHHRGASIP DA TGCKDGF
Sbjct  403  NSYKPEDLRKFAMSQADYVLGTNPMKISYLVGYGSSYPQYVHHRGASIPVDADTGCKDGF  462

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL S  PNPN+A G LVGGP LN++Y+DSR N  Q EP+TYN+A+IVGLLSGL
Sbjct  463  RWLNSDDPNPNIAFGALVGGPSLNDSYLDSRKNVKQGEPSTYNTALIVGLLSGL  516



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++C  
Sbjct  332  AVMCGLIPSSPTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGVKELSCSD  391

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DATTGCKDGF
Sbjct  392  QSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADATTGCKDGF  451

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  452  KWLNSDEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  500



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SPTATSSRTDSGL+W+++WN LQH VASAFLAV+YSDYML+S+T  + C G
Sbjct  342  AVICGLLPDSPTATSSRTDSGLIWVTEWNPLQHSVASAFLAVIYSDYMLTSKTETLYCSG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K+Y P+DLRKFA+SQ +YVLG+NPM M YLVG+G NYP+YVHHRGASIP DA TGC DGF
Sbjct  402  KHYKPADLRKFAISQTEYVLGNNPMNMCYLVGHGSNYPQYVHHRGASIPVDAETGCHDGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KWLES  PNPN+AVG LVGGPFLNETYIDSRNN+MQ EP+TYNSA
Sbjct  462  KWLESLDPNPNLAVGALVGGPFLNETYIDSRNNTMQGEPSTYNSA  506



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            ++MCGLLP SPTATSSRTDSGL+WI +WN+LQHPVASAFLAV+YSDYM++S T  + C G
Sbjct  367  SIMCGLLPDSPTATSSRTDSGLIWIVKWNSLQHPVASAFLAVLYSDYMITSGTETLYCSG  426

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y P DLRKFA+SQ DY+LG NPM+MSYLVGYG+NYP YVHHRG+SIP +A TGC DGF
Sbjct  427  KSYQPHDLRKFAISQVDYLLGKNPMEMSYLVGYGNNYPLYVHHRGSSIPANANTGCTDGF  486

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KWLES  PNPNVA+G LVGGPFLNE+YIDSRNNSMQ EPTTYNSA
Sbjct  487  KWLESESPNPNVAIGALVGGPFLNESYIDSRNNSMQGEPTTYNSA  531



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRTD GL+WI QWN+LQHPVA++FLAVVYSDYML+SRT+++ C+G
Sbjct  341  AVMCGLLPDSPTATKSRTDGGLIWIDQWNSLQHPVAASFLAVVYSDYMLTSRTSEMHCNG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P DLRKFAM+QADY+LGDNPMKMSYLVGYG NYP+ VHHRGASIP +A TGCK G+
Sbjct  401  ETFSPLDLRKFAMAQADYILGDNPMKMSYLVGYGSNYPQQVHHRGASIPANANTGCK-GW  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+S  PNPNVA G LVGGPF N+++ID RNNSMQ+EP+TY+SA +VGLLSGL
Sbjct  460  QWLKSPNPNPNVATGALVGGPFQNDSFIDLRNNSMQSEPSTYSSASLVGLLSGL  513



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SPTATSSRT+SGL+W+++WN+L HPV SAFLAV+YSDYML+S T  + C  +
Sbjct  344  MMCSLLPDSPTATSSRTESGLIWVTEWNSLLHPVGSAFLAVLYSDYMLTSGTEALFCSER  403

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             YTP +LR FA+SQ DYVLG+NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTGCKDGFK
Sbjct  404  SYTPGNLRDFAISQVDYVLGENPMKLSYLVGFGENYPQYVHHRGSSIPADATTGCKDGFK  463

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S+ PNPNVAVG LVGGPF NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  464  WLNSSAPNPNVAVGALVGGPFRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  516



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SPTATSSRT+SGL+W+++WN+L HPV SAFLAV+YSDYML+S T  + C  +
Sbjct  340  MMCSLLPDSPTATSSRTESGLIWVTEWNSLLHPVGSAFLAVLYSDYMLTSGTEALFCSER  399

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             YTP +LR FA+SQ DYVLG+NPMK+SYLVG+G+NYP+YVHHRG+SIP DATTGCKDGFK
Sbjct  400  SYTPGNLRDFAISQVDYVLGENPMKLSYLVGFGENYPQYVHHRGSSIPADATTGCKDGFK  459

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S+ PNPNVAVG LVGGPF NETY DSRNNSMQ EP+TYNSA+ VG+LSGL
Sbjct  460  WLNSSAPNPNVAVGALVGGPFRNETYSDSRNNSMQGEPSTYNSALPVGVLSGL  512



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score =   282 bits (722),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 153/173 (88%), Gaps = 1/173 (1%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLP+SPTAT SRTD GLVWI QWN+LQHPVA++FLAVVYSDYML+SRTA++ C+G+
Sbjct  338  VMCGLLPESPTATKSRTDDGLVWIDQWNSLQHPVAASFLAVVYSDYMLTSRTAEVQCNGE  397

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             +TP DLRKFA+SQADYVLGDNPM+MSYLVGYG +YP+ VHHRGASIP +A +GCK G++
Sbjct  398  SFTPMDLRKFAISQADYVLGDNPMEMSYLVGYGSSYPQQVHHRGASIPANANSGCK-GWQ  456

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S  PNPNVA G LVGGPF N++YID RNNSMQAEPTTY+SA +V LLSGL
Sbjct  457  WLSSPDPNPNVATGALVGGPFKNDSYIDLRNNSMQAEPTTYSSASLVALLSGL  509



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SPTAT++RT+SGL+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK
Sbjct  327  LMCKLLPDSPTATANRTESGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGK  386

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLRKFA+SQADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTGCKDGFK
Sbjct  387  LYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTGCKDGFK  446

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            W +S  PNPNVA G LVGGPF +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  447  WFDSPHPNPNVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  499



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++CD 
Sbjct  334  AVMCGLIPSSPTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCDD  393

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + +  SDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGF
Sbjct  394  QSFKSSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGF  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  454  KWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  502



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+++WNA+QHPV+SAFLA +YSDYML+S   + +C  
Sbjct  339  AVMCGLIPNSPTATSSRTDGGLIWVAEWNAMQHPVSSAFLATLYSDYMLTSGIEQFSCGD  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGF
Sbjct  399  TSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGF  458

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL+S +PNPNVA G LVGGPFLNET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  459  KWLQSEEPNPNVAYGALVGGPFLNETFIDARNNSMQNEPSTYNSALVVG  507



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SPTAT++RT+SGL+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK
Sbjct  353  LMCKLLPDSPTATANRTESGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEILYCSGK  412

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLRKFA+SQADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SIP +ATTGCKDGFK
Sbjct  413  LYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTQYPKYIHHRGSSIPVNATTGCKDGFK  472

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            W +S  PNPNVA G LVGGPF +ETY D RNNSMQAEPTTY+SA+ V LLSGL
Sbjct  473  WFDSPHPNPNVAFGALVGGPFFDETYNDFRNNSMQAEPTTYSSALFVALLSGL  525



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRT+ GL+W+++WNALQ PV+S+FLA +YSDYML+S    + C  
Sbjct  341  AVMCGLIPSSPTATSSRTEGGLIWVAEWNALQQPVSSSFLATLYSDYMLTSGIENLACGD  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADY+LG NP KMSYLVGYGD YP+YVHHRGASIP DA TGCKDGF
Sbjct  401  TSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGDKYPEYVHHRGASIPADANTGCKDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  461  EWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  514



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRT+ GL+W+S+WNALQHPV+SAFLA +YSDYML+S   + +C  
Sbjct  333  AVMCGLIPSSPTATSSRTEGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKEFSCSD  392

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGF
Sbjct  393  QSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGF  452

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  453  KWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCG LPKSPTAT SRT++GL+W+S+WNALQ  V+SAFLAVVYSDYML+SRTA I+C G
Sbjct  334  AVMCGFLPKSPTATESRTENGLIWVSEWNALQQSVSSAFLAVVYSDYMLTSRTAHISCSG  393

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLR FA++QA+YVLGDNPM++SY+VGYGDNYP+ VHHRGASIP D    CKDGF
Sbjct  394  STFKPSDLRDFAITQANYVLGDNPMQLSYIVGYGDNYPQQVHHRGASIPADENPSCKDGF  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KWLE+  PNPN+A G LVGGPFLNETYID RNNSMQ EP+TYNSA
Sbjct  454  KWLEADTPNPNIATGALVGGPFLNETYIDVRNNSMQGEPSTYNSA  498



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTAT SRTD GL+W+S+WNALQHPV+S FLA +YSDYML+S   K++C  
Sbjct  333  AVMCGLIPSSPTATESRTDGGLIWVSEWNALQHPVSSGFLASLYSDYMLTSGIEKLSCSD  392

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA  GCKDGF
Sbjct  393  QDFKPSDLRKFAKSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPGDANVGCKDGF  452

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL S +PNPNVA G LVGGPF+NET+ID+RNNSMQ EP+TYNSA++VG
Sbjct  453  KWLNSEEPNPNVAYGALVGGPFMNETFIDARNNSMQNEPSTYNSALVVG  501



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRTD GL+W+S+WNALQHPV+SAFLA +YSDYML+S   +++C  
Sbjct  333  AVMCGLIPSSPTATSSRTDGGLIWVSEWNALQHPVSSAFLATLYSDYMLTSGIKELSCSD  392

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + + PSDLRKFA SQADY+LG NP KMSYLVGYG+ YP++VHHRGASIP DA TGCKDGF
Sbjct  393  QSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGEKYPEFVHHRGASIPADANTGCKDGF  452

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL+S + NPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VG
Sbjct  453  KWLDSDEQNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVG  501



>emb|CDY29381.1| BnaA06g14150D [Brassica napus]
Length=548

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTATSSRT+ GL+W+++WNALQ PV+S+FLA +YSDYML+S    + C  
Sbjct  334  AVMCGLIPSSPTATSSRTEGGLIWVAEWNALQQPVSSSFLATLYSDYMLTSGIENLACGD  393

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKFA SQADY+LG NP KMSYLVGYGD YP+YVHHRGASIP DA TGCKDGF
Sbjct  394  TSFKPSDLRKFARSQADYMLGKNPEKMSYLVGYGDKYPEYVHHRGASIPADANTGCKDGF  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS L
Sbjct  454  EWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLSSL  507



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MCGL+P SPTATS RTD+GL+W+ +WN LQH ++SAFLAV+YSDYM++S+T  + CDGK 
Sbjct  350  MCGLIPDSPTATSDRTDNGLIWVEEWNCLQHALSSAFLAVLYSDYMVASQTEMLYCDGKI  409

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P DLR FA+SQADY LG NPMKMSYLVGYG NYP+ VHHRG+SIP DA TGC DGFKW
Sbjct  410  YNPEDLRSFAISQADYALGKNPMKMSYLVGYGSNYPQQVHHRGSSIPVDADTGCSDGFKW  469

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L S  PNPNVAVG LVGGPF N++Y+D RNNSMQ EP+TYNSA+IV LLSGL
Sbjct  470  LYSPDPNPNVAVGALVGGPFQNDSYMDIRNNSMQGEPSTYNSALIVALLSGL  521



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLP SPTAT SRT+ GL+WI QWN+LQHPVA++FLA+VYSDYML+SRTA++ C G
Sbjct  341  AVMCGLLPDSPTATKSRTNGGLIWIDQWNSLQHPVAASFLAIVYSDYMLTSRTAEVQCSG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + +T  DLRKFA+SQADY+LGDNPMKMSYLVGYG +YP+ VHHRGASIP +A TGCK G+
Sbjct  401  ETFTLMDLRKFAISQADYILGDNPMKMSYLVGYGSSYPRQVHHRGASIPVNANTGCK-GW  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL S  PNPNVA G +VGGPF N++YID RNNSMQ EP+TY+SA +VGLLSGL
Sbjct  460  QWLSSADPNPNVATGAVVGGPFKNDSYIDLRNNSMQGEPSTYSSASLVGLLSGL  513



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP+SP+ATS RT+ GL+WI++WNALQHPVA AFLA +Y DYM  S    + CD 
Sbjct  295  ALMCTLLPESPSATSDRTNGGLIWIAEWNALQHPVAVAFLASLYGDYMEKSDNENLECDE  354

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +   DLR+FA  QADYVLGDNP  MSYLVGY   +PK+VHHRGASIP DATTGCKDG+
Sbjct  355  KTFKSEDLREFAKKQADYVLGDNPNSMSYLVGYSKKFPKFVHHRGASIPADATTGCKDGY  414

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WLEST+PNPN A G LVGGPF+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  415  QWLESTKPNPNEATGALVGGPFMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  468



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SP+AT+SRT SGL+WI++W++LQHPV SAFLAV+YSDYM +S    ++C   
Sbjct  340  LMCALLPDSPSATASRTKSGLIWITKWDSLQHPVGSAFLAVLYSDYMRASDNEILSCGDD  399

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLGDNPM +SYLVGYG  YP++VHHRGASIP DATTGC +GFK
Sbjct  400  SFEPSDLRKFAQSQADYVLGDNPMDISYLVGYGGKYPEFVHHRGASIPVDATTGCSEGFK  459

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S +PNPNVA+G LVGGPF NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  460  WLSSKKPNPNVAIGALVGGPFKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SP+AT+SRT SGL+WI++W++LQHPV SAFLAV+YSDYM +S    ++C   
Sbjct  340  LMCALLPDSPSATASRTKSGLIWITKWDSLQHPVGSAFLAVLYSDYMRASDNEILSCGDD  399

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             + PSDLRKFA SQADYVLGDNPM +SYLVGYG  YP++VHHRGASIP DATTGC +GFK
Sbjct  400  SFEPSDLRKFAQSQADYVLGDNPMDISYLVGYGGKYPEFVHHRGASIPVDATTGCSEGFK  459

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S +PNPNVA+G LVGGPF NE++IDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  460  WLSSKKPNPNVAIGALVGGPFKNESFIDSRNNSMQTEPTTYNSAVLVGLLSSL  512



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SPTAT++RT SG +W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK
Sbjct  352  LMCNLLPDSPTATTNRTKSGQIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTENLYCSGK  411

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLRKFA+SQ +YVLG+NPMKMS+LVGYG NYPKY+HHRG+SIP +A TGCKDGFK
Sbjct  412  MYKPVDLRKFAISQVEYVLGENPMKMSFLVGYGSNYPKYIHHRGSSIPVNAKTGCKDGFK  471

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            W +S QPNPNVA G +VGGPF NETY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  472  WYDSPQPNPNVAFGAIVGGPFFNETYNDFRNNSMQAEPTTYSNALLVALLSGL  524



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP+SP+ATS RT+ GL+WI++WNALQHPVA AFLA +Y DYM  S    + CD 
Sbjct  329  ALMCTLLPESPSATSDRTNGGLIWIAEWNALQHPVAVAFLASLYGDYMEKSDNENLECDE  388

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +   DLR+FA  QADYVLGDNP  MSYLVGY   +PK+VHHRGASIP DATTGCKDG+
Sbjct  389  KTFKSEDLREFAKKQADYVLGDNPNSMSYLVGYSKKFPKFVHHRGASIPADATTGCKDGY  448

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WLEST+PNPN A G LVGGPF+NETYIDSRNNSMQ EPTTYNSA++VGLLS L
Sbjct  449  QWLESTKPNPNEATGALVGGPFMNETYIDSRNNSMQGEPTTYNSALLVGLLSSL  502



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP SPTATSSRT  GL+W+SQWN LQH +ASAFLAV++SDYM++++ + + C G
Sbjct  346  AIMCELLPDSPTATSSRTKGGLIWVSQWNCLQHAMASAFLAVLFSDYMVTTQISTLYCHG  405

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y+P+DLR F++SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF
Sbjct  406  KSYSPADLRDFSISQADYILGNNPMKMSYLVGYGSNYPQKVHHRGASIPVDANTTCKDGF  465

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  270
             WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYNSA++
Sbjct  466  TWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYNSALV  512



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            ++C LLP SPTAT++RT+SGL+W+  WN+LQH VASAFLA++YSDYM +S+T  + C GK
Sbjct  352  LICTLLPDSPTATTNRTESGLIWLVPWNSLQHSVASAFLAILYSDYMQTSQTEILYCGGK  411

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLRKFA+SQADYVLG+NPMKMSYLVGYG + P Y+HHRG+SIP +ATTGCKDGFK
Sbjct  412  LYKPVDLRKFAISQADYVLGENPMKMSYLVGYGTHNPNYIHHRGSSIPVNATTGCKDGFK  471

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S  PNPNVA+G LVGGPFLNETY D RNNSMQ EPTTYNSA+ V LLSGL
Sbjct  472  WLYSPYPNPNVALGALVGGPFLNETYNDFRNNSMQGEPTTYNSALFVALLSGL  524



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLP SPTATS RTD GL+WI++WN LQH VASAFLAV+YSDYML+S+T  + C G 
Sbjct  343  VMCGLLPDSPTATSRRTDGGLIWITEWNPLQHAVASAFLAVLYSDYMLTSQTETLYCSGN  402

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLR FA+SQADYVLG+NPMKMSYLVGYG  YP YVHHRG+SIP +A T C+DGFK
Sbjct  403  SYKPDDLRNFAISQADYVLGENPMKMSYLVGYGSRYPLYVHHRGSSIPVNADTSCQDGFK  462

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL S  PNPN+AVG LVGGP LN++Y D+R+N  Q+EP+TYNSA++VGLLSGL
Sbjct  463  WLYSDDPNPNIAVGALVGGPSLNDSYSDTRDNVKQSEPSTYNSALLVGLLSGL  515



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLL  S +ATS RT+ GL+W+ +W+ALQ+PVASAFLA+VYSDYML+S T  + CDG+
Sbjct  345  VMCGLLSSSSSATSYRTEGGLIWVREWDALQYPVASAFLALVYSDYMLTSHTRNLYCDGE  404

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLR  A+ QADYVLG+NPM MSYLVGYG +YP+YVHHRGASIPTDA TGC DGF 
Sbjct  405  LYEPMDLRNLAIMQADYVLGNNPMNMSYLVGYGSSYPQYVHHRGASIPTDAKTGCSDGFM  464

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            WL ST PNPNVA+G LVGGPF N++YIDSRNN+ QAEPTTYNSA++VGLLSGL
Sbjct  465  WLSSTAPNPNVAIGALVGGPFQNDSYIDSRNNTAQAEPTTYNSAVLVGLLSGL  517



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            VMCGLLP SP ATSSRT +GL+W+  W+ LQH +ASAFLAV+Y DYML+S+T  + CDG+
Sbjct  361  VMCGLLPDSPPATSSRTQNGLIWVINWHCLQHSMASAFLAVLYGDYMLTSQTEILYCDGQ  420

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             YTP DLRKFAMSQ DYVLG NPM+MSYLVGYG+NYP+ VHHRG+SIP DA TGCKDGF+
Sbjct  421  SYTPEDLRKFAMSQVDYVLGQNPMEMSYLVGYGNNYPQQVHHRGSSIPVDAKTGCKDGFE  480

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            WL S +PNPN+A+G LVGGPFLNETY+D RNNSM +EP+TYN+A++V 
Sbjct  481  WLYSPKPNPNLAIGALVGGPFLNETYVDYRNNSMLSEPSTYNNALLVA  528



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP S TAT++RT SGL+W+  WN+LQH VASAFLAV+YSDYML+S+T  + C GK
Sbjct  351  LMCKLLPDSQTATTNRTKSGLIWVVPWNSLQHSVASAFLAVLYSDYMLTSQTEFLYCSGK  410

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFK  408
             Y P DLRKFA+SQ +YVLG+NPM+MS++VGYG+ YPKY HHRG+SIP DA TGC+DGFK
Sbjct  411  MYKPVDLRKFAISQVEYVLGENPMRMSFVVGYGNEYPKYTHHRGSSIPFDAKTGCRDGFK  470

Query  407  WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            W +S QPNPNVA G LVGGPF N+TY D RNNSMQAEPTTY++A++V LLSGL
Sbjct  471  WYDSPQPNPNVAFGALVGGPFFNDTYNDFRNNSMQAEPTTYSNALLVALLSGL  523



>ref|XP_012065674.1| PREDICTED: endoglucanase 24-like [Jatropha curcas]
 gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A +CGLLP SPTATSSRT++GL+W+ +WN+LQ+ VASAF+A+++SDYM++S    + C G
Sbjct  354  AFICGLLPDSPTATSSRTENGLIWVVKWNSLQYSVASAFIALLFSDYMVASHIPTLYCSG  413

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              Y+P++LR FA+SQADY+LG NPM+MS+LVGYG+ YP+YVHHRG+SIP DA TGCKDGF
Sbjct  414  ILYSPTELRSFAISQADYILGKNPMEMSFLVGYGNEYPQYVHHRGSSIPVDAKTGCKDGF  473

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WL+S  PNPN+AVG LVGGPFLNETY DSR N +QAE TTYN A+IVGLLSGL
Sbjct  474  EWLDSPNPNPNIAVGALVGGPFLNETYNDSRRNIIQAEATTYNGALIVGLLSGL  527



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score =   278 bits (711),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGL+P SPTAT+SRT+ GL+W+++WNALQ PV+SAFLA +YSDY+L+S    ++C  
Sbjct  356  AVMCGLIPSSPTATTSRTEGGLIWVAEWNALQQPVSSAFLATLYSDYLLTSGIENLSCGD  415

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
              + PSDLRKF+ SQADY+LG NP KMSYLVGYGD YP++VHHRGASIP DA TGCKDGF
Sbjct  416  TSFKPSDLRKFSRSQADYMLGKNPEKMSYLVGYGDKYPEFVHHRGASIPADANTGCKDGF  475

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            KWL S +PNPNVA G LVGGPFLN+T+ID+RNNSMQ EP+TYNSA++VGLLS
Sbjct  476  KWLNSEEPNPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYNSALVVGLLS  527



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP SPTATSSRT  GLVW+S+WN LQH +ASAFLAV++ DYM++++ + + C G
Sbjct  346  AIMCELLPDSPTATSSRTKGGLVWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCQG  405

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y+P+DLR FA+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF
Sbjct  406  KSYSPADLRNFAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGF  465

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  282
             WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  466  TWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP SPTATSSRT  GLVW+S+WN LQH +ASAFLAV++ DYM++++ + + C G
Sbjct  346  AIMCELLPDSPTATSSRTKGGLVWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCHG  405

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y+P+DLR FA+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF
Sbjct  406  KSYSPADLRNFAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGF  465

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  282
             WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  466  TWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +CGLLP+SPTATS RT  GLVW++QWN  Q+ VAS+FLAVVYSDYMLSS+T+ + C GK 
Sbjct  342  LCGLLPESPTATSQRTADGLVWVNQWNPFQYSVASSFLAVVYSDYMLSSQTSNLYCSGKL  401

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P++LR FA+SQ DY+LG+NPM+MSYLVGYG  YP+ VHHRGASIP +A + C DGFKW
Sbjct  402  YEPTELRNFAVSQLDYILGNNPMEMSYLVGYGSRYPQQVHHRGASIPVNANSNCSDGFKW  461

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L +  PNPNVAVG LVGGP L++TY+DSRNN  Q+EPTTYNSA+IVGL+SGL
Sbjct  462  LHTRHPNPNVAVGALVGGPSLSDTYMDSRNNISQSEPTTYNSALIVGLISGL  513



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C G
Sbjct  345  AVICGLLPDSPSATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSG  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  405  KYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  463

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L ST PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  464  QYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C G
Sbjct  345  AVICGLLPDSPSATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSG  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  405  KYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  463

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L ST PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  464  QYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C G
Sbjct  345  AVICGLLPDSPSATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSG  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  405  KYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  463

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L ST PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  464  QYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  517



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYMLS+RTA + C G
Sbjct  342  AVICGLIPDSPQATASRTGGGLVWISGWNSLQHATNAAFLAVVYSDYMLSTRTAAVQCSG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  402  KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S+ PNPNVAVG LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  461  QYLHSSDPNPNVAVGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  514



>gb|AFZ78646.1| korrigan [Populus tomentosa]
Length=530

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A+MC LLP SPTATSSRT  GL W+S+WN LQH +ASAFLAV++SDYM++++ + + C G
Sbjct  346  AIMCELLPDSPTATSSRTKGGLAWVSKWNCLQHAMASAFLAVLFSDYMVTTQISTLYCHG  405

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K Y+P+D+R  A+SQADY+LG+NPMKMSYLVGYG NYP+ VHHRGASIP DA T CKDGF
Sbjct  406  KSYSPADMRDLAISQADYILGNNPMKMSYLVGYGSNYPQNVHHRGASIPVDANTTCKDGF  465

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYN  282
             WL+S  PNPNVAVG +VGGPFLNETYIDSRNN MQAEPTTYN
Sbjct  466  TWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYN  508



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT+SRT  GLVWIS WN+LQH   +AFLAVVYSDYML+S+TA + C G
Sbjct  315  AVICGLLPDSPSATASRTGGGLVWISPWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSG  374

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA+SQ +Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  375  KYYSPTDIRNFAISQVNYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  433

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S+ PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VG+LSGL
Sbjct  434  QYLHSSSPNPNVAMGALVGGPFQNDTFVDSRDNALQTESSTYNSGTLVGVLSGL  487



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GLVWIS WN+LQH   +AFL+VVYSDYMLS+RTA + C G
Sbjct  343  AVICGLIPDSPQATASRTGGGLVWISGWNSLQHATNAAFLSVVYSDYMLSTRTAAVQCSG  402

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YPK VHHRGASIP DA TGCK GF
Sbjct  403  KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPKQVHHRGASIPADAKTGCK-GF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S  PNPNVA G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  462  EYLHSPSPNPNVATGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGL  515



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SR++ GLV +S+WNALQ  V++AFLA ++SDYML+SR  KI+C+G
Sbjct  342  AVMCGLLPKSPTATTSRSNGGLVLVSEWNALQQSVSAAFLASLFSDYMLTSRLHKISCNG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF
Sbjct  402  KIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPEDATTGCLDGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++  ST+PNPN+A G LVGGPFLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  462  EYFNSTKPNPNIAYGALVGGPFLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCG+LPKSPTAT+SRT+ GLVW+S+WN+LQ  V++AFLA ++SDYMLSSR  KI+CDG
Sbjct  340  AVMCGVLPKSPTATASRTNGGLVWVSEWNSLQQSVSAAFLASLFSDYMLSSRIHKISCDG  399

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NPM MS++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  400  KIFKATELRDFAKSQADYMLGKNPMGMSFVVGYGDKYPEFVHHRGASIPADATTGCLDGF  459

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            K+  ST+PNPN+A G LVGGPF NET++DSR+N MQ EPTTYN+A
Sbjct  460  KYFNSTKPNPNIAYGALVGGPFFNETFLDSRDNPMQNEPTTYNNA  504



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+ GLVW+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  AVMCGLLPKSPTATASRTNGGLVWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIPTDATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPTDATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+ GLVW+S+WN+LQ  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  AVMCGLLPKSPTATASRTNGGLVWVSEWNSLQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPADATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+ GLVW+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  AVMCGLLPKSPTATASRTNGGLVWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPEFVHHRGASIPADATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  AVMCGLLPKSPTATASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            +VMCGLLPKSPTAT+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  SVMCGLLPKSPTATASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPFLNET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFLNETFTDSRENPMQNEPTTYNNA  505



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SR++ GLV +S+WNALQ  V++AFLA ++SDYML+SR  KI+C+G
Sbjct  342  AVMCGLLPKSPTATTSRSNGGLVLVSEWNALQQSVSAAFLASLFSDYMLTSRLHKISCNG  401

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF
Sbjct  402  KIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPEDATTGCLDGF  461

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++  ST+PNPN+A G LV GPFLNET+ D+R+N  Q EPTTYN+A++VGL+S L
Sbjct  462  EYFNSTKPNPNIAYGALVRGPFLNETFRDARDNVRQNEPTTYNNALLVGLMSSL  515



>gb|EMT32027.1| Endoglucanase 24 [Aegilops tauschii]
Length=504

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT SRT  GLVWIS WN+LQH + +AFLAVVYSDYML+S+TA + C G
Sbjct  321  AVICGLLPDSPSATGSRTSGGLVWISGWNSLQHGINAAFLAVVYSDYMLTSQTAAVECSG  380

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KY++P+D+R FA+SQA+YVLGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  381  KYFSPTDIRNFAISQANYVLGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  439

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S+ PNPNVA G +VGGPF N++++D R+N++Q E +TYNS   VGLL+GL
Sbjct  440  EYLHSSSPNPNVATGAVVGGPFQNDSFVDLRDNAVQTESSTYNSGTFVGLLAGL  493



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score =   259 bits (661),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPT+T+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  AVMCGLLPKSPTSTASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPT+T+SRT+ GL+W+S+WN++Q  V+SAFLA ++SDYML+SR  KI+CDG
Sbjct  341  AVMCGLLPKSPTSTASRTNGGLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDG  400

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NP+  S++VGYGD YP++VHHRGASIP DATTGC DGF
Sbjct  401  KIFKATELRDFAKSQADYMLGKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGF  460

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            KW  ST+PNPN+A G LVGGPF NET+ DSR N MQ EPTTYN+A
Sbjct  461  KWFNSTKPNPNIAYGALVGGPFFNETFTDSRENPMQNEPTTYNNA  505



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +CGLLP+SP ATS RT  GLVW++QWN  Q+ VAS+FLAVVYSDYMLSS+T+ + C GK 
Sbjct  342  LCGLLPESPMATSQRTADGLVWVNQWNPFQYSVASSFLAVVYSDYMLSSQTSNLYCSGKL  401

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P++LR FA+SQ DY+LG+N M+MSYLVGYG  YP+ VHHRGASIP +A + C DGFKW
Sbjct  402  YEPTELRNFAVSQLDYILGNNSMEMSYLVGYGSRYPQQVHHRGASIPVNANSNCSDGFKW  461

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L +   NPNVAVG LVGGP L++TY+DSRNN  Q+EPTTYNSA+IVGL+SGL
Sbjct  462  LHTRHSNPNVAVGALVGGPSLSDTYMDSRNNISQSEPTTYNSALIVGLISGL  513



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +CGLLP+SPTATS RT  GLVW++QWN LQ+ VAS+FLAVVYSDYMLSS+T  + C G+ 
Sbjct  343  LCGLLPESPTATSQRTPDGLVWVNQWNPLQYSVASSFLAVVYSDYMLSSQTPNLYCIGEL  402

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P++LR FA+ Q DY+LG+NPM+MSYLVGYG  YP+ VHHRGASIP D  + C DGFKW
Sbjct  403  YEPTELRNFAVLQLDYILGNNPMEMSYLVGYGSRYPQQVHHRGASIPVDVNSNCSDGFKW  462

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L + +PNPNVAVG LVGGP L++TY+DSRNN  Q+E TTYN+A+IVGL+SGL
Sbjct  463  LHTREPNPNVAVGALVGGPSLSDTYMDSRNNISQSETTTYNTALIVGLISGL  514



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            +V+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS++TA + C G
Sbjct  345  SVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLAIVYSDYMLSTQTAAVQCSG  404

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGASIP DA TGCK GF
Sbjct  405  KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSVYPQQVHHRGASIPADAKTGCK-GF  463

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S  PNPNVA+G LVGGPF N+T++DSR+N++Q E +TYNS  +VGLLSGL
Sbjct  464  QYLHSPDPNPNVAMGALVGGPFQNDTFVDSRDNALQTESSTYNSGTLVGLLSGL  517



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT SRT  GLVWIS WN+LQH + +AFLAVVYSDYML+S+TA + C G
Sbjct  348  AVICGLLPDSPSATGSRTSGGLVWISGWNSLQHGINAAFLAVVYSDYMLTSQTAAVECSG  407

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KY++P+D+R FA+SQA+YVLGDN MK+SYLVGYG NYP+ VHHRGASIP DA TGCK GF
Sbjct  408  KYFSPTDIRNFAISQANYVLGDNTMKLSYLVGYGSNYPQQVHHRGASIPADAKTGCK-GF  466

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S+ PNPNVA+G +VGGPF N+T++D R+N++Q E +TYNS   VGLL+GL
Sbjct  467  EYLHSSSPNPNVAMGAVVGGPFQNDTFVDLRDNAVQTESSTYNSGTFVGLLAGL  520



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGLLP SP+AT SRT  GLVWIS WN++QH   S FLA VYSDYML+S+TA + C G
Sbjct  346  AVICGLLPDSPSATGSRTSGGLVWISGWNSIQHGTNSGFLASVYSDYMLTSQTAAVQCSG  405

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            KY++P+D+R FA+SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGASIP DA TGCK GF
Sbjct  406  KYFSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVHHRGASIPADAKTGCK-GF  464

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L S+ PNPNVA+G LVGGPF N++++DSR+N++Q E +TYNS  +VGLL+GL
Sbjct  465  EYLHSSSPNPNVAMGALVGGPFQNDSFVDSRDNAVQTESSTYNSGTLVGLLAGL  518



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +CGLLP+SPTATS RT  GLVW++QWN LQ+ VAS+FLAVVYSDYML S+T+ + C G+ 
Sbjct  343  LCGLLPESPTATSQRTADGLVWVNQWNPLQYSVASSFLAVVYSDYMLCSQTSNLYCSGEL  402

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGFKW  405
            Y P++LR FA+SQ DY+LG+N M++SYLVGYG  YP+ VHHRGASIP D  + C DGFKW
Sbjct  403  YEPTELRNFAVSQLDYILGNNRMEISYLVGYGSRYPQQVHHRGASIPVDDNSNCSDGFKW  462

Query  404  LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            L + +PNPNVAVG LVGGP L++TY+D RNN  Q+E TTYNSA+IVGL+SGL
Sbjct  463  LHTREPNPNVAVGALVGGPSLSDTYMDFRNNISQSETTTYNSALIVGLISGL  514



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAK-ITCD  594
            +VMC LLP+SPTA+ SRT SGL+W+S+WNALQ  VASAFLA +Y+DY++SS + + + C 
Sbjct  326  SVMCILLPRSPTASPSRTQSGLIWVSEWNALQEAVASAFLASLYADYIISSPSDQTLLCG  385

Query  593  GKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDG  414
            G+ + PS+L+ FA SQ DYVLG NPM MSYLVGYGD+YP+ VHHRGASIP +ATTGC DG
Sbjct  386  GQSFDPSELKSFAKSQVDYVLGQNPMNMSYLVGYGDSYPRQVHHRGASIPANATTGCTDG  445

Query  413  FKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            F WL S +PNPNVAVG LVGGPFLNETY+D RNN+MQAEPTTYN+A
Sbjct  446  FVWLMSEEPNPNVAVGALVGGPFLNETYVDDRNNTMQAEPTTYNTA  491



>ref|XP_002530743.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF31649.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=414

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A MC LLP SPTATSSRT++GL+W+ +WN LQ+ VASAFLAV++SDYM++S    + C G
Sbjct  229  AFMCRLLPDSPTATSSRTENGLIWVLKWNPLQYAVASAFLAVLFSDYMVASHIPTLYCSG  288

Query  590  KYYTP---SDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCK  420
            ++Y     + LR     QADYVLG NPM+MS+LVGYG N+P+YVHHRG+SIP DA TGCK
Sbjct  289  QFYRQMIFAALRFRRCFQADYVLGKNPMEMSFLVGYGLNFPRYVHHRGSSIPVDARTGCK  348

Query  419  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            DGF WL S  PNPNV VG LVGGPFLNETY+DSRNN+  AEPTTY+SA+ VGLLS L
Sbjct  349  DGFMWLHSQNPNPNVPVGALVGGPFLNETYVDSRNNTDIAEPTTYSSALFVGLLSAL  405



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT SR++SGLV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+G
Sbjct  315  AVMCGLLPKSPTATGSRSNSGLVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNG  374

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC DGF
Sbjct  375  KIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPADATTGCLDGF  434

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            K+  ST+PNPN+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  435  KYFNSTKPNPNIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  479



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            A++C L+P SPT+  +RT+ GL+WI+QWNA+QH V SA L ++YSDY+L+SR   I C  
Sbjct  346  AIICALIPHSPTSAPNRTEGGLIWITQWNAIQHSVNSALLTLIYSDYLLTSRVENIKCGD  405

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT--GCKD  417
            K + P DLRKFA SQ DY+LG+NPMKMSYLVG+G NYPK VHHRGASIP DA+T   C  
Sbjct  406  KDFAPEDLRKFAFSQVDYILGENPMKMSYLVGFGGNYPKQVHHRGASIPADASTVYDCNS  465

Query  416  GFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF W +S  PNPNV  G LVGGPFLN+++ID R+N MQ EP+TYNSA +VGLLSGL
Sbjct  466  GFVWFKSKSPNPNVVTGALVGGPFLNDSFIDIRSNPMQNEPSTYNSAALVGLLSGL  521



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT+ GL++++ WN+LQHPVASAFLA VYSDYML+S   +++C  
Sbjct  334  AVMCILLPDSETA-APRTEGGLLYVADWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGS  392

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADYVLG+NPMK+SYLVGYGD+YP+ VHHRGASIP D  TGC  G 
Sbjct  393  QTFSPADLRKFAKSQADYVLGENPMKVSYLVGYGDSYPQQVHHRGASIPADVDTGCG-GQ  451

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +WLES +PNPNVA G LVGGPF N++++D R+N MQ E TTYNSA+IVGLLSG+
Sbjct  452  EWLESPEPNPNVATGALVGGPFRNDSFVDKRDNVMQNEATTYNSALIVGLLSGI  505



>gb|EAZ38281.1| hypothetical protein OsJ_22659 [Oryza sativa Japonica Group]
Length=494

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT+ GL+++++WN+LQHPVASAFLA VYSDYM SS   +++C G
Sbjct  312  AVMCILLPDSETA-AFRTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSG  370

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG 
Sbjct  371  QGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGH  429

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWLE+++PNPNVA G LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  430  KWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  483



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT SR++SGLV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+G
Sbjct  343  AVMCGLLPKSPTATGSRSNSGLVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNG  402

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG NPM MS++VGYGD YP+Y+HHRGASIP DATTGC D F
Sbjct  403  KIFKATELRDFAKSQADYILGKNPMGMSFVVGYGDKYPEYIHHRGASIPADATTGCLDEF  462

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            K+  ST+PNPN+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  463  KYFNSTKPNPNIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  507



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT+ GL+++++WN+LQHPVASAFLA VYSDYM SS   +++C G
Sbjct  336  AVMCILLPDSETA-AFRTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSG  394

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG 
Sbjct  395  QGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGH  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWLE+++PNPNVA G LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  454  KWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT+ GL+++++WN+LQHPVASAFLA VYSDYM SS   +++C G
Sbjct  336  AVMCILLPDSETA-AFRTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSG  394

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG 
Sbjct  395  QGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVHHRGASIPEDVDTGC-DGH  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWLE+++PNPNVA G LVGGP+ N++++D R+N MQ E TTYNSA++ GLLS L
Sbjct  454  KWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSAL  507



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMCGLLPKSPTAT+SR++SGLV +S WN LQ  V++AFLA ++SDYML+SR  KI+C+G
Sbjct  343  AVMCGLLPKSPTATTSRSNSGLVLVSDWNPLQQSVSAAFLASLFSDYMLTSRIHKISCNG  402

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +  ++LR FA SQADY+LG N M MS++VGYGD YP+++HHRGASIP DATTGC DGF
Sbjct  403  KIFKATELRDFAKSQADYILGKNSMGMSFVVGYGDKYPEFIHHRGASIPADATTGCLDGF  462

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            K+  ST+PNPN+A G LVGGP+LNET+ DSR N  Q EPTTYN+A
Sbjct  463  KYFNSTKPNPNIAYGALVGGPYLNETFSDSRENVRQNEPTTYNNA  507



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT  GL+++++WN+LQHPVASAFLA VY DYML+S   ++TC G
Sbjct  336  AVMCILLPDSETA-AFRTQGGLLYVAEWNSLQHPVASAFLAAVYGDYMLTSGKTELTCGG  394

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADYVLGDNPMK+SYLVGYGD+YP+ VHHRGASIP+D  TGC  G 
Sbjct  395  QSFSPADLRKFAQSQADYVLGDNPMKLSYLVGYGDSYPQRVHHRGASIPSDVNTGCG-GQ  453

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  267
            +WLES  PNPNVA G LVGGPF N++++D R N MQ E TTYNSA+IV
Sbjct  454  EWLESPDPNPNVATGALVGGPFKNDSFVDERQNVMQNEATTYNSALIV  501



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT+ GL+++++WN+LQHPVASAFLA VYSDYML+S   +++C G
Sbjct  337  AVMCILLPDSETA-AFRTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMLTSGKTELSCGG  395

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADYVLG NPMK+SYLVGYGD YP+ VHHRGASIP D  TGC DG 
Sbjct  396  QSFSPADLRKFAKSQADYVLGSNPMKISYLVGYGDRYPQRVHHRGASIPADVDTGC-DGH  454

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWLES++ NPNVA G LVGGPF N+T+ D R+N MQ E TTYNSA++ G
Sbjct  455  KWLESSKDNPNVATGALVGGPFKNDTFSDKRDNVMQNEATTYNSALVAG  503



>gb|EMS54236.1| Endoglucanase 18 [Triticum urartu]
Length=485

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT+ GL++++ WN+LQHPVASAFLA VY DYML+S   ++TC G
Sbjct  302  AVMCILLPDSETA-AFRTEGGLLYVADWNSLQHPVASAFLAAVYGDYMLTSGKTELTCGG  360

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++P+DLRKFA SQADYVLGDNPMK+SYLVGYGD+YP+ VHHRGASIP D  TGC  G 
Sbjct  361  QSFSPADLRKFAQSQADYVLGDNPMKLSYLVGYGDSYPQRVHHRGASIPADVNTGCG-GQ  419

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  267
            +WLES  PNPNVA G LVGGPF N++++D R N MQ E TTYNSA+IV
Sbjct  420  EWLESPDPNPNVAAGALVGGPFKNDSFVDERQNVMQNEATTYNSALIV  467



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP+S TA + RT+ GL+++++W++LQHPVASAFLA VYS+YM +S  +++TC G
Sbjct  340  AVMCILLPESDTA-AFRTEGGLLYVAEWDSLQHPVASAFLANVYSNYMATSGKSELTCSG  398

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +T  DLRKFA SQADYVLGDNPMK+SYLVG+GD YP+ VHHRGASIP D  TGC DG 
Sbjct  399  KSFTALDLRKFAKSQADYVLGDNPMKLSYLVGFGDTYPQRVHHRGASIPADVDTGC-DGQ  457

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
            KWL+S  PNPNVA G LVGGPF N++++D R N  Q EPTTYNSA++VG
Sbjct  458  KWLKSPDPNPNVATGALVGGPFKNDSFVDDRENVQQNEPTTYNSALVVG  506



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP+S TA + RT+ GL+++++WN+LQHPVASAFLA VYSDYM +S   ++TC G
Sbjct  339  AVMCILLPESDTA-AFRTEGGLLYVAEWNSLQHPVASAFLAAVYSDYMSTSGKTELTCSG  397

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +T +DLRKFA SQADYVLGDNPMK+SYLVG+GD+YP+ VHHRGASIP D  TGC DG 
Sbjct  398  KSFTAADLRKFAKSQADYVLGDNPMKLSYLVGFGDSYPQRVHHRGASIPADVDTGC-DGQ  456

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  270
            +WL+S +PNPNVA G LVGGPF N+++ID R N  Q E TTYNSA+I
Sbjct  457  EWLKSPKPNPNVATGALVGGPFKNDSFIDDRENVRQNEATTYNSALI  503



>ref|NP_001066668.2| Os12g0428200 [Oryza sativa Japonica Group]
 dbj|BAF29687.2| Os12g0428200 [Oryza sativa Japonica Group]
Length=471

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA  + T  GL+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G
Sbjct  182  AVMCILLPDSETAAFT-TKGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSG  240

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++PSDLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  
Sbjct  241  QGFSPSDLRKFAKSQADYLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSH  299

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWLE+++PNPNV    LVGG + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  300  KWLETSKPNPNVTTDALVGGLYKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  353



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP+S TA + RT+ GL+++++WN+LQHPVASAFLA VYS+YM +S  +++TC G
Sbjct  339  AVMCILLPESDTA-AFRTEGGLLYVAEWNSLQHPVASAFLANVYSNYMATSGKSELTCSG  397

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            K +T  DLR+FA SQADYVLGDNPMK+SYLVG+GD+YP+ VHHRGASIP    TGC DG 
Sbjct  398  KSFTALDLRRFAKSQADYVLGDNPMKLSYLVGFGDSYPQRVHHRGASIPAGVDTGC-DGQ  456

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSA  276
            +WL+S +PNPNVA G LVGGPF N++++D R N  Q EPTTYNSA
Sbjct  457  EWLKSPEPNPNVATGALVGGPFKNDSFVDDRENVQQNEPTTYNSA  501



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  785  GALQXAVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAK  606
            G     ++C  LP+SPTA+++R+  GL+W+SQ NA+QH V SAFLAVVY+DY+ SS   +
Sbjct  373  GKTAEHLVCAFLPQSPTASTNRSTGGLLWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQ  432

Query  605  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  426
              C G  +   DLR FA SQADY+LG+NPM  SYLVGYG N+P+ +HHR ASIP DA TG
Sbjct  433  FRCSGNSFAAKDLRAFAASQADYILGENPMSKSYLVGYGANFPQQLHHREASIPLDAATG  492

Query  425  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            CKDGF+WL ++ PNP+VA G LVGGPF N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  493  CKDGFRWLHASAPNPHVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  551



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  785  GALQXAVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAK  606
            G     ++C  LP+SPTA+++R+  GL+W+SQ NA+QH V SAFLAVVY+DY+ SS   +
Sbjct  372  GKTAEHLVCAFLPQSPTASTNRSTGGLLWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQ  431

Query  605  ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  426
              C G  +   DLR FA SQADY+LG+NPM  SYLVGYG N+P+ +HHR ASIP DA TG
Sbjct  432  FRCSGNSFAAKDLRAFAASQADYILGENPMSKSYLVGYGANFPQQLHHREASIPLDAATG  491

Query  425  CKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            CKDGF+WL ++ PNP+VA G LVGGPF N++Y D R+N+MQ E TTYNSA +  LL  L
Sbjct  492  CKDGFRWLHASAPNPHVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVAL  550



>gb|ABA97969.1| Glycosyl hydrolase family 9 protein, expressed [Oryza sativa 
Japonica Group]
Length=694

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA  + T  GL+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G
Sbjct  360  AVMCILLPDSETAAFT-TKGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSG  418

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++PSDLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  
Sbjct  419  QGFSPSDLRKFAKSQADYLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSH  477

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            KWLE+++PNPNV    LVGG + N +++D R+N M  E TTYN A++ GLLS L
Sbjct  478  KWLETSKPNPNVTTDALVGGLYKNNSFVDERDNVMHNEATTYNCALVAGLLSAL  531



>gb|EAZ20312.1| hypothetical protein OsJ_35923 [Oryza sativa Japonica Group]
Length=392

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA  + T  GL+++++WN+LQHPVASAFLA VYSDYM SSR  ++TC G
Sbjct  182  AVMCILLPDSETAAFT-TKGGLLYVAEWNSLQHPVASAFLAAVYSDYMQSSRKTELTCSG  240

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDGF  411
            + ++PSDLRKFA SQADY+LG NPMK+SYLVGYGD YP+ VHHRG SIP +  TGC D  
Sbjct  241  QGFSPSDLRKFAKSQADYLLGSNPMKISYLVGYGDRYPERVHHRGISIPENVDTGC-DSH  299

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAI  273
            KWLE+++PNPNV    LVGG + N +++D R+N M  E TTYN A+
Sbjct  300  KWLETSKPNPNVTTDALVGGLYKNNSFVDERDNVMHNEATTYNCAL  345



>emb|CDP04111.1| unnamed protein product [Coffea canephora]
Length=138

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  629  MLSSRTAKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGAS  450
            M  S T  + C+G  Y P DLR FA+SQA+YVLG NPMKMSYLVGY  +YPKYVHHRGAS
Sbjct  1    MFWSGTPTLYCNGDQYEPMDLRSFAISQANYVLGSNPMKMSYLVGYSSDYPKYVHHRGAS  60

Query  449  IPTDATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAII  270
            IP DA TGCKDGFKWL S  PNPN+A G LVGGPFLN+TYIDSRNNS+QAEPTTYNSA I
Sbjct  61   IPADANTGCKDGFKWLRSPSPNPNIATGALVGGPFLNDTYIDSRNNSIQAEPTTYNSAFI  120

Query  269  VGLLSGL  249
            VGLLSGL
Sbjct  121  VGLLSGL  127



>ref|XP_001763275.1| predicted protein [Physcomitrella patens]
 gb|EDQ71805.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC  LP+SPTA+  RT  G++WI QW+ALQH + SA LA  YSDY+ +++   I+C G 
Sbjct  289  LMCAFLPRSPTASKDRTKGGMLWIEQWSALQHGINSALLATFYSDYLSAAQLPGISCSGI  348

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT-GCKDGF  411
             +TP++LR FA SQADYVLG NP+  S++VGYG  YP+ +HHRGASIP + T   CK GF
Sbjct  349  SFTPAELRSFAASQADYVLGANPLSTSFMVGYGAEYPQKLHHRGASIPVNPTVYDCKGGF  408

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             W +STQPNPN+A G +VGGPF NETY D+R+N +Q E +T+NSA +  L +GL
Sbjct  409  IWFDSTQPNPNIAHGAIVGGPFKNETYSDTRDNILQNEASTHNSAAMASLTAGL  462



>ref|XP_001781646.1| predicted protein [Physcomitrella patens]
 gb|EDQ53532.1| predicted protein [Physcomitrella patens]
Length=474

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC  LP SPTA++ RT  G +W+++W+ALQH + SA LA  YSDY+++++++ ITC GK
Sbjct  288  LMCAFLPGSPTASTDRTKGGYIWLNEWSALQHGINSALLASFYSDYLVAAKSSGITCSGK  347

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA-TTGCKDGF  411
             +T + LR FA SQA+YVLG+NP+  S++VGYG+ +PKY+HHRGASIP D   T C   +
Sbjct  348  SFTHAQLRAFASSQANYVLGNNPLSTSFMVGYGEKHPKYLHHRGASIPVDQIKTDCAHSW  407

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             W +S +PNPN+A G +VGGPF NETY D+R N MQ E + Y SA   GL +GL
Sbjct  408  GWYDSKEPNPNIAYGAVVGGPFKNETYTDARTNIMQNEASVYTSAAFAGLSAGL  461



>gb|KHN34290.1| Endoglucanase 24 [Glycine soja]
Length=516

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC LLP SPTAT++RT+SGL+W+  WN+LQ  VAS FLAV+Y DYML+S+T  + C GK
Sbjct  363  LMCMLLPDSPTATTNRTESGLIWVVPWNSLQLSVASVFLAVLYRDYMLTSQTEILYCSGK  422

Query  587  YYTPSDLRKFAMSQ--ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTGCKDG  414
             Y P DLRKF++SQ  ADYVLG+NPMKMSYLVGYG  YPKY+HHRG+SI  +ATTGCKDG
Sbjct  423  LYKPVDLRKFSISQFQADYVLGENPMKMSYLVGYGTQYPKYLHHRGSSIAVNATTGCKDG  482

Query  413  FKWLESTQPNPNVAVGGLVG  354
            FKW ES  PNPNVA G L+ 
Sbjct  483  FKWFESPHPNPNVAFGALIA  502



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 129/174 (74%), Gaps = 1/174 (1%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            ++C LLP SPT +++RT +G++W+SQWN++QH V SAFL+ +Y+DY+ S+    ++C GK
Sbjct  284  LVCALLPDSPTTSTNRTRAGMIWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGK  343

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGF  411
             +    LR+ A  QADY+LG NPM MSY+VGYG  YP  +HHR ASIP T +   CK+GF
Sbjct  344  IFQVEHLRELAGFQADYILGKNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEVECKEGF  403

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L ++ PNPN+A G LVGGPF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  404  QYLHTSTPNPNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  457



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 129/174 (74%), Gaps = 1/174 (1%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            ++C LLP SPT +++RT +G++W+SQWN++QH V SAFL+ +Y+DY+ S+    ++C GK
Sbjct  363  LVCALLPDSPTTSTNRTRAGMIWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGK  422

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKDGF  411
             +    LR+ A  QADY+LG NPM MSY+VGYG  YP  +HHR ASIP T +   CK+GF
Sbjct  423  IFEVEHLRELAGFQADYILGKNPMGMSYVVGYGKKYPLRLHHRAASIPSTLSEVECKEGF  482

Query  410  KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            ++L ++ PNPN+A G LVGGPF N++++D R+NSMQ E T+YNSA +  L++ L
Sbjct  483  QYLHTSTPNPNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASL  536



>gb|AFN16945.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTAK+ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAKVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16938.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C+G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCNG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16859.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16860.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16861.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16862.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16863.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16864.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16865.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16866.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16867.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16868.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16869.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16870.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16871.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16872.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16873.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16874.1| cellulase-like protein, partial [Panicum amarum]
 gb|AFN16875.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16876.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16878.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
 gb|AFN16887.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16889.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16892.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16893.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16895.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16896.1| cellulase-like protein, partial [Panicum virgatum var. cubense]
 gb|AFN16897.1| cellulase-like protein, partial [Panicum virgatum var. cubense]
 gb|AFN16913.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16914.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16915.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16916.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16918.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16924.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16925.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16926.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16927.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16928.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16929.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16930.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16931.1| cellulase-like protein, partial [Panicum tricholaenoides]
 gb|AFN16933.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16934.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16936.1| cellulase-like protein, partial [Panicum urvilleanum]
 gb|AFN16937.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16939.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16940.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16941.1| cellulase-like protein, partial [Panicum virgatum]
 gb|AFN16942.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16888.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVRCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFATSQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16911.1| cellulase-like protein, partial [Panicum racemosum]
 gb|AFN16912.1| cellulase-like protein, partial [Panicum racemosum]
Length=107

 Score =   173 bits (439),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRSFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16906.1| cellulase-like protein, partial [Panicum mystasipum]
 gb|AFN16908.1| cellulase-like protein, partial [Panicum olyroides]
 gb|AFN16909.1| cellulase-like protein, partial [Panicum olyroides]
Length=107

 Score =   173 bits (439),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+PSD+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPSDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16885.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   173 bits (439),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSARTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16884.1| cellulase-like protein, partial [Panicum cervicatum]
 gb|AFN16905.1| cellulase-like protein, partial [Panicum mystasipum]
 gb|AFN16919.1| cellulase-like protein, partial [Panicum rudgei]
Length=107

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16894.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS++TA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTQTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFATSQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16886.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16890.1| cellulase-like protein, partial [Panicum chloroleucum]
 gb|AFN16935.1| cellulase-like protein, partial [Panicum urvilleanum]
Length=107

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS++TA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTQTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16879.1| cellulase-like protein, partial [Panicum aquaticum]
 gb|AFN16882.1| cellulase-like protein, partial [Panicum bergii]
 gb|AFN16901.1| cellulase-like protein, partial [Panicum gouinii]
 gb|AFN16910.1| cellulase-like protein, partial [Panicum pedersenii]
 gb|AFN16923.1| cellulase-like protein, partial [Panicum stramineum]
Length=107

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16877.1| cellulase-like protein, partial [Panicum amarum var. amarulum]
Length=107

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS W++LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWSSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16946.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   171 bits (433),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH    AFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNPAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16932.1| cellulase-like protein, partial [Urochloa plantaginea]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP ATSSRT  GL+WIS WN+LQH   +AFL+VVYSDYMLS+RTA + C G
Sbjct  2    AVICGLIPDSPQATSSRTGGGLIWISGWNSLQHATNAAFLSVVYSDYMLSTRTAAVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16904.1| cellulase-like protein, partial [Panicum miliaceum]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYM+S+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMISTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16944.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVG G NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGNGSNYPQQVHHRGA  107



>gb|AFN16891.1| cellulase-like protein, partial [Panicum chloroleucum]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGD+PM++SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDSPMRLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16920.1| cellulase-like protein, partial [Setaria palmifolia]
 gb|AFN16921.1| cellulase-like protein, partial [Setaria palmifolia]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA + C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLAIVYSDYMLSTRTAAVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSTYPRQVHHRGA  107



>gb|AFN16881.1| cellulase-like protein, partial [Panicum bergii]
 gb|AFN16883.1| cellulase-like protein, partial [Panicum capillare]
 gb|AFN16903.1| cellulase-like protein, partial [Panicum miliaceum]
 gb|AFN16907.1| cellulase-like protein, partial [Panicum nephelophilum]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16880.1| cellulase-like protein, partial [Panicum aquaticum]
 gb|AFN16898.1| cellulase-like protein, partial [Panicum dichotomiflorum]
 gb|AFN16899.1| cellulase-like protein, partial [Panicum dichotomiflorum]
Length=107

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+ TA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTGTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16917.1| cellulase-like protein, partial [Panicum racemosum]
Length=107

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS++ A++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTQAAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|AFN16922.1| cellulase-like protein, partial [Panicum stramineum]
Length=107

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+ RT  GL+WIS WN+LQH   +AFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATAGRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+PSD+R FA SQA+Y+LGDNPMK+SYLVGYG +YP+ VHHRGA
Sbjct  62   KYYSPSDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVHHRGA  107



>gb|AFN16900.1| cellulase-like protein, partial [Panicum elephantipes]
Length=107

 Score =   169 bits (427),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS++TA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTQTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSTYPQQVHHRGA  107



>gb|AFN16902.1| cellulase-like protein, partial [Panicum gouinii]
Length=107

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   +AFLA+VYSDYMLS++TA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNAAFLALVYSDYMLSTQTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+D+R FA SQA+Y+LGDNPMK+SYLVGYG  YP+ VHHRGA
Sbjct  62   KYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSAYPQQVHHRGA  107



>gb|AFN16943.1| cellulase-like protein, partial [Panicum virgatum]
Length=107

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AV+CGL+P SP AT+SRT  GL+WIS WN+LQH   SAFLA+VYSDYMLS+RTA++ C G
Sbjct  2    AVICGLIPDSPQATASRTGGGLIWISGWNSLQHATNSAFLALVYSDYMLSTRTAEVQCSG  61

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA  453
            KYY+P+ +R FA SQA+ +LGDNPMK+SYLVGYG NYP+ VHHRGA
Sbjct  62   KYYSPTGIRNFAASQANCILGDNPMKLSYLVGYGSNYPQQVHHRGA  107



>gb|EAY82930.1| hypothetical protein OsI_38148 [Oryza sativa Indica Group]
Length=348

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            AVMC LLP S TA + RT  GL+++ +WN+LQHPVASAFLA VYSDYM SSR  +++C G
Sbjct  8    AVMCILLPDSETA-AFRTKGGLLYVDEWNSLQHPVASAFLAAVYSDYMQSSRKTELSCSG  66

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATTG  426
            + ++PSDLRKFA SQADY+LG NPMK+S LVGYGD YP+ VHHRG SIP D  TG
Sbjct  67   QGFSPSDLRKFAKSQADYLLGSNPMKISCLVGYGDRYPERVHHRGTSIPEDVDTG  121



>gb|EPS65630.1| hypothetical protein M569_09145, partial [Genlisea aurea]
Length=483

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 110/164 (67%), Gaps = 6/164 (4%)
 Frame = -2

Query  722  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITC-DGKYYTPSDLRKFAMSQ  546
            +T  GL+++ +WN LQ+  ++AFL   YS Y+   +TA + C DG+   P DL  FA SQ
Sbjct  319  KTPGGLLYVQKWNNLQYTSSAAFLMAAYSGYLSEGKTAVVNCPDGRQLQPLDLLNFARSQ  378

Query  545  ADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCKDGFK-WLESTQPNP  381
            ADY+LG NPM +SYLVGYGD+YP  VHHRGASIP+ +      GC +G++ W  S++ NP
Sbjct  379  ADYILGKNPMSLSYLVGYGDHYPIRVHHRGASIPSTSVLRSAVGCAEGYEVWYGSSKGNP  438

Query  380  NVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            NV  GGLVGGP  N+ + D R+N  Q EPT   +A +VGLLS L
Sbjct  439  NVIFGGLVGGPDENDEFTDERSNYEQNEPTLSGTAPMVGLLSKL  482



>ref|XP_008385953.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=286

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 104/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L ++  A   RT  G ++I QWN +Q+   +AFL   YSDY L +    +TCD   
Sbjct  93   MCACLDRNNVANVQRTPGGXLYIRQWNNMQYXSNAAFLLTTYSDY-LQATHENLTCDKGQ  151

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
             +P ++  FA SQ DY+LG NPM MSYL GYG  YP+ VHHRGASI +        GC  
Sbjct  152  VSPQEILSFAKSQVDYILGSNPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQ  211

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV  G LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  212  GYDSWYGRQGPNPNVLXGALVGGPDGNDGFXDERWNYMQTEACTYNTATLVGVLAKL  268



>gb|ERN09448.1| hypothetical protein AMTR_s00029p00087270 [Amborella trichopoda]
Length=617

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L K+       T  GL+++  WN +Q   +SAFL VVYSDY L +  A + C    
Sbjct  310  MCACLQKNKGYNVQMTPGGLLYVGDWNNMQFVSSSAFLVVVYSDY-LRAANAPLNCPEAQ  368

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKD  417
              PS+L  FA SQADY+LG NP  MSYLVG+G NYP  VHHRGASI + A +     C +
Sbjct  369  LHPSNLISFAQSQADYILGKNPRAMSYLVGFGPNYPTRVHHRGASIVSKAVSPAPVRCLE  428

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF+ W    Q +PN+ VG LVGGP  N+ +ID R+N  Q EPTTYN A ++GL + L
Sbjct  429  GFESWFNREQRDPNILVGALVGGPDRNDRFIDERSNYEQTEPTTYNVAPLIGLFAKL  485



>ref|XP_009334150.1| PREDICTED: endoglucanase 11-like [Pyrus x bretschneideri]
Length=509

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 108/177 (61%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L ++  A   RT  GL++I QWN +Q+   +AFL   Y+DY+ ++    +TCD   
Sbjct  316  MCACLDRNNVANVQRTPGGLLYIRQWNNMQYVSNAAFLLTTYTDYLQATH-ENLTCDKGQ  374

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
             +P ++  FA SQ DY+LG NPM MSYLVGYG  YP+ VHHRGASI +        GC  
Sbjct  375  VSPQEILSFAKSQVDYILGSNPMAMSYLVGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQ  434

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  435  GYDSWYGKQGPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  491



>ref|XP_011624647.1| PREDICTED: endoglucanase 5 [Amborella trichopoda]
 ref|XP_011624648.1| PREDICTED: endoglucanase 5 [Amborella trichopoda]
Length=542

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 108/175 (62%), Gaps = 6/175 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L K+       T  GL+++  WN +Q   +SAFL VVYSDY L +  A + C    
Sbjct  231  MCACLQKNKGYNVQMTPGGLLYVGDWNNMQFVSSSAFLVVVYSDY-LRAANAPLNCPEAQ  289

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKD  417
              PS+L  FA SQADY+LG NP  MSYLVG+G NYP  VHHRGASI + A +     C +
Sbjct  290  LHPSNLISFAQSQADYILGKNPRAMSYLVGFGPNYPTRVHHRGASIVSKAVSPAPVRCLE  349

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            GF+ W    Q +PN+ VG LVGGP  N+ +ID R+N  Q EPTTYN A ++GL +
Sbjct  350  GFESWFNREQRDPNILVGALVGGPDRNDRFIDERSNYEQTEPTTYNVAPLIGLFA  404



>ref|XP_003616918.1| Endoglucanase [Medicago truncatula]
 gb|AES99876.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=517

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+   T+  RT +GL+++ QWN +QH   ++FL  +YSDY L +   K+TC G 
Sbjct  320  ICSCLNKNINGTNVERTPAGLLYVRQWNNMQHVSTASFLLTIYSDY-LKNTNQKLTCHGG  378

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQ DY+LG NPM MSYLVGYG +YPK VHHRGASI          GC 
Sbjct  379  ILDHKEILSFAKSQVDYILGSNPMNMSYLVGYGPSYPKRVHHRGASIMSYKENKGFIGCT  438

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W     PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +V L +
Sbjct  439  QGYDNWYSKEDPNPNVLVGALVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVALFA  494



>gb|KJB13746.1| hypothetical protein B456_002G092400 [Gossypium raimondii]
Length=452

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 110/177 (62%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+  +  +RT +GL++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD   
Sbjct  259  LCACLNKNNGSNVNRTPAGLLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGK  317

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQADY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  
Sbjct  318  VGPEEVLLFARSQADYILGANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQ  377

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  378  GYDYWYPRNDPNPNVVVGALVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  434



>ref|XP_010252537.1| PREDICTED: endoglucanase 11-like [Nelumbo nucifera]
Length=526

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 104/175 (59%), Gaps = 5/175 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL  VYSDY+      K+ C G  
Sbjct  329  LCACLNKTTVENVDRTPGGLLYIRQWNNMQYVSTAAFLLTVYSDYLQRYSDQKLNCPGGE  388

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
              P ++  FA+SQ DY+LG NPM MSYLVGYG  YP+ VHHRGASI     +    GC  
Sbjct  389  VGPREILDFAISQVDYILGSNPMGMSYLVGYGPKYPRRVHHRGASIVSYRESKGFIGCTQ  448

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            G+  W    + NPNV VG LVGGP   + + D R+N MQ E  TYN+A +VGL +
Sbjct  449  GYDNWYGRDEANPNVLVGALVGGPDCQDNFRDRRSNFMQTEACTYNTAPLVGLFA  503



>gb|AFK38997.1| unknown [Medicago truncatula]
Length=517

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+   T+  RT +GL+++ QWN +QH   ++FL  +YSDY L +   K+TC G 
Sbjct  320  ICSCLNKNINGTNVERTPAGLLYVRQWNNMQHVSTASFLFTIYSDY-LKNTNQKLTCHGG  378

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQ DY+LG NPM MSYLVGYG +YPK VHHRGASI          GC 
Sbjct  379  ILDHKEILSFAKSQVDYILGSNPMNMSYLVGYGPSYPKRVHHRGASIMSYKENKGFIGCT  438

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W     PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +V L +
Sbjct  439  QGYDNWYSKEDPNPNVLVGALVGGPDWQDNFEDKRNNFMQTEACTYNTAPLVALFA  494



>ref|XP_010110634.1| Endoglucanase 11 [Morus notabilis]
 gb|EXC27256.1| Endoglucanase 11 [Morus notabilis]
Length=522

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            MC  L K+   T+  RT SGL+++ QWN +Q+   ++FL +VYSDY+ +S   K+TC G+
Sbjct  326  MCSCLNKNINGTNVERTPSGLLYVRQWNNMQYVSTASFLLIVYSDYLKAS-NQKLTCQGE  384

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
              +  ++  FA SQ DY+LG NP   SYLVGYG NYPK VHHRGASI          GC 
Sbjct  385  AISHEEVFTFAKSQVDYILGSNPQNKSYLVGYGPNYPKRVHHRGASIGSYRENKGFIGCT  444

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             G+  W    +PNPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  445  QGYDNWYGRDEPNPNVLVGALVGGPDCQDNFSDERYNYMQTEACTYNTAPLVGVFAKL  502



>ref|XP_011047209.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
 ref|XP_011047210.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=528

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+     +RT  GL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G  
Sbjct  333  LCSCLNKNNGTNVNRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGS  391

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
              P ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  
Sbjct  392  VDPEEILGFAKSQVDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQ  451

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  452  GYDNWYGREEPNPNVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|KJB13747.1| hypothetical protein B456_002G092400 [Gossypium raimondii]
Length=522

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 110/177 (62%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+  +  +RT +GL++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD   
Sbjct  329  LCACLNKNNGSNVNRTPAGLLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGK  387

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQADY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  
Sbjct  388  VGPEEVLLFARSQADYILGANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQ  447

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  448  GYDYWYPRNDPNPNVVVGALVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  504



>gb|AID55385.1| glycoside hydrolase family 9 B8 [Gossypium hirsutum]
Length=522

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 110/177 (62%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+  +  +RT +GL++I QWN +Q+   +AFL  VYSDY+ +S   ++ CD   
Sbjct  329  LCACLNKNNGSNVNRTPAGLLYIRQWNNMQYVSNAAFLLTVYSDYLRAS-NQRLRCDRGK  387

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQADY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  
Sbjct  388  VGPEEVLLFARSQADYILGANPMGMSYLVGYGSRYPQRMHHRGASIESYRENKGFIGCTQ  447

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  448  GYDYWYPRNDPNPNVVVGALVGGPDHMDRFSDDRKNFMQTEACTYNTASLVGVLAKL  504



>ref|XP_003519454.1| PREDICTED: endoglucanase 11 [Glycine max]
Length=524

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 108/176 (61%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+  + +  RT +GL+++ QWN +Q+   +AFL  +YSD+ L S   K+ C G 
Sbjct  327  ICSCLNKNNDSNNVERTPAGLIYVRQWNNMQYVSTAAFLLSIYSDF-LQSTNQKLNCHGG  385

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQADY+LG NPM MSYLVGYG NYPK VHHRGASI          GC 
Sbjct  386  TVDHEEILNFAKSQADYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCT  445

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W  S  PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  446  QGYDNWYGSQAPNPNVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  501



>gb|KHN38485.1| Endoglucanase 11 [Glycine soja]
Length=514

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 108/176 (61%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+  + +  RT +GL+++ QWN +Q+   +AFL  +YSD+ L S   K+ C G 
Sbjct  317  ICSCLNKNNDSNNVERTPAGLIYVRQWNNMQYVSTAAFLLSIYSDF-LQSTNQKLNCHGG  375

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQADY+LG NPM MSYLVGYG NYPK VHHRGASI          GC 
Sbjct  376  TVDHEEILNFAKSQADYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCT  435

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W  S  PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +VG+ +
Sbjct  436  QGYDNWYGSQAPNPNVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFA  491



>ref|XP_008366459.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=371

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 104/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L ++  A   RT  G ++I QWN +Q+   +AFL   YSDY L +    +TCD   
Sbjct  182  MCACLDRNNVANVQRTPGGXLYIRQWNNMQYXSNAAFLLTTYSDY-LQATHENLTCDKGQ  240

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
             +P ++  FA SQ DY+LG NPM MSYL GYG  YP+ VHHRGASI +        GC  
Sbjct  241  VSPQEILSFAKSQVDYILGSNPMAMSYLXGYGPKYPQRVHHRGASIDSYKKNKGFIGCTQ  300

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV  G LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  301  GYDSWYGRQGPNPNVLXGALVGGPDGNDGFXDERWNYMQTEACTYNTATLVGVLAKL  357



>ref|XP_002321149.2| hypothetical protein POPTR_0014s15590g [Populus trichocarpa]
 gb|EEE99464.2| hypothetical protein POPTR_0014s15590g [Populus trichocarpa]
Length=528

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+     +RT SGL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G  
Sbjct  333  LCSCLNKNNGTNVNRTPSGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGS  391

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
                ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  
Sbjct  392  VDHEEILGFAKSQVDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQ  451

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  452  GYDNWYGREEPNPNVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>ref|XP_012071240.1| PREDICTED: endoglucanase 11-like [Jatropha curcas]
 gb|KDP39180.1| hypothetical protein JCGZ_00937 [Jatropha curcas]
Length=502

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN LQ+   +AFL  VYSDY+ +S   ++ CD   
Sbjct  316  LCSCLNKNNVTNVERTPGGLLYIRQWNNLQYASTAAFLLTVYSDYLQAS-NQRLKCDRGT  374

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQ DY+LG NPM MSYLVGYG  YP+ VHHRGASI +        GC  
Sbjct  375  LDPQEIFGFAKSQVDYILGANPMNMSYLVGYGSKYPQKVHHRGASIASYKEYKGFVGCTQ  434

Query  416  GFKW-LESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+     S  PNPNV VG +VGGP  N+ + D R N +Q E  TYN+A +VG+ + L
Sbjct  435  GYDIGYNSQDPNPNVLVGAIVGGPDKNDEFRDERGNYVQTEACTYNTACLVGVFAKL  491



>ref|XP_012080633.1| PREDICTED: endoglucanase 11-like [Jatropha curcas]
 gb|KDP30800.1| hypothetical protein JCGZ_13743 [Jatropha curcas]
Length=532

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+  +   RT +GL+ + QWN +Q+   +AFL  +YSD++ SS   K+ C G  
Sbjct  333  ICSCLNKNNGSNVDRTPAGLLHVRQWNNMQYVSTAAFLLTIYSDFLRSS-DRKLVCHGGL  391

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
                ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  
Sbjct  392  VDHEEILNFAKSQVDYILGSNPMNMSYLVGYGSKYPTRVHHRGASIVSYRENKGFIGCTQ  451

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV VG LVGGP   + ++D R N MQ E  TYN+A +VG+ + L
Sbjct  452  GYDNWYSQKEPNPNVLVGALVGGPDCQDNFMDQRGNYMQTEACTYNTAPLVGVFAKL  508



>ref|XP_011046752.1| PREDICTED: endoglucanase 11-like [Populus euphratica]
Length=493

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD   
Sbjct  299  LCACLNKNNVTNVQRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGT  357

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              PSD+ KFA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI +        GC  
Sbjct  358  LDPSDIFKFAKSQVDYILGYNPMGMSYLVGYGAKYPARVHHRGASIESYKEQKDFIGCMQ  417

Query  416  GFKWLESTQ-PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+    S Q PNPNV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  418  GYDIGYSRQGPNPNVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  474



>ref|XP_007215908.1| hypothetical protein PRUPE_ppa004172mg [Prunus persica]
 gb|EMJ17107.1| hypothetical protein PRUPE_ppa004172mg [Prunus persica]
Length=525

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKS-PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+  T    RT +GL++I QWN +Q+   +AFL  VYSD++ SS   K++C G 
Sbjct  331  ICSCLNKNNDTKNVERTPAGLLYIRQWNNMQYVSTAAFLLTVYSDFLKSS-NQKLSCHGG  389

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCK  420
                 ++  FA SQ DY+LG NPM MSYLVGYG  YP+ VHHRGAS+ +        GC 
Sbjct  390  MVGHEEVLDFAKSQIDYILGSNPMNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCT  449

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W    +PNPNV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  450  QGYDNWYGREEPNPNVLVGALVGGPDCQDNFVDQRDNYMQTEACTYNTAPLVGVFA  505



>ref|XP_008364782.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=507

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L K+      RT  GL++I QWN +Q+   +AFL  +YSDY+ ++    +TCD   
Sbjct  315  MCACLDKNNVTNVQRTPGGLLYIRQWNNMQYVSNAAFLLTIYSDYIQAAH-HNLTCDKGQ  373

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  F  SQ DY+LG NPM MSYLVGYG  YP+ +HHRGASI +        GC  
Sbjct  374  VGPQEILSFTKSQVDYILGSNPMGMSYLVGYGPKYPRRLHHRGASIDSYKKNXGFIGCTQ  433

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  434  GYHNWYGRQGPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  490



>gb|KCW73256.1| hypothetical protein EUGRSUZ_E01717 [Eucalyptus grandis]
Length=475

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 107/177 (60%), Gaps = 7/177 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K  +    +T  GL+W   WN LQ+   +AF+A VY+DY L S+ A I C G  
Sbjct  300  ICNCLQKG-SGNFKKTPGGLLWFQPWNNLQYTSTAAFIAAVYADY-LDSKKASIQCPGGI  357

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKD  417
             + SDL + A SQADY+LG+NP K+SY+VGYG NYP  VHHRGA   SI  D T   C  
Sbjct  358  ASSSDLIELAQSQADYILGENPNKLSYMVGYGSNYPTQVHHRGASIVSIKKDPTPVSCSQ  417

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF  W     PNPNV  G LVGGP   + Y DSR+N   AEP T N+A  VG+L+ L
Sbjct  418  GFDLWFNKNAPNPNVLDGALVGGPDQQDGYSDSRSNYQMAEPATANTAPFVGVLARL  474



>ref|XP_010058568.1| PREDICTED: endoglucanase 14-like [Eucalyptus grandis]
Length=492

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 107/177 (60%), Gaps = 7/177 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K  +    +T  GL+W   WN LQ+   +AF+A VY+DY L S+ A I C G  
Sbjct  317  ICNCLQKG-SGNFKKTPGGLLWFQPWNNLQYTSTAAFIAAVYADY-LDSKKASIQCPGGI  374

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKD  417
             + SDL + A SQADY+LG+NP K+SY+VGYG NYP  VHHRGA   SI  D T   C  
Sbjct  375  ASSSDLIELAQSQADYILGENPNKLSYMVGYGSNYPTQVHHRGASIVSIKKDPTPVSCSQ  434

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF  W     PNPNV  G LVGGP   + Y DSR+N   AEP T N+A  VG+L+ L
Sbjct  435  GFDLWFNKNAPNPNVLDGALVGGPDQQDGYSDSRSNYQMAEPATANTAPFVGVLARL  491



>ref|XP_008230008.1| PREDICTED: endoglucanase 11 [Prunus mume]
Length=526

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKS-PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+  T    RT +GL++I QWN +Q+   +AFL  VYSD++ SS   K++C G 
Sbjct  332  ICSCLNKNNDTKNVERTPAGLLYIRQWNNMQYVSTAAFLLTVYSDFLKSS-NQKLSCHGG  390

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCK  420
                 ++  FA SQ DY+LG NPM MSYLVGYG  YP+ VHHRGAS+ +        GC 
Sbjct  391  MVGHEEVLDFAKSQTDYILGANPMNMSYLVGYGPKYPQRVHHRGASVESYRENKGFIGCT  450

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W    +PNPNV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  451  QGYDNWYGRDEPNPNVLVGALVGGPDCQDNFVDQRDNYMQTEACTYNTAPLVGVFA  506



>gb|AFZ78643.1| korrigan [Populus tomentosa]
Length=528

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+     +RT  GL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G  
Sbjct  333  LCSCLDKNNGTNVNRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLNCHGGS  391

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
                ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  
Sbjct  392  VDHEEILGFAKSQVDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQ  451

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  452  GYDNWYGREEPNPNVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|AFZ78645.1| korrigan [Populus tomentosa]
Length=505

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 107/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD   
Sbjct  311  LCACLNKNNVTNVQRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGT  369

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              PSD+ KFA SQ DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  
Sbjct  370  LDPSDIFKFAKSQVDYILGYNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQ  429

Query  416  GFKWLESTQ-PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+    S Q PNPNV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  430  GYDIGYSRQGPNPNVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  486



>ref|XP_002300328.1| hypothetical protein POPTR_0001s36600g [Populus trichocarpa]
 gb|EEE85133.1| hypothetical protein POPTR_0001s36600g [Populus trichocarpa]
Length=517

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 107/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD   
Sbjct  323  LCACLNKNNVTNVQRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGT  381

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              PSD+ KFA SQ DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  
Sbjct  382  LDPSDIFKFAKSQVDYILGYNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQ  441

Query  416  GFKWLESTQ-PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+    S Q PNPNV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  442  GYDIGYSRQGPNPNVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  498



>ref|XP_002529469.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF32935.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=510

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L ++      RT  GL++I QWN LQ+   +AFL  VYSD++L+S   ++ CD   
Sbjct  317  LCSCLDQNNVTNVKRTPGGLLYIRQWNNLQYVSTAAFLLTVYSDHLLAS-NQRLKCDRGI  375

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++   A SQ DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  
Sbjct  376  LDPQEILSVAKSQIDYILGANPVGMSYLVGYGTEYPQRVHHRGASIESYKGNKGFIGCTQ  435

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+L+ L
Sbjct  436  GYDMWYNRQDPNPNVVVGALVGGPDEKDEFSDERGNYMQTEACTYNTASLVGVLARL  492



>gb|AEO97204.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97231.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=528

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+     +RT  GL+ I QWN +Q+   +AFL  VYSD++L+S   K+ C G  
Sbjct  333  LCSCLNKNNGTNVNRTPGGLLHIRQWNNMQYVSTAAFLLTVYSDFLLNS-NQKLKCHGGS  391

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
                ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  
Sbjct  392  VDHEEILGFAKSQVDYILGSNPMNMSYLVGYGPKYPARVHHRGASIVSYRENKGFIGCTQ  451

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV VG LVGGP   + + D R+N MQ E  TYN+A +VG+ + L
Sbjct  452  GYDNWYGREEPNPNVLVGALVGGPDCQDNFTDQRSNYMQTEACTYNTAPLVGVFAKL  508



>gb|AEO97205.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97232.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=524

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 107/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL   YSD++ +S   ++ CD   
Sbjct  330  LCACLNKNNVTNVQRTPGGLLYIRQWNNMQYVSTAAFLLTTYSDHLQAS-NQRLQCDQGT  388

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              PSD+ KFA SQ DY+LG NP+ MSYLVGYG  YP+ VHHRGASI +        GC  
Sbjct  389  LDPSDIFKFAKSQVDYILGYNPLGMSYLVGYGAKYPERVHHRGASIESYKGQKDFIGCMQ  448

Query  416  GFKWLESTQ-PNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+    S Q PNPNV  G LVGGP + + + D R N MQ E  TYN+A +VG+ + L
Sbjct  449  GYDIGYSRQGPNPNVLTGALVGGPDMKDQFRDERENYMQTEACTYNTATLVGVFAKL  505



>ref|XP_007212600.1| hypothetical protein PRUPE_ppa016852mg [Prunus persica]
 gb|EMJ13799.1| hypothetical protein PRUPE_ppa016852mg [Prunus persica]
Length=513

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL   YSDY+ ++    +TCD   
Sbjct  320  ICACLDKNNVTNVQRTPGGLLYIRQWNNMQYVSNAAFLLTTYSDYLQATHQ-NLTCDKGQ  378

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P +L  FA SQ DY+LG NP  MSYLVGYG  YP+ +HHRGASI +        GC +
Sbjct  379  VGPQELLSFAKSQVDYILGSNPTAMSYLVGYGPKYPQRLHHRGASIESYKRNKGFIGCTE  438

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  439  GYDSWYGMHDPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  495



>gb|EYU29517.1| hypothetical protein MIMGU_mgv1a003302mg [Erythranthe guttata]
Length=593

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 6/176 (3%)
 Frame = -2

Query  761  CGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYY  582
            C  L K+       T  GL+++ +WN LQ+  +SAFL  VYSDY+  S++  + C     
Sbjct  318  CACLQKNDGYNVKMTPGGLLYVREWNNLQYTASSAFLLAVYSDYLAKSKSV-VKCPSVQV  376

Query  581  TPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDG  414
             P +L  FA SQADY+LG NP  MSYLVG+G +YP +VHHRGASI +     +  GC +G
Sbjct  377  QPQELLTFAKSQADYILGKNPKSMSYLVGFGQSYPLHVHHRGASITSISLLKSAVGCVEG  436

Query  413  FK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            F+ W +  + +PNV  G LVGGP  N+ Y DSR+N  Q+EPT   +A +VGL S L
Sbjct  437  FESWYKRVEADPNVIYGALVGGPNANDEYFDSRSNYEQSEPTISGTAPLVGLFSRL  492



>gb|KHM99090.1| Endoglucanase 11 [Glycine soja]
Length=527

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+  + +  RT +GL+++ QWN +Q+   +AFL  +YSD+ L +   K+ C G 
Sbjct  330  ICSCLNKNNDSNNVERTPAGLIYVRQWNNMQYVSTAAFLLSIYSDF-LQNTNQKLNCHGG  388

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQ DY+LG NPM MSYLVGYG NYPK VHHRGASI          GC 
Sbjct  389  TVDHEEILNFAKSQVDYILGSNPMNMSYLVGYGPNYPKRVHHRGASIVSYKKNKGFIGCT  448

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             G+  W  S  PNPNV VG LVGGP   + + D RNN MQ E  TYN+A +VG+ +  
Sbjct  449  QGYDNWYGSQAPNPNVLVGALVGGPDGKDNFEDRRNNFMQTEACTYNTAPLVGVFAKF  506



>ref|XP_004304093.1| PREDICTED: endoglucanase 11 [Fragaria vesca subsp. vesca]
Length=517

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 110/176 (63%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKS-PTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+  T    RT +GL++I QWN +Q+   ++FL  +YSD++ SS   K++C G 
Sbjct  320  ICSCLNKNLDTTNVERTPAGLLYIRQWNNMQYVSTASFLLTMYSDFLKSS-NQKLSCHGG  378

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQ DY+LG NP  MSYLVGYG NYP+ VHHRGAS+       A  GC 
Sbjct  379  TVAHQEILSFAKSQVDYILGSNPSNMSYLVGYGSNYPQRVHHRGASVVSYRENKAFIGCT  438

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W    +PNPNV VG LVGGP  ++ ++D R+N MQ E  TYN+A +VG+ +
Sbjct  439  QGYDNWYGRLEPNPNVLVGALVGGPDSHDNFLDQRDNYMQTEACTYNTAPLVGVFA  494



>ref|XP_009403726.1| PREDICTED: endoglucanase 9-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
             MC +LP +P++T+  T  GL++      LQ+  + +FL   YS Y+ SS+ +  TC   
Sbjct  207  FMCRILPNNPSSTTQYTPGGLMYKQSSANLQYATSISFLLFTYSKYIASSKHS-FTCGNL  265

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCK  420
             +T S LR  A  Q DY+LG+NP+KMSY+VG+G  +P+ +HHR AS+P+ AT     GC+
Sbjct  266  LFTASSLRSLAKKQVDYILGENPLKMSYMVGFGARFPQKIHHRAASLPSLATYPGHIGCQ  325

Query  419  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             GF++L+S+ PNPN+  G +VGGP  N+ + D R +   AEP TY +A +VG L+ L
Sbjct  326  AGFQYLDSSSPNPNILTGAVVGGPDQNDAFTDDRKDFSHAEPATYINAPLVGSLAYL  382



>ref|XP_009403727.1| PREDICTED: endoglucanase 9-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=401

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC +LP +P++T+  T  GL++      LQ+  + +FL   YS Y+ SS+ +  TC    
Sbjct  220  MCRILPNNPSSTTQYTPGGLMYKQSSANLQYATSISFLLFTYSKYIASSKHS-FTCGNLL  278

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCKD  417
            +T S LR  A  Q DY+LG+NP+KMSY+VG+G  +P+ +HHR AS+P+ AT     GC+ 
Sbjct  279  FTASSLRSLAKKQVDYILGENPLKMSYMVGFGARFPQKIHHRAASLPSLATYPGHIGCQA  338

Query  416  GFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF++L+S+ PNPN+  G +VGGP  N+ + D R +   AEP TY +A +VG L+ L
Sbjct  339  GFQYLDSSSPNPNILTGAVVGGPDQNDAFTDDRKDFSHAEPATYINAPLVGSLAYL  394



>ref|XP_002510937.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF51539.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=506

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            ++C +LP+SPT   + +  GL++    + LQH  A +FL +VYS Y+  SR   + C   
Sbjct  321  LVCSILPESPTKFVTYSAGGLLFKPGSSNLQHTTALSFLLLVYSRYLEQSRRV-VKCGNV  379

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCK  420
              TP+ L   A  Q DY+LG NP+ MSY+VGYG+ YP+ +HHRG+++P         GCK
Sbjct  380  VATPTRLVAVAKGQVDYILGRNPLGMSYMVGYGNKYPQRIHHRGSTLPMIQNHPQHIGCK  439

Query  419  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +G  + ES  PNPNV VG +VGGP +N+ Y+D R N  Q+EPTTY +A  VG+L+ L
Sbjct  440  EGTPYFESNNPNPNVLVGAIVGGPDINDQYVDDRLNVSQSEPTTYINAPFVGVLAYL  496



>ref|XP_008227038.1| PREDICTED: endoglucanase 11-like [Prunus mume]
Length=513

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL   YSDY+ ++    + CD   
Sbjct  320  ICACLDKNNVTNVQRTPGGLLYIRQWNNMQYVSNAAFLLTTYSDYLQATHQ-NLACDKGR  378

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P +L  FA SQ DY+LG NP  MSYLVGYG  YP+ +HHRGASI +        GC  
Sbjct  379  VGPQELLSFAKSQVDYILGSNPTAMSYLVGYGPKYPQRLHHRGASIESYKRNKGFIGCTQ  438

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  439  GYDSWYRMHRPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  495



>ref|XP_010666165.1| PREDICTED: endoglucanase 14-like [Beta vulgaris subsp. vulgaris]
Length=484

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 102/161 (63%), Gaps = 6/161 (4%)
 Frame = -2

Query  722  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  543
            +T  GL+W + W+ LQ+   + F+  +Y+DY+ +S  + + C      P DL  FA SQ 
Sbjct  322  KTSGGLLWFNDWDNLQYTSTATFVITIYADYLFASEKS-LNCPSSLVNPPDLIAFAKSQV  380

Query  542  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGF-KWLESTQPNPN  378
            DY+LG NP   SY+VGYG NYP+ VHHRG+   SI  D T  GCKDGF  W    QPNPN
Sbjct  381  DYILGANPKNTSYMVGYGSNYPQQVHHRGSSIVSIKKDPTPVGCKDGFTNWFNKNQPNPN  440

Query  377  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            V VG +VGGP  N+ Y+D R++   AEP T NSA +VG+L+
Sbjct  441  VLVGAIVGGPDKNDNYVDQRSDYQLAEPATANSAGLVGVLA  481



>ref|XP_010536683.1| PREDICTED: endoglucanase 11-like [Tarenaya hassleriana]
Length=437

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 108/177 (61%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K   A  +RT  GL+++ QWN LQ+ V ++FL  VYSD+ L +   ++ C    
Sbjct  250  LCACLGKGGAANVARTPGGLLYVRQWNNLQYVVTASFLLAVYSDH-LRATGRRLVCGQGA  308

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
                ++  FA +QADY+LG+NP  MSY+VGYG  +P  VHHRGASI +        GC D
Sbjct  309  VGAGEVLAFAKAQADYILGNNPQGMSYMVGYGPRFPVRVHHRGASIASYRDEKGFIGCVD  368

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+ +W  S  PNPN+ +G +VGGP  N+ + D R+N  Q E  TYN+A  VG+L+ L
Sbjct  369  GYHRWFHSKDPNPNIIIGAIVGGPDKNDDFEDRRDNFRQTEACTYNTAAFVGVLARL  425



>ref|XP_012086616.1| PREDICTED: endoglucanase 1-like [Jatropha curcas]
 gb|KDP25211.1| hypothetical protein JCGZ_20367 [Jatropha curcas]
Length=495

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 113/185 (61%), Gaps = 5/185 (3%)
 Frame = -2

Query  791  SIGALQXAVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRT  612
            S  A     +C ++P + ++ +  T  GL++ +  + LQ+  ++AFL + YS Y LSS  
Sbjct  308  SFKAHSDNYICSIIPGTSSSQAQYTPGGLLYKASESNLQYVTSTAFLLLTYSKY-LSSNG  366

Query  611  AKITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT  432
              + C G   T   L   A  Q DY+LGDNP KMSY+VG+G+ YP++VHHRG+S+P+  T
Sbjct  367  GAVKCGGSVVTAESLESAAKKQVDYILGDNPAKMSYMVGFGNKYPQHVHHRGSSVPSIHT  426

Query  431  ----TGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVG  264
                  C DGF++ +ST PNPNV VG ++GGP   + + D RNN  Q+EP TY +A  VG
Sbjct  427  HPERISCNDGFQYFKSTSPNPNVLVGAIIGGPDNQDNFADDRNNYQQSEPATYINAPFVG  486

Query  263  LLSGL  249
             L+ L
Sbjct  487  ALAFL  491



>ref|XP_008342129.1| PREDICTED: endoglucanase 11-like [Malus domestica]
Length=516

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 109/176 (62%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPK-SPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            MC  L K + T    RT +GL+++ QWN +Q+   ++FL  VYSD++ +S   K++C G 
Sbjct  319  MCSCLNKNTATKNVERTPAGLLYVRQWNNMQYVSTASFLLTVYSDFLETS-NQKLSCHGG  377

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCK  420
                 ++  FA SQ DY+LG NP+ MSYLVGYG  YP+ VHHRGAS+ +        GC 
Sbjct  378  TAGHEEVLSFAKSQIDYILGSNPLNMSYLVGYGPKYPRRVHHRGASVESYRENKGFIGCT  437

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W    +PNPNV VG LVGGP   + ++D R+N MQ E  TYN+A +VG+ +
Sbjct  438  QGYDNWYGREEPNPNVLVGALVGGPDCKDNFVDRRDNYMQTEACTYNTAPLVGVFA  493



>ref|XP_010264780.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=628

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 104/163 (64%), Gaps = 6/163 (4%)
 Frame = -2

Query  722  RTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYYTPSDLRKFAMSQA  543
            R+  GL+W   WN LQ+  ++ F+A  YS+Y+ ++R A I C G    PSDL  F  SQA
Sbjct  466  RSPGGLLWWQPWNDLQYTTSAMFVATAYSEYLTAAR-ATIQCQGGRVGPSDLISFVRSQA  524

Query  542  DYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKDGFK-WLESTQPNPN  378
            +Y+LG NP  MSY+VG+G +YP+ VHHRGA   SI  D T   CK G+  W     PNPN
Sbjct  525  NYILGSNPKGMSYMVGFGSSYPQMVHHRGASIVSIKKDRTPVTCKGGYDMWFNRNAPNPN  584

Query  377  VAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            V VG +VGGP  N+ Y DSR+N  QAEP T N+A  VG+L+ L
Sbjct  585  VLVGAIVGGPDQNDAYTDSRSNFQQAEPATVNTAPFVGVLAKL  627



>gb|ERN05290.1| hypothetical protein AMTR_s00007p00145080 [Amborella trichopoda]
Length=215

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 116/180 (64%), Gaps = 7/180 (4%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTA--KITCD  594
            ++C  + KS T+ +  T  GL+W++ W  LQ+   ++FL  VYSD++ ++R     + C 
Sbjct  32   LLCQYIQKSGTSNARTTPGGLLWLNPWINLQYISTASFLLTVYSDFLSTARGGPRSLMCP  91

Query  593  GKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT---DAT-TG  426
                 PS+L  FA SQ DY+LG NP  +SY+VGYG +YP +VHHRGASI +   D T  G
Sbjct  92   AGQVQPSELLSFARSQVDYILGTNPKAVSYMVGYGSSYPWHVHHRGASIVSVKKDPTPVG  151

Query  425  CKDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            C+DG K W ++T P+PNV  GG+VGGP  N+ + D+R+   Q++P  Y +A +VG+L+ L
Sbjct  152  CEDGLKIWFDNTGPDPNVIDGGVVGGPDENDAFGDNRSLMAQSQPAIYTTAPLVGVLAKL  211



>ref|XP_004500768.1| PREDICTED: endoglucanase 24-like isoform X3 [Cicer arietinum]
Length=340

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 118/184 (64%), Gaps = 7/184 (4%)
 Frame = -2

Query  791  SIGALQXAVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRT  612
            S  A   + +C L+P++ ++    T  GL++    + LQH  + AFL +VY++Y+  SRT
Sbjct  150  SYKASAESFLCTLIPETSSSHIEYTPGGLIYRPGGSNLQHATSIAFLELVYANYL--SRT  207

Query  611  AK-ITCDGKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT--  441
            ++ I C   Y +   LR+ A  Q DY+LGDNP+ +SY+VGYG+NYP+ +HHRG+S+P   
Sbjct  208  SQSINCGNVYVSAQTLRERAKRQVDYILGDNPLGLSYMVGYGNNYPQRIHHRGSSLPNIK  267

Query  440  --DATTGCKDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIV  267
                   CK+G  +  ST PNPNV VG +VGGP  ++ Y+D R + +++EPTTY +A  V
Sbjct  268  DHPQKIACKEGSIYFNSTNPNPNVLVGAIVGGPGEDDVYMDDRADYIKSEPTTYINAPFV  327

Query  266  GLLS  255
            G+L+
Sbjct  328  GVLA  331



>ref|XP_010244161.1| PREDICTED: endoglucanase 11-like [Nelumbo nucifera]
Length=521

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+ +A   RT  GL++I QWN +Q+   +AFL  VYSDY+  S   K++C    
Sbjct  324  LCACLNKTISANVDRTPGGLLYIRQWNNMQYVSTAAFLLTVYSDYLKHS-GQKLSCPAGE  382

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
                ++ K+A SQ DY+LG NPM MSYLVGYG   P+ VHHRGASI          GC  
Sbjct  383  VEHQEILKYAKSQVDYILGSNPMGMSYLVGYGPKSPRRVHHRGASIVSYRENKGFIGCTQ  442

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPN+ VG LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  443  GYDNWYGRDEPNPNIVVGALVGGPDWQDNFRDQRGNYMQTEACTYNTAPLVGIFAKL  499



>ref|XP_006596588.1| PREDICTED: endoglucanase 11-like [Glycine max]
Length=523

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L  +      RT  GL+++ QWN +Q+   ++FL  VYSD++L++   K+ C    
Sbjct  326  LCACLNLNSVTNVERTPGGLLYVRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGE  384

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQ DY+LG NPM MSYLVGYG  +P+ VHHRGASI +        GC  
Sbjct  385  VGPHEMLAFAKSQVDYILGSNPMAMSYLVGYGPKFPRRVHHRGASIESYGENKGFIGCTQ  444

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV +G LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  445  GYDNWYGRVEPNPNVLIGALVGGPDIKDQFKDERRNYVQTEACTYNTAALVGVFARL  501



>ref|XP_007131338.1| hypothetical protein PHAVU_011G005500g [Phaseolus vulgaris]
 gb|ESW03332.1| hypothetical protein PHAVU_011G005500g [Phaseolus vulgaris]
Length=417

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +MC  LP SPT + S +  GL++    + LQH  + +FL +VY+ YM + +   I C  +
Sbjct  236  LMCSFLPNSPTKSVSYSKGGLLFKPGGSNLQHATSMSFLLIVYARYMNAVKKT-IPCGQQ  294

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT----TGCK  420
               P+ L   A  QADY+LG NPM MSY+VG+G  +PK +HHRG+ IP+  T     GC+
Sbjct  295  VVNPNTLINIAKHQADYILGKNPMGMSYMVGFGSKFPKKIHHRGSVIPSLDTHPQHVGCR  354

Query  419  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            DG K+ +S +PNPNV  G +VGGP  ++++ DSR+   Q+EPTTY +A  VG+L+ L
Sbjct  355  DGDKFFKSDEPNPNVLTGAVVGGPAFDDSFQDSRSIITQSEPTTYINAPFVGVLAYL  411



>gb|EYU26799.1| hypothetical protein MIMGU_mgv1a020424mg [Erythranthe guttata]
Length=458

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 111/177 (63%), Gaps = 7/177 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  + K       +T  GL+W   W+ LQ+  +++F+   Y+DY+  +R A + C G  
Sbjct  282  ICNCIQKG-NGNFQKTKGGLLWFLPWSNLQYVNSASFIMSAYADYLSKAR-ATLRCAGGA  339

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGA---SIPTDAT-TGCKD  417
              P+DL  FA SQ DY+LG+NP ++SY+VG+G NYPK VHHRGA   SI  D T  GC+D
Sbjct  340  VGPNDLISFARSQVDYILGNNPKRLSYMVGFGSNYPKRVHHRGASIVSIKKDRTRVGCQD  399

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF  W      NPNV  G +VGGP  ++ Y D+RNN  QAEP+T N+A +VG+L+ L
Sbjct  400  GFNNWYNRNADNPNVITGAIVGGPDQSDQYTDARNNYQQAEPSTANNAPLVGVLARL  456



>ref|XP_008805594.1| PREDICTED: endoglucanase 11-like [Phoenix dactylifera]
Length=424

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 104/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+  +   RT  GL+++ QWN +Q+   +AFL  +YSDY+   R  ++ C    
Sbjct  230  ICACLDKNNGSNVDRTPGGLLYVRQWNNMQYVSGAAFLLTIYSDYLTELRR-ELHCPDGV  288

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
              P +L   A SQADY+LG NPM +SYLVGYG  YP+ VHHRGAS+     +    GC  
Sbjct  289  VKPGELLALARSQADYILGSNPMGISYLVGYGPRYPRKVHHRGASVVSYKESKGFVGCTQ  348

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    Q NPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  349  GYDDWYHRRQANPNVLVGALVGGPDFQDNFSDDRGNYMQTEACTYNTAPMVGVFARL  405



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQW--NALQHPVASAFLAVVYSDYMLSSRTAKITCD  594
            +MC  LP     + +RT  GL+ ++      LQ+ V +AFLA +YSDY+ ++ T    C 
Sbjct  30   IMCSYLPV--FTSFNRTKGGLIQLNHGRPQPLQYVVNAAFLATLYSDYLDAADTPGWYCG  87

Query  593  GKYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP-TDATTGCKD  417
              +Y+   LR+FA +Q DY+LG NP KMSY+VG+G++YPK+VHHRGASIP T     CK 
Sbjct  88   PNFYSTDKLREFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKTKVKYNCKG  147

Query  416  GFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+KW ++++PNPN+ VG +V GP  ++ + D R+N    EPT   +A +V  L  L
Sbjct  148  GWKWRDTSKPNPNILVGAMVAGPDRHDGFHDVRSNYNYTEPTLAGNAGLVAALVAL  203



>ref|XP_006283596.1| hypothetical protein CARUB_v10004652mg [Capsella rubella]
 gb|EOA16494.1| hypothetical protein CARUB_v10004652mg [Capsella rubella]
Length=496

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -2

Query  770  AVMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDG  591
            + MC L+P+SP      T +GL++    + LQH    +F+ +VY+ Y LS  +  + C  
Sbjct  313  SFMCSLVPESPGPHVEYTPAGLLYKPGGSQLQHATTISFILLVYAQY-LSRSSLSLNCGT  371

Query  590  KYYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA----TTGC  423
                P  LR+ A  Q DY+LG+NPM +SY+VGYG+ YPK +HHRG+S+P+ A      GC
Sbjct  372  LTVPPDYLRRLAKKQVDYILGENPMGLSYMVGYGERYPKRIHHRGSSLPSIADHPGAIGC  431

Query  422  KDGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            KDG  +  ST+PNPNV +G +VGGP  ++TY D+R++  ++EPTTY +A  VG+L+
Sbjct  432  KDGSLYFNSTEPNPNVLIGAVVGGPGEDDTYDDNRSDFRKSEPTTYINAPFVGVLA  487



>gb|EYU26800.1| hypothetical protein MIMGU_mgv1a019325mg [Erythranthe guttata]
Length=474

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 109/177 (62%), Gaps = 7/177 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  + K   +   RT  GL+W  QW+ LQ+  +++F+   Y+DY LS     I C    
Sbjct  298  ICNCIQKG-YSNVQRTSGGLLWFLQWSNLQYVTSASFIITAYADY-LSKTHKNIQCASGI  355

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P+DL  FA SQ DY+LG NP  MSY+VG+G NYPK VHHRGASI +         C++
Sbjct  356  VGPNDLMAFAKSQVDYMLGSNPKNMSYMVGFGSNYPKQVHHRGASIVSIKKDSRPMSCQE  415

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            GF +W  + Q NPNV  G +VGGP  ++ Y D+R+N  QAEP+T N+A +VG+L+ L
Sbjct  416  GFEEWFHNNQENPNVLTGAIVGGPDRSDQYTDARDNYQQAEPSTANNAPLVGVLARL  472



>gb|KHN38252.1| Endoglucanase 11 [Glycine soja]
Length=515

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L  +      RT  GL++I QWN +Q+   ++FL  VYSD++L++   K+ C    
Sbjct  325  LCACLNLNNITNVERTPGGLLYIRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGE  383

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQ DY+LG NPM MSYLVGYG  +P+ VHHRGASI +        GC  
Sbjct  384  VGPHEMLAFAKSQVDYILGTNPMAMSYLVGYGPKFPQKVHHRGASIESYGENKGFIGCTQ  443

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV +G LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  444  GYDNWYGRVEPNPNVLIGALVGGPDIKDQFKDERRNYIQTEACTYNTAALVGVFARL  500



>ref|XP_003518530.1| PREDICTED: endoglucanase 11-like [Glycine max]
Length=515

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L  +      RT  GL++I QWN +Q+   ++FL  VYSD++L++   K+ C    
Sbjct  325  LCACLNLNNITNVERTPGGLLYIRQWNNMQYVATASFLLTVYSDHLLAT-DQKLHCQKGE  383

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  FA SQ DY+LG NPM MSYLVGYG  +P+ VHHRGASI +        GC  
Sbjct  384  VGPHEMLAFAKSQVDYILGTNPMAMSYLVGYGPKFPQKVHHRGASIESYGENKGFIGCTQ  443

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    +PNPNV +G LVGGP + + + D R N +Q E  TYN+A +VG+ + L
Sbjct  444  GYDNWYGRVEPNPNVLIGALVGGPDIKDQFKDERRNYIQTEACTYNTAALVGVFARL  500



>ref|XP_009361039.1| PREDICTED: endoglucanase 11-like [Pyrus x bretschneideri]
Length=508

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            MC  L K+      RT  GL++I QWN +Q+   +AFL  +YSDY+ +S    +TCD   
Sbjct  315  MCACLDKNNVTNVQRTPGGLLYIRQWNNMQYVSNAAFLLTIYSDYIQASH-HNLTCDKGQ  373

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P ++  F  SQ +Y+LG NP  MSYLVGYG  YP+ +HHRGAS+ +        GC  
Sbjct  374  VGPQEILSFTKSQVNYILGSNPTGMSYLVGYGPKYPRRLHHRGASVDSYKKNKGFIGCTQ  433

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP  N+ + D R N MQ E  TYN+A +VG+L+ L
Sbjct  434  GYDNWYGRQGPNPNVLVGALVGGPDGNDGFRDERWNYMQTEACTYNTATLVGVLAKL  490



>ref|XP_010688721.1| PREDICTED: endoglucanase 5 [Beta vulgaris subsp. vulgaris]
Length=639

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 105/176 (60%), Gaps = 6/176 (3%)
 Frame = -2

Query  761  CGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYY  582
            C +L K+       T  GLV++ QWN +Q+  ++AFL  VYSDY LS   A + C     
Sbjct  321  CSILQKNNDYDVQLTPGGLVYVRQWNNMQYASSAAFLIAVYSDY-LSQGKAVVNCPEGTM  379

Query  581  TPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDG  414
             P DL  FA SQADY+LG NP  +SYLVG+G NYP  VHHRGASI      +A  GC  G
Sbjct  380  KPQDLLNFAQSQADYILGKNPKSISYLVGFGKNYPTQVHHRGASIAAISVHNAQVGCVQG  439

Query  413  F-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            F +W   +  NPNV  GGLVGGP  N+ Y + R+N  Q EPT   +A ++GL S L
Sbjct  440  FEEWYHRSSANPNVVHGGLVGGPDNNDEYDNDRSNYEQTEPTLSGTAPLIGLFSKL  495



>ref|XP_006452448.1| hypothetical protein CICLE_v10007984mg [Citrus clementina]
 gb|ESR65688.1| hypothetical protein CICLE_v10007984mg [Citrus clementina]
Length=529

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 103/177 (58%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+      RT  GL++I QWN +Q+   +AFL  VY DY L S    + CD   
Sbjct  336  LCACLNKNNETNVDRTPGGLLYIRQWNNMQYVSTAAFLLTVYGDY-LQSTNQTLKCDRGT  394

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
             TP +L  FA SQ DY+LG NPM +SYLVGYG  +P+ +HHRG S  +        GC  
Sbjct  395  LTPQELFDFAKSQVDYILGSNPMAVSYLVGYGSKFPQRMHHRGGSTVSYKQDQGFIGCTQ  454

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W +   PNPNV VG LVGGP   + + D R+N +Q E  TYN+A +VG+ + L
Sbjct  455  GYDDWFKRLDPNPNVVVGALVGGPDEKDQFRDERSNFVQTEACTYNTATLVGVFAKL  511



>ref|XP_007142327.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
 gb|ESW14321.1| hypothetical protein PHAVU_008G270900g [Phaseolus vulgaris]
Length=515

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L  +  +   RT  GL++  +WN +Q+   ++FL  +YSD++ ++   K+ C    
Sbjct  322  LCACLNLNNVSNVERTPGGLLYTREWNNMQYVATASFLLTLYSDHLQATHQ-KLQCHRGE  380

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDATT----GCKD  417
              P  +  FA SQ DY+LG NPM MSYLVGYG N+PK VHHRGASI +        GC  
Sbjct  381  VGPHQMFAFAKSQVDYILGSNPMAMSYLVGYGPNFPKRVHHRGASIESSKENKGFIGCVQ  440

Query  416  GFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W    QPNPNV +G LVGGP   + + D R N +Q EP TYN+A +VG+ + L
Sbjct  441  GYDTWYGRVQPNPNVLIGALVGGPDRKDQFKDERQNYIQTEPCTYNTAALVGVFARL  497



>gb|KEH29369.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=470

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (65%), Gaps = 5/175 (3%)
 Frame = -2

Query  767  VMCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            ++C LLP SPT + + +  GL++ +  + LQH  A +FL VVY  YM  +    + C   
Sbjct  292  LICSLLPNSPTKSVTYSKGGLLFKAGPSNLQHVTALSFLLVVYGHYM-EANNKIVNCGNV  350

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCK  420
               P DL   A SQ DYVLG+NP++MSY+VGYG  YP+ +HHRG+++P+        GC+
Sbjct  351  VAKPCDLINLAKSQVDYVLGNNPLEMSYMVGYGQKYPQKIHHRGSTLPSLDVHPKHMGCR  410

Query  419  DGFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            DG K+ +S+ PN NV +G +VGGP  ++++ DSR N  Q+EPTTY +A  VG+L+
Sbjct  411  DGDKYFQSSTPNINVLIGAIVGGPANDDSFQDSRYNVSQSEPTTYINAPFVGVLA  465



>ref|XP_004491466.1| PREDICTED: endoglucanase 11-like [Cicer arietinum]
Length=519

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 109/178 (61%), Gaps = 7/178 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L  +      RT  GL++I QWN +Q+   +AFL  +YSD++L++   K+ C    
Sbjct  323  ICSCLNLNKVNNVERTPGGLLYIRQWNNMQYVANAAFLLTIYSDHLLAN-NQKLHCQKNE  381

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDAT-----TGCK  420
              P+++  FA SQ DY+LG NPM +SYLVGYG  +P+ VHHRGASI +         GC 
Sbjct  382  VGPNEIFAFAKSQVDYILGSNPMGISYLVGYGPKFPQRVHHRGASIKSYNKGNMDFIGCT  441

Query  419  DGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
             G++ W ES++PNPN+ +G LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  442  QGYENWYESSEPNPNILIGALVGGPDNKDLFKDERRNYEQMEACTYNTAALVGVFARL  499



>ref|XP_006447630.1| hypothetical protein CICLE_v10014884mg [Citrus clementina]
 ref|XP_006469628.1| PREDICTED: endoglucanase 11-like [Citrus sinensis]
 gb|ESR60870.1| hypothetical protein CICLE_v10014884mg [Citrus clementina]
 gb|KDO54286.1| hypothetical protein CISIN_1g009690mg [Citrus sinensis]
Length=528

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 103/177 (58%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K+  +   RT  GL++I  WN +Q+   +AFL  +YSD +L S    + C+G+ 
Sbjct  336  ICSCLNKNNGSNVDRTRGGLLYIRPWNNMQYVSTAAFLLTIYSDLLLDSNQP-LNCNGEI  394

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
                ++  FA SQ DY+LG NPM MSYLVGYG  YP  VHHRGASI          GC  
Sbjct  395  VGHQEILSFAKSQVDYILGSNPMNMSYLVGYGPKYPTRVHHRGASIVSYRENKGFIGCTQ  454

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W      NPNV VG LVGGP   + ++D RNN MQ E  TYN+A +VG+ + L
Sbjct  455  GYDNWYSRVDQNPNVIVGALVGGPDWRDNFMDQRNNYMQTEACTYNTAPLVGVFAKL  511



>ref|XP_004491112.1| PREDICTED: endoglucanase 11-like [Cicer arietinum]
Length=532

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 107/176 (61%), Gaps = 7/176 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATS-SRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGK  588
            +C  L K+   ++  RT +GL++I QWN +Q+   ++FL  +YSD+ L +   K+TC   
Sbjct  335  ICSCLNKNINGSNVERTPAGLLYIRQWNNMQYVSTASFLLTIYSDF-LKNTNQKLTCHEG  393

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCK  420
                 ++  FA SQ DY+LG NPM MSYLVG+G +YPK VHHRGASI          GC 
Sbjct  394  IVDHEEILSFAKSQVDYILGSNPMNMSYLVGFGPSYPKRVHHRGASIMSYKENKGFIGCT  453

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
             G+  W  S  PNPNV +G LVGGP   + + D R+N MQ E  TYN+A +VGL +
Sbjct  454  QGYDNWYSSEDPNPNVLIGALVGGPDWEDNFEDRRSNFMQTEACTYNTAPLVGLFA  509



>ref|XP_003526224.2| PREDICTED: endoglucanase 8-like [Glycine max]
Length=486

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C LLP SPT + S +  GL++    + LQH  A +FL +VY+ YM S++   +TC  + 
Sbjct  306  ICSLLPSSPTKSVSYSKGGLLFKPGGSNLQHTTALSFLLIVYARYMQSAKKT-VTCGNEV  364

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKD  417
              P+ L   A SQ DY+LG NP+ MSY+VGYG  YPK +HHRG+++P+         C++
Sbjct  365  ADPARLINLAKSQVDYILGKNPLGMSYMVGYGAKYPKKIHHRGSTLPSVNMHPQHIQCRE  424

Query  416  GFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            G ++ +S +PNPN+  G +VGGP  ++++ DSR N  Q+EPTTY +A  VGLL+
Sbjct  425  GDQYFKSEKPNPNILTGAVVGGPAEDDSFQDSRYNVGQSEPTTYINAPFVGLLA  478



>ref|XP_008460200.1| PREDICTED: endoglucanase 13-like [Cucumis melo]
Length=492

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 106/179 (59%), Gaps = 11/179 (6%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C  L K   +   +T +GL+W   WN LQ+  ++ FLA VYSDY LSS+   I C G  
Sbjct  317  LCSCLQKG-NSNVQKTPAGLLWFQPWNNLQYVTSATFLATVYSDY-LSSKGVSIQCPGGL  374

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI------PTDATTGC  423
              PSDL  FA SQ DY+LG NP  MSY+VG+G  YP  VHHRGASI      PT  T  C
Sbjct  375  VQPSDLISFAKSQVDYILGSNPSGMSYMVGFGSKYPTQVHHRGASIVSIKRDPTLVT--C  432

Query  422  KDGFK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            + GF  W     PNPNV  G +VGGP  N+ Y DSR+N   AEP T   A +VG+L+ L
Sbjct  433  QGGFNLWFNRNAPNPNVLHGAVVGGPDPNDAYWDSRSNFKTAEPATVTPAPLVGVLARL  491



>ref|XP_008449473.1| PREDICTED: endoglucanase 11 [Cucumis melo]
Length=623

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 103/177 (58%), Gaps = 6/177 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C +L K+  +   RT +GL++I QWN +Q+   ++FL  VYSDY+  S   ++ C    
Sbjct  427  LCTILNKNNASNVDRTPAGLLFIRQWNNMQYVSTASFLLTVYSDYLRRS-NLRLNCPMGS  485

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASI----PTDATTGCKD  417
              P DL  FA  Q DY+LG NPM MSY VG+G  +P  VHHRGASI       A  GC  
Sbjct  486  VDPDDLFIFAKQQIDYILGSNPMNMSYFVGFGSKFPTRVHHRGASIVSYRENKAFIGCTQ  545

Query  416  GF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            G+  W     PNPNV VG LVGGP   + + D R N MQ E  TYN+A +VG+ + L
Sbjct  546  GYDNWYGKGDPNPNVVVGALVGGPDCQDNFADERGNYMQTEACTYNTAPLVGIFAKL  602



>ref|XP_009351718.1| PREDICTED: endoglucanase 5 [Pyrus x bretschneideri]
Length=628

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 107/176 (61%), Gaps = 6/176 (3%)
 Frame = -2

Query  761  CGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYY  582
            C  L K+      +T  GL+++ +WN LQ+  ++AFL  VYSDY LS+  AK+ C     
Sbjct  321  CACLQKNDGYNVQKTPGGLLYVREWNNLQYVTSAAFLLAVYSDY-LSAANAKLACPDGQA  379

Query  581  TPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDG  414
             P +L  FA SQADY+LG NP  MSY+VG G NYP +VHHRGASIP+     +   C  G
Sbjct  380  QPQELLNFAKSQADYILGKNPKSMSYIVGIGQNYPVHVHHRGASIPSVFTLHSAVECVQG  439

Query  413  FK-WLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            F+ W   T+ NPNV  G LVGGP  N+ + D R++  Q EPT   +  +VGLLS L
Sbjct  440  FEMWYHRTEANPNVIYGALVGGPDQNDYFSDDRSSYEQTEPTLSGTGPLVGLLSKL  495



>ref|XP_003579470.1| PREDICTED: endoglucanase 13 [Brachypodium distachyon]
Length=612

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYM-LSSRTAKITCDGK  588
            +C  L K+       T +GL++++ WN +Q+  +SAFL  VY+DY+ +S R  ++ C   
Sbjct  321  LCACLQKNGGNNVRTTPAGLLYVADWNNMQYVTSSAFLLAVYADYLAVSGR--QLKCPDG  378

Query  587  YYTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIP----TDATTGCK  420
              +PS++ +F   Q DYVLGDNP  MSY+VGYG+N+P+ VHHRGASIP     +   GC 
Sbjct  379  EVSPSEMIRFVRRQVDYVLGDNPASMSYMVGYGENFPRRVHHRGASIPAVGSVNGIVGCM  438

Query  419  DGF-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            DGF ++  + + +PNV  G LVGGP  N+ ++D R N  +AEPT   +A IVG+ + L
Sbjct  439  DGFDRFYNTKEADPNVLYGALVGGPDANDAFVDDRCNYQRAEPTIATAAPIVGVFARL  496



>gb|AET00580.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=504

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 6/176 (3%)
 Frame = -2

Query  761  CGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKYY  582
            C  L  +      RT  GL++I QWN +Q+   +AFL  +YSD++L++   K+ C     
Sbjct  326  CLNLNNASKDNVDRTPGGLLYIRQWNNMQYVANAAFLLAIYSDHLLAT-NQKLHCQKGEV  384

Query  581  TPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPT----DATTGCKDG  414
             P++L  FA SQ DY+LG NPM MSYLVGYG N+P+ VHHRGAS  +        GC  G
Sbjct  385  GPNELLAFAKSQVDYILGSNPMGMSYLVGYGSNFPQRVHHRGASTESYKGNMGFIGCTQG  444

Query  413  F-KWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLSGL  249
            +  W ES +PNPN+ +G LVGGP   + + D R N  Q E  TYN+A +VG+ + L
Sbjct  445  YDNWYESPKPNPNILIGALVGGPDNKDQFRDERRNFEQLEACTYNTAALVGVFARL  500



>gb|KGN50329.1| hypothetical protein Csa_5G167210 [Cucumis sativus]
Length=430

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 115/174 (66%), Gaps = 5/174 (3%)
 Frame = -2

Query  764  MCGLLPKSPTATSSRTDSGLVWISQWNALQHPVASAFLAVVYSDYMLSSRTAKITCDGKY  585
            +C +LP+SP+   S +  GL++ S  + +QH  A +FL +VYS+Y L+     + C    
Sbjct  251  VCSVLPESPSLLVSYSRGGLLFKSGGSNIQHSTALSFLLIVYSNY-LNQYKHILHCGNVV  309

Query  584  YTPSDLRKFAMSQADYVLGDNPMKMSYLVGYGDNYPKYVHHRGASIPTDA----TTGCKD  417
             +PS L + A +Q DY+LG NP+ MSY+VGYG N+P+ +HHRG+S+P+ A      GC  
Sbjct  310  ASPSRLLQLAKTQVDYILGSNPLGMSYMVGYGKNFPQRIHHRGSSLPSMANYPQAIGCAK  369

Query  416  GFKWLESTQPNPNVAVGGLVGGPFLNETYIDSRNNSMQAEPTTYNSAIIVGLLS  255
            G ++ +S  PNPN+ +G +VGGP  N++Y DSR + + +EPTTY +A +VGLL+
Sbjct  370  GKQYFQSNNPNPNLLIGAVVGGPDFNDSYADSRPDFVYSEPTTYINAPLVGLLA  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272